BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4337
         (672 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|B96530|B96530 Similar to CCS1 [imported] - Arabidopsis thali...   155   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AC107207_1738360 Oryza sativa chromosome 3 BAC OSJNBb0106M04 ...   152   5e-36   
gb:AF079137_477116 Synechococcus PCC6301 ApcC (apcC), FtsW (ftsW...    85   1e-15   
gb:BA000039_726466 Thermosynechococcus elongatus BP-1 DNA, compl...    79   5e-14   
pir|S75114|S75114 hypothetical protein slr2087 - Synechocystis s...    77   4e-13   Synechocystis sp. PCC 6803
gb:BA000045_742096 Gloeobacter violaceus PCC 7421 DNA, complete ...    76   6e-13   
pir|AD2196|AD2196 c-type cytochrome biogenesis protein Ccs1 [imp...    75   8e-13   Nostoc sp. PCC 7120
gb:AY673996_1621378 Gracilaria tenuistipitata var. liui chloropl...    70   3e-11   
sp|O78437|YC44_GUITH|YC44_GUITH Hypothetical 47.8 kDa protein ycf44.>gb:AF0...    70   4e-11   Guillardia theta
gb:AF052290_473549 Synechococcus PCC7002 succinate dehydrogenase...    69   6e-11   
sp|P49539|YC44_ODOSI|YC44_ODOSI Hypothetical 43.8 kDa protein ycf44 (ORF382...    69   7e-11   
gb:AY095303S2_1575810 Chlamydomonas reinhardtii c-type cytochrom...    69   1e-10   
gb:AY095301S2_1575809 Chlamydomonas reinhardtii c-type cytochrom...    69   1e-10   
pir|T09105|T09105 holocytochrome c-type forming protein Ccs1, ch...    69   1e-10   Chlamydomonas reinhardtii
gb:BX572093_797086 Prochlorococcus marinus MED4 complete genome;...    55   8e-07   
gb:BX572099_798819 Prochlorococcus marinus MIT9313 complete geno...    55   1e-06   
gb:BX569690_775373 Synechococcus sp. WH8102 complete genome; seg...    53   4e-06   
sp|P51363|YC44_PORPU|YC44_PORPU Hypothetical 50.2 kDa protein ycf44 (ORF437...    50   5e-05   Porphyra purpurea
gb:AE017165_396068 Prochlorococcus marinus subsp. marinus str. C...    45   9e-04   
gb:CR522870_100527 Desulfotalea psychrophila LSv54 chromosome.         41   0.022   
sp|O19913|YC44_CYACA|YC44_CYACA Hypothetical 45.3 kDa protein ycf44.>pir|T1...    36   0.69    Cyanidium caldarium
gb:AL607122_1930984 Human DNA sequence from clone RP11-511I2 on ...    35   1.5     
gb:BX649606_1643487 Aspergillus fumigatus BAC pilot project supe...    34   2.0     
sp|O60548|FXD2_HUMAN|FXD2_HUMAN Forkhead box protein D2 (Forkhead-related p...    34   2.6     Homo sapiens [man]
gb:BA000030_701483 Streptomyces avermitilis MA-4680 genomic DNA,...    33   3.4     
gb:AY204400_597050 Leptospirillum ferrooxidans Lfe152p1 gene, pa...    33   3.4     
gb:CP000009_862427 Gluconobacter oxydans 621H, complete genome.        33   5.9     
gb:CR378677_97493 Photobacterium profundum SS9 chromosome 2; seg...    33   5.9     
pir|G83469|G83469 hypothetical protein PA1408 [imported] - Pseud...    33   5.9     Pseudomonas aeruginosa
gb:BC052781_1984866 Homo sapiens RAN binding protein 9, mRNA (cD...    32   7.7     
gb:AB055311_1868318 Homo sapiens mRNA for RanBPM, complete cds.>...    32   7.7     
gb:AE017348_1758311 Cryptococcus neoformans var. neoformans JEC2...    32   7.7     
gb:AY772713_1628173 'Chlorella' zofingiensis beta-carotene ketol...    32   7.7     
gb:AE017283_430114 Propionibacterium acnes KPA171202, complete g...    32   7.7     


>pir|B96530|B96530 Similar to CCS1 [imported] - Arabidopsis
           thaliana>gb:AE005173_892873 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007504_1535866 Arabidopsis thaliana
           chromosome I BAC F13F21 genomic sequence, complete
           sequence.>gb:AK117293_1815334 Arabidopsis thaliana
           At1g49380 mRNA for unknown protein, complete cds, clone:
           RAFL16-85-B03.
          Length = 547

 Score =  155 bits (392), Expect = 6e-37
 Identities = 91/201 (45%), Positives = 119/201 (59%), Gaps = 4/201 (1%)
 Frame = +2

Query: 80  NPK-LNFTFIPHFSLRNSRIYGVYRDKGQNFSFTLSCKLNTTRKKQGAKENSAPSKI--- 247
           NPK L+F+ I  FS  +S     Y  + +N S   +CKL   +K Q   + S+ ++    
Sbjct: 6   NPKILHFSKIHPFSRPSS-----YLCRTRNVSLITNCKL---QKPQDGNQRSSSNRNLTK 57

Query: 248 RVPESDGAPTLLDAGDAGNXXXXXXXXXXXXXXXXXXXXXXXXXXXVVASLSSLTXAISE 427
            +  SD AP + +    G                            V++ LS+L  AI+E
Sbjct: 58  TISLSDSAPPVTEETGDGIVKGGGNGGGGGGDGRGGLGFLKILPRKVLSVLSNLPLAITE 117

Query: 428 MFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHMFSSPIFLGTS 607
           MF +A LMA+G++IEQGE PDFYFQK+PED+P+ GFF WRW+ TLG DHM+S+PIFLG  
Sbjct: 118 MFTIAALMALGTVIEQGETPDFYFQKYPEDNPVLGFFTWRWISTLGLDHMYSAPIFLGML 177

Query: 608 ALLAASLMACTYTTQIPLVKV 670
            LLAASLMACTYTTQIPLVKV
Sbjct: 178 VLLAASLMACTYTTQIPLVKV 198



>gb:AC107207_1738360 Oryza sativa chromosome 3 BAC OSJNBb0106M04
           genomic sequence, complete sequence.>gb:AC133450_1741472
           Oryza sativa chromosome 3 BAC OSJNBa0072F13 genomic
           sequence, complete sequence.
          Length = 564

 Score =  152 bits (384), Expect = 5e-36
 Identities = 69/91 (75%), Positives = 82/91 (90%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           LS+L  AISEMFA+A LMA+G++I+QGEAP +YF+KFPED+P+FGF  WRW+LT GFDHM
Sbjct: 122 LSNLPLAISEMFAIAALMALGTVIDQGEAPSYYFEKFPEDNPVFGFITWRWILTPGFDHM 181

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
           FSSP+FLG  ALLAASLMACTYTTQIP+VKV
Sbjct: 182 FSSPVFLGLLALLAASLMACTYTTQIPIVKV 212



>gb:AF079137_477116 Synechococcus PCC6301 ApcC (apcC), FtsW (ftsW),
           CcdA (ccdA), Ccs1 (ccs1), and nitrogen regulatory
           protein P-II (glnB) genes, complete
           cds.>gb:AP008231_580886 Synechococcus elongatus PCC 6301
           DNA, complete genome.
          Length = 456

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 40/90 (44%), Positives = 58/90 (64%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           L+ L  AI  + A+A   A G++IEQG++  FY + +P D  LFGF +WRW+L+LG DH+
Sbjct: 26  LADLRLAILLLLAIAIASATGTVIEQGQSLAFYQENYPTDPALFGFLSWRWILSLGLDHV 85

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           + +  FLG   L  ASL ACT+  Q P ++
Sbjct: 86  YRAGWFLGLLILFGASLTACTFRRQWPALR 115



>gb:BA000039_726466 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 442

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/91 (42%), Positives = 55/91 (60%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLG 565
           V+A L  L  AI  +  +A     G++IEQG++  FY   +PE+  LFGF +WR +L LG
Sbjct: 10  VLALLGDLRLAILLLLVIAIASMAGTVIEQGQSLSFYQANYPENPALFGFLSWRVLLALG 69

Query: 566 FDHMFSSPIFLGTSALLAASLMACTYTTQIP 658
            DH++ +P +L    L  ASL ACT T Q+P
Sbjct: 70  LDHVYRTPWYLTLLVLFGASLTACTLTRQVP 100



>pir|S75114|S75114 hypothetical protein slr2087 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688755 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 458

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 37/91 (40%), Positives = 56/91 (61%)
 Frame = +2

Query: 395 SLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDH 574
           +L+ L  AI+ +  +A     G++IEQGE+  FY Q +PED  LFGF +W+ +L LG + 
Sbjct: 22  TLADLRLAIALLLLIAVFSISGTVIEQGESLSFYQQNYPEDPALFGFLSWQVILQLGLNQ 81

Query: 575 MFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           ++ +  FLG   L  +SL ACT+  Q P +K
Sbjct: 82  VYRTWWFLGLLILFGSSLTACTFNRQFPALK 112



>gb:BA000045_742096 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 474

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 1/95 (1%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPL-FGFFNWRWVLTL 562
           V A L SL  AI    A+A     G++I QGE+ DFY Q +P+   + +GF  WR++++L
Sbjct: 29  VAAWLGSLKLAIGLFLAIAAASIAGTVIPQGESTDFYRQNYPDSGAVVWGFVTWRFIISL 88

Query: 563 GFDHMFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           G D ++ S  F+    LLA SL  CT+  QIP++K
Sbjct: 89  GLDEVYRSWWFVALLLLLATSLTICTFRRQIPMLK 123



>pir|AD2196|AD2196 c-type cytochrome biogenesis protein Ccs1
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:AF136760_482318 Anabaena PCC7120 putative
           c-type cytochrome biogenesis protein CcdA (ccdA), c-type
           cytochrome biogenesis protein Ccs1 (ycf44), and XisI
           (xisI) genes, complete cds; and heme oxygenase (ho)
           gene, partial cds.>gb:BA000019_684112 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 461

 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 35/90 (38%), Positives = 53/90 (58%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           L+ L  AI+ +  +A     G++IEQG++P FY   +PE   LFGF  W+ +  +G DH+
Sbjct: 29  LTDLRLAIALLLIIALFSISGTVIEQGQSPAFYQSNYPEHPALFGFLTWKVIQVVGLDHV 88

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           + +  FL    L   SL ACT+T Q+P +K
Sbjct: 89  YRTWWFLSLLVLFGTSLTACTFTRQLPALK 118



>gb:AY673996_1621378 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 435

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 33/91 (36%), Positives = 58/91 (63%), Gaps = 1/91 (1%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFG-FFNWRWVLTLGFDH 574
           LS+L+ +IS +  +A +  IG+IIEQ ++  +Y   +P ++  FG   NW+ +L LG DH
Sbjct: 14  LSNLSLSISLLLLIASISIIGTIIEQNQSIVYYQMNYPINNQPFGRIMNWKIILNLGLDH 73

Query: 575 MFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           ++ +P F+    L   SL+ACT++ Q+P ++
Sbjct: 74  IYLNPCFVLVLVLFFCSLLACTFSNQLPSLR 104



>sp|O78437|YC44_GUITH Hypothetical 47.8 kDa protein
           ycf44.>gb:AF041468_1763491 Guillardia theta complete
           plastid genome.
          Length = 414

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 36/91 (39%), Positives = 54/91 (59%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           L++LT AI  + A+A   A+G++IEQ +  DFY + +P   PLF F     +L  G DH+
Sbjct: 11  LNNLTVAIIILLAIALASALGTVIEQNKNTDFYLKNYPLTKPLFNFVTSDLILKFGLDHV 70

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
           ++S  F+    LL  SL  CT T Q+P +K+
Sbjct: 71  YTSWWFIFLIILLLLSLTLCTITRQLPALKL 101



>gb:AF052290_473549 Synechococcus PCC7002 succinate dehydrogenase
           iron-sulfur protein subunit (sdhB), ycf4 gene,
           peptidyl-prolyl cis-trans isomerase B (ppiB), ycf36
           gene, putative c-type cytochrome biogenesis protein
           (ccdA), and c-type cytochrome biogenesis protein (ycf44)
           genes, complete cds; and unknown genes.
          Length = 462

 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 31/90 (34%), Positives = 54/90 (60%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           ++ L  AI+ +  ++    +G++IEQG    FY + +PED  L GF +W+ +L LG DH+
Sbjct: 27  IADLRVAIALLLLISVFSILGTVIEQGSTIQFYQENYPEDPALLGFLSWKVLLGLGLDHV 86

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           +++  +L        SL+ACT+  Q+P +K
Sbjct: 87  YTTWWYLVLLLAFGVSLIACTFRRQLPALK 116



>sp|P49539|YC44_ODOSI Hypothetical 43.8 kDa protein ycf44
           (ORF382).>pir|S78285|S78285 conserved hypothetical
           protein 382 - Odontella sinensis
           chloroplast>gb:OSCHLPLXX_1692870 Odontella sinensis
           complete chloroplast genome.
          Length = 382

 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 34/95 (35%), Positives = 53/95 (55%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLG 565
           V+  L+ L  AIS +  +A    IG++IEQ ++ + Y   +P  + +FGF +W  +L  G
Sbjct: 5   VLRFLADLRFAISILLIIASCSVIGTVIEQDQSIEIYKLNYPLTNRIFGFLSWDIILKFG 64

Query: 566 FDHMFSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
            DH++ +  FLG  AL   SL  CT   Q P +K+
Sbjct: 65  LDHVYKTWWFLGFIALFGLSLFTCTILQQFPSLKI 99



>gb:AY095303S2_1575810 Chlamydomonas reinhardtii c-type cytochrome
           synthesis 1 (CCS1) gene, ccs1-ac206 allele, exons 7, 8
           and 9, 3'UTR and complete cds.
          Length = 649

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPED-HPLFGFFNWRWVLTL 562
           ++  LSSL  AI+ M  +A L  +G+ I Q ++ ++Y   +P+    + GF     +LTL
Sbjct: 115 LMKELSSLPRAIAIMALIAVLSGLGTFIPQNKSIEYYLVNYPDGAEKVLGFLTGDLILTL 174

Query: 563 GFDHMFSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
             DH++++  F  +  LLAASL ACTYT Q P VKV
Sbjct: 175 QLDHIYTADYFYLSMGLLAASLAACTYTRQWPAVKV 210



>gb:AY095301S2_1575809 Chlamydomonas reinhardtii c-type cytochrome
           synthesis 1 (CCS1) gene, ccs1-2 allele, exons 8; 9, 10
           and complete cds.
          Length = 613

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPED-HPLFGFFNWRWVLTL 562
           ++  LSSL  AI+ M  +A L  +G+ I Q ++ ++Y   +P+    + GF     +LTL
Sbjct: 115 LMKELSSLPRAIAIMALIAVLSGLGTFIPQNKSIEYYLVNYPDGAEKVLGFLTGDLILTL 174

Query: 563 GFDHMFSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
             DH++++  F  +  LLAASL ACTYT Q P VKV
Sbjct: 175 QLDHIYTADYFYLSMGLLAASLAACTYTRQWPAVKV 210



>pir|T09105|T09105 holocytochrome c-type forming protein Ccs1,
           chloroplast - Chlamydomonas
           reinhardtii>gb:AY095298_1575807 Chlamydomonas
           reinhardtii strain CC125 c-type cytochrome synthesis 1
           (ccs1) gene, complete cds.>gb:CRU70999_1673726
           Chlamydomonas reinhardtii CCS1 mRNA, complete
           cds.>gb:CRU71000_1673727 Chlamydomonas reinhardtii CCS1
           gene, complete cds.
          Length = 613

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 1/96 (1%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPED-HPLFGFFNWRWVLTL 562
           ++  LSSL  AI+ M  +A L  +G+ I Q ++ ++Y   +P+    + GF     +LTL
Sbjct: 115 LMKELSSLPRAIAIMALIAVLSGLGTFIPQNKSIEYYLVNYPDGAEKVLGFLTGDLILTL 174

Query: 563 GFDHMFSSPIFLGTSALLAASLMACTYTTQIPLVKV 670
             DH++++  F  +  LLAASL ACTYT Q P VKV
Sbjct: 175 QLDHIYTADYFYLSMGLLAASLAACTYTRQWPAVKV 210



>gb:BX572093_797086 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 428

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 33/93 (35%), Positives = 49/93 (52%)
 Frame = +2

Query: 389 VASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGF 568
           +  +SSL  AI  +  +A    +G+ I QG     Y   F  + P+ GF N   V+ L  
Sbjct: 8   ILKISSLRFAILLIIFIAISSGVGTFIPQGNDQQEYID-FYNETPILGFINGSQVIRLQL 66

Query: 569 DHMFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           DH+++S  FL +  LL  SL AC++  QIP +K
Sbjct: 67  DHIYTSNWFLFSLILLCISLAACSFRRQIPSLK 99



>gb:BX572099_798819 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 430

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 31/94 (32%), Positives = 51/94 (54%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLG 565
           ++A +S L  AI  +  +A   A+G+ I QGE  + Y + +  D P  GF N   +L L 
Sbjct: 7   LLAWISDLRIAIGLLLVIALASALGTAIPQGELRESYLEGY-SDKPWLGFVNGSMILRLQ 65

Query: 566 FDHMFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
            DH+++S  FL   A L  +L+ C++  Q P ++
Sbjct: 66  LDHVYTSSWFLALLAWLGLALILCSWRRQWPALQ 99



>gb:BX569690_775373 Synechococcus sp. WH8102 complete genome;
           segment 2/7.
          Length = 432

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 32/90 (35%), Positives = 47/90 (52%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           LS L  AI  +  +A   A+G+ I QG+ P  Y   + E  P  G  +   VL L  DH+
Sbjct: 8   LSDLRVAIVLLLLIALASAVGTAIPQGDPPTSYVDAYAET-PWLGLLHGEQVLQLQLDHV 66

Query: 578 FSSPIFLGTSALLAASLMACTYTTQIPLVK 667
           +SS  FLG  A L  +L+ C++  Q P ++
Sbjct: 67  YSSGWFLGLLAWLGLALILCSWRRQWPALQ 96



>sp|P51363|YC44_PORPU Hypothetical 50.2 kDa protein ycf44
           (ORF437).>pir|S73284|S73284 hypothetical protein 437 -
           red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701679 Porphyra purpurea
           chloroplast, complete genome.
          Length = 437

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 26/86 (30%), Positives = 45/86 (52%)
 Frame = +2

Query: 401 SSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHMF 580
           S+L  +I  +  +A    IG+IIEQ +  DFY   +      F   NW+ +   G +H++
Sbjct: 21  SNLQFSIILLLVIASFSVIGTIIEQNKDLDFYQAHYSVSGEHFIILNWKNIELFGLNHVY 80

Query: 581 SSPIFLGTSALLAASLMACTYTTQIP 658
           ++  FL    + + SL+ C+ + QIP
Sbjct: 81  TTWWFLTLLFIFSLSLLVCSLSRQIP 106



>gb:AE017165_396068 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031737 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 429

 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 31/94 (32%), Positives = 49/94 (52%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLG 565
           ++  LSSL  AI  +  +A   A+G+ + QGE  + Y + + E     G  N   +L L 
Sbjct: 7   IINWLSSLKVAIVLLILIALGSALGTALPQGEKAESYLKNY-EVTRFLGVINGDLLLQLQ 65

Query: 566 FDHMFSSPIFLGTSALLAASLMACTYTTQIPLVK 667
            DH++SS  FL     L+ SL+ C++  Q P +K
Sbjct: 66  LDHVYSSFWFLFLLTWLSFSLIICSWKRQWPSLK 99



>gb:CR522870_100527 Desulfotalea psychrophila LSv54 chromosome.
          Length = 437

 Score = 40.8 bits (94), Expect = 0.022
 Identities = 29/81 (35%), Positives = 39/81 (48%)
 Frame = +2

Query: 398 LSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHM 577
           L+S+  AI   FALA    IG++I Q     FY +        +G F  +  L L    M
Sbjct: 11  LASVQLAIFIFFALASTSVIGTVIPQHRPMAFYLE-------AYGNFWTQIFLVLDIPEM 63

Query: 578 FSSPIFLGTSALLAASLMACT 640
           +SS  F G   LLA +L+ CT
Sbjct: 64  YSSWWFTGLLCLLALNLIICT 84



>sp|O19913|YC44_CYACA Hypothetical 45.3 kDa protein
           ycf44.>pir|T11981|T11981 hypothetical protein ORF396 -
           red alga (Cyanidium caldarium)
           chloroplast>gb:AF022186_1761849 Cyanidium caldarium
           strain RK1 chloroplast, complete genome.
          Length = 396

 Score = 35.8 bits (81), Expect = 0.69
 Identities = 22/89 (24%), Positives = 43/89 (48%)
 Frame = +2

Query: 401 SSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLGFDHMF 580
           ++L  +I+    +  + AIG+II Q +  +FY   +     + G   W+ +  L  + +F
Sbjct: 20  TNLKFSITLFIIICIVSAIGTIIPQDKPKEFYMNTY--SLKVLGMPLWKIIQLLSLEKIF 77

Query: 581 SSPIFLGTSALLAASLMACTYTTQIPLVK 667
            S  +L     L+ SL  C+  +Q P ++
Sbjct: 78  YSNFYLILLLCLSFSLFFCSLKSQFPYLR 106



>gb:AL607122_1930984 Human DNA sequence from clone RP11-511I2 on
           chromosome 1 Contains the 3' end of the gene for UMP-CMP
           kinase (UMP-CMPK), a novel gene, the FOXE3 gene for
           forkhead box E3, a novel gene (MGC12982), the FOXD2 gene
           for forkhead box D2 and three CpG islands, complete
           sequence.
          Length = 495

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/57 (42%), Positives = 26/57 (45%)
 Frame = -1

Query: 360 PKPPALLFFAGGGPVGEAPFPASPASKSVGAPSDSGTLILLGALFSLAPCFFLVVLS 190
           P PP    FAG G    AP PA PAS S   P  +G    LGA    A  F+   LS
Sbjct: 320 PGPPTASVFAGAG---SAPAPA-PASGSGPGPGPAGLPAFLGAELGCAKAFYAASLS 372



>gb:BX649606_1643487 Aspergillus fumigatus BAC pilot project
           supercontig; segment 2/3.
          Length = 700

 Score = 34.3 bits (77), Expect = 2.0
 Identities = 23/50 (46%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -1

Query: 378 GNLLNSPKPPALLFFAGGGPVGEA-PFPASPASKSVGAPSDSGTLILLGA 232
           GN   +P P A    A G P   A P P SP S +V APSD+G    LGA
Sbjct: 318 GNQAEAPSPVA----ATGPPSPSAIPLPQSPLSPTVPAPSDAGVESALGA 363



>sp|O60548|FXD2_HUMAN Forkhead box protein D2 (Forkhead-related
           protein FKHL17) (Forkhead- related transcription factor
           9) (FREAC-9).>gb:AF042832_1878509 Homo sapiens
           forkhead-related transcription factor FREAC-9 (FKHL17)
           mRNA, complete cds.
          Length = 497

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 24/57 (42%), Positives = 26/57 (45%)
 Frame = -1

Query: 360 PKPPALLFFAGGGPVGEAPFPASPASKSVGAPSDSGTLILLGALFSLAPCFFLVVLS 190
           P PP    FAG G    AP PA PAS S   P  +G    LGA    A  F+   LS
Sbjct: 322 PGPPTASVFAGAG---SAPAPA-PASGSGPGPGPAGLPAFLGAELGCAKAFYPASLS 374



>gb:BA000030_701483 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 99

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +3

Query: 150 GTRAKISPSPFLASSTPLERSRVPRRTVRPARLGCRNLTEHPR 278
           GTR +++     A+ T +ERS+VPR     A  G R +T+H R
Sbjct: 57  GTRIEVTDPDPRANRTVMERSQVPRNDPGSAATGARPVTDHRR 99



>gb:AY204400_597050 Leptospirillum ferrooxidans Lfe152p1 gene,
           partial cds; and Lfe152p2 gene, complete cds.
          Length = 112

 Score = 33.5 bits (75), Expect = 3.4
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 1/66 (1%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNW-RWVLTL 562
           ++A LSSL  AIS    LA L   G+ IEQG    FY   + E         W  W++ L
Sbjct: 54  LLAVLSSLRLAISLFLILAFLTIFGTFIEQGRDAPFYIAGYGE--------KWGGWIVRL 105

Query: 563 GFDHMF 580
             D ++
Sbjct: 106 KIDDIY 111



>gb:CP000009_862427 Gluconobacter oxydans 621H, complete genome.
          Length = 242

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = -1

Query: 330 GGGPVGEAPFPASPASKSVGAPSDSGTLIL 241
           GG P GE   P  PA+ + G  S  GTLI+
Sbjct: 109 GGRPAGEVEIPEDPAASAAGPVSGGGTLII 138



>gb:CR378677_97493 Photobacterium profundum SS9 chromosome 2;
           segment 3/7.
          Length = 508

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 5/84 (5%)
 Frame = +1

Query: 349 WWFGAVEEITQKGSGESV*FDXRYI*DVCP-----RWLNGHRINHRTRGGSRFLFSEVPR 513
           WW G +  I   GS             VCP      WL  H++ HR+   SR L   VP 
Sbjct: 101 WWAGIIIAILISGSAWCA---------VCPWDNIASWLVNHKLWHRSNSNSR-LQLRVPN 150

Query: 514 RSSSVWVLQLEMGSHSWLRSHVFI 585
              ++W   L     +WL   V I
Sbjct: 151 VLRNIWPASLLFIGFTWLELGVGI 174



>pir|G83469|G83469 hypothetical protein PA1408 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004570_55644
           Pseudomonas aeruginosa PAO1, section 131 of 529 of the
           complete genome.>gb:AE004091_969744 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 807

 Score = 32.7 bits (73), Expect = 5.9
 Identities = 23/57 (40%), Positives = 31/57 (54%)
 Frame = -1

Query: 459 PMAIKPARANISDIAXVKLDRLATTLLGNLLNSPKPPALLFFAGGGPVGEAPFPASP 289
           P ++  AR   SD+    LDRL +   G  L+SP+  +LL    GGP   AP PA+P
Sbjct: 757 PRSVAGAR---SDLLFTILDRLRSE--GIALSSPQ--SLLMIQDGGPASAAPAPATP 806



>gb:BC052781_1984866 Homo sapiens RAN binding protein 9, mRNA (cDNA
           clone IMAGE:5272048), partial cds.
          Length = 802

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = -1

Query: 360 PKPPALLFFAGGGPVGEAPFPASPASKSVGAPSDSG 253
           P PP L   AG GP G AP PA  A  S  AP   G
Sbjct: 176 PAPPGLA--AGPGPAGGAPTPALVAGSSAAAPFPHG 209



>gb:AB055311_1868318 Homo sapiens mRNA for RanBPM, complete
           cds.>gb:AL441883_1927202 Human DNA sequence from clone
           RP1-223E5 on chromosome 6 Contains the SIRT5 gene for
           sirtuin silent mating type information regulation 2
           homolog 5 (S. cerevisiae), the gene for retinoic acid
           repressible protein (RARG-1), the 3' end of the RANBP9
           gene for RAN binding protein 9 (RanBPM) and two CpG
           islands, complete sequence.>gb:HS503G16_1998895 Human
           DNA sequence from clone RP3-503G16 on chromosome 6p23
           Contains the 5' end of the RANBP9 gene for RAN binding
           protein 9 (RanBPM) and three CpG islands, complete
           sequence.
          Length = 729

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 18/36 (50%), Positives = 18/36 (50%)
 Frame = -1

Query: 360 PKPPALLFFAGGGPVGEAPFPASPASKSVGAPSDSG 253
           P PP L   AG GP G AP PA  A  S  AP   G
Sbjct: 103 PAPPGLA--AGPGPAGGAPTPALVAGSSAAAPFPHG 136



>gb:AE017348_1758311 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 1218

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = -1

Query: 366 NSPKPPALLFFAGGGPVGEAPFPASPASKSVGAPSDSG 253
           N+P PPA+   +   P  E P P++P S      S SG
Sbjct: 7   NTPPPPAITISSSNAPHSEQPMPSTPPSPLRSTSSSSG 44



>gb:AY772713_1628173 'Chlorella' zofingiensis beta-carotene
           ketolase/oxygenase (bkt/crto) mRNA, complete
           cds.>gb:AY772714_1628174 'Chlorella' zofingiensis
           beta-carotene ketolase/oxygenase (bkt/crto) gene,
           complete cds.
          Length = 312

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +2

Query: 485 PDFYFQKFPEDHPLFGFFNWRWVLTLGFDHMFSSPIFLGTSALLAASLMACTYTTQIPLV 664
           PDF+ +  P  H  FG F W +   L F  +F+ P FL +  +   +L  C +    PLV
Sbjct: 165 PDFH-RGDPALHKWFGRFMWEYATPLQFAKIFAYPFFLQSLRVQYPNL--CVFLAAAPLV 221



>gb:AE017283_430114 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 503

 Score = 32.3 bits (72), Expect = 7.7
 Identities = 24/84 (28%), Positives = 35/84 (41%)
 Frame = +2

Query: 386 VVASLSSLTXAISEMFALAGLMAIGSIIEQGEAPDFYFQKFPEDHPLFGFFNWRWVLTLG 565
           V   L+S+  A+  +F LA     GS++ Q          F  +HP       R    LG
Sbjct: 4   VWGQLTSMRTALILLFLLALAAIPGSVVPQSAQSAMKVSDFAANHPTLD----RICRPLG 59

Query: 566 FDHMFSSPIFLGTSALLAASLMAC 637
             H+++S  F     LL  SL+ C
Sbjct: 60  MYHVYTSVWFSAIYLLLLISLIGC 83


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 718,004,347
Number of Sequences: 1806583
Number of extensions: 15404497
Number of successful extensions: 40362
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 38851
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40298
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 37608185545
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)