BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4223
         (853 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC073178_1541009 Arabidopsis thaliana chromosome 1 BAC F10D13...    47   4e-04   
gb:LUS310157_1685464 Linum usitatissimum N2-B gene.                    46   0.001   
gb:LUS310153_1685460 Linum usitatissimum N1-B gene.                    46   0.001   
gb:LUS310150_1685457 Linum usitatissimum variety Bombay Ngc-D, N...    46   0.001   
pir|S13724|S13724 ESAG 8 protein - Trypanosoma brucei>gb:TBESAG8...    44   0.005   Trypanosoma brucei brucei
gb:LUS310154_1685461 Linum usitatissimum N1-C gene.                    43   0.007   
gb:TBH25N7_1399063 Trypanosoma brucei 221 VSG expression site BAC.     42   0.015   
sp|P26337|ESA8_TRYEQ|ESA8_TRYEQ Putative adenylate cyclase regulatory prote...    42   0.015   Trypanosoma equiperdum
gb:TBH25N7_1399062 Trypanosoma brucei 221 VSG expression site BAC.     42   0.019   
gb:TB13J3_1398436 Trypanosoma brucei Bn-2 VSG expression site BA...    42   0.019   
gb:LUS310155_1685462 Linum usitatissimum N1-D gene.                    41   0.025   
pir|T45787|T45787 disease resistance-like protein - Arabidopsis ...    41   0.025   Arabidopsis thaliana [mouse-ear cress]
gb:TBH25N7_1399057 Trypanosoma brucei 221 VSG expression site BAC.     41   0.033   
pir|G96610|G96610 probable disease resistance protein RPP1-WsA [...    41   0.033   Arabidopsis thaliana [mouse-ear cress]
gb:TRBKPLEUM_1400712 Trypanosoma brucei leucine repeat protein (...    40   0.043   
sp|P23799|ESA8_TRYBB|ESA8_TRYBB Putative adenylate cyclase regulatory prote...    40   0.043   Trypanosoma brucei brucei
gb:LUS310164_1685471 Linum usitatissimum Nho-C gene.                   40   0.074   
gb:LUS310151_1685458 Linum usitatissimum Ngc-C gene.                   40   0.074   
gb:AF098963_1767941 Arabidopsis thaliana disease resistance prot...    36   0.081   
pir|T52347|T52347 disease resistance protein RPP1-WsB [imported]...    36   0.081   Arabidopsis thaliana [mouse-ear cress]
gb:ATF2I11_1550473 Arabidopsis thaliana DNA chromosome 5, BAC cl...    39   0.096   
pir|T04426|T04426 hypothetical protein T18B16.20 - Arabidopsis t...    39   0.096   Arabidopsis thaliana [mouse-ear cress]
pir|T47438|T47438 disease resistance protein homolog - Arabidops...    39   0.096   Arabidopsis thaliana [mouse-ear cress]
sp|O50052|DR25_ARATH|DR25_ARATH Putative disease resistance protein At4g19050.    39   0.096   Arabidopsis thaliana [mouse-ear cress]
gb:AF310958_1785050 Linum usitatissimum cv. 'Akmolinsk' resistan...    39   0.13    
gb:LUS310163_1685470 Linum usitatissimum Nbi-D gene.                   39   0.13    
gb:LUS310162_1685469 Linum usitatissimum Nbi-C gene.                   39   0.13    
gb:LUS310159_1685466 Linum usitatissimum N2-D gene.                    39   0.13    
gb:LUS310158_1685465 Linum usitatissimum N2-C gene.                    39   0.13    
gb:LUS310150_1685453 Linum usitatissimum variety Bombay Ngc-D, N...    39   0.13    
gb:TBBCHR1A3_1398783 Trypanosoma brucei DNA chromosome 1, segmen...    39   0.13    
gb:AF310960_1785053 Linum usitatissimum cv. 'Abyssinian' resista...    39   0.16    
gb:HVU507093_1682775 Hordeum vulgare mRNA for NBS-LRR disease re...    39   0.16    
sp|Q9T048|DR27_ARATH|DR27_ARATH Putative disease resistance protein At4g271...    39   0.16    Arabidopsis thaliana [mouse-ear cress]
pir|T47442|T47442 disease resistance protein homlog - Arabidopsi...    37   0.17    Arabidopsis thaliana [mouse-ear cress]
gb:AP006164_1861172 Oryza sativa (japonica cultivar-group) genom...    38   0.21    
gb:ATAC016829_1543647 Arabidopsis thaliana chromosome III BAC T6...    34   0.23    
gb:AF310966_1785058 Linum usitatissimum cv. 'Koto' resistance-li...    38   0.28    
gb:AF310962_1785056 Linum usitatissimum cv. 'Leona' resistance-l...    38   0.28    
pir|B36359|B36359 VSG expression site-associated protein ES88 - ...    38   0.28    Trypanosoma brucei
gb:AF310968_1785059 Linum usitatissimum cv. 'Hoshangabad' resist...    37   0.48    
gb:OSJN00045_1693805 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.48    
gb:AB018113_1513800 Arabidopsis thaliana genomic DNA, chromosome...    37   0.48    
gb:AB017065_1513377 Arabidopsis thaliana genomic DNA, chromosome...    37   0.48    
pir|T47430|T47430 disease resistence-like protein - Arabidopsis ...    37   0.48    Arabidopsis thaliana [mouse-ear cress]
sp|Q8VZC7|DR36_ARATH|DR36_ARATH Probable disease resistance protein At5g455...    37   0.48    Arabidopsis thaliana [mouse-ear cress]
pir|T05207|T05207 hypothetical protein F24J7.30 - Arabidopsis th...    37   0.62    Arabidopsis thaliana [mouse-ear cress]
gb:AF310964_1785057 Linum usitatissimum cv. 'CI 1911 Punjab' res...    36   0.81    
gb:AF310961_1785055 Linum usitatissimum cv. 'Leona' resistance-l...    36   0.81    
gb:AF310960_1785052 Linum usitatissimum cv. 'Abyssinian' resista...    36   0.81    
gb:AF310959_1785051 Linum usitatissimum cv. 'Akmolinsk' resistan...    36   0.81    
gb:AB025639_1516695 Arabidopsis thaliana genomic DNA, chromosome...    36   0.81    
gb:AE011952_278006 Xanthomonas axonopodis pv. citri str. 306, se...    36   0.81    
gb:AF499727_1806151 Cucumis melo BAC clone PIT92-60K17, complete...    36   1.1     
gb:AY091558_1574663 Pinus taeda NBS/LRR mRNA, partial cds.             36   1.1     
gb:AC006528_1534363 Arabidopsis thaliana chromosome 2 clone F9B2...    36   1.1     
pir|H84513|H84513 probable disease resistance protein [imported]...    36   1.1     Arabidopsis thaliana [mouse-ear cress]
gb:AC007197_1535539 Arabidopsis thaliana chromosome 2 clone T22C...    35   1.4     
gb:AB006706_1510012 Arabidopsis thaliana genomic DNA, chromosome...    35   1.4     
gb:ATRPP5LE2_1554110 Arabidopsis thaliana RPP5 disease resistanc...    35   1.8     
gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segmen...    35   2.4     
pir|T47431|T47431 disease resistence-like protein - Arabidopsis ...    35   2.4     Arabidopsis thaliana [mouse-ear cress]
pir|T48928|T48928 disease resistance protein-like - Arabidopsis ...    35   2.4     Arabidopsis thaliana [mouse-ear cress]
pir|T52346|T52346 disease resistance protein RPP1-WsA [imported]...    34   3.1     Arabidopsis thaliana [mouse-ear cress]
gb:AF098964_1767942 Arabidopsis thaliana disease resistance prot...    34   4.0     
gb:AY091561_1574666 Pinus taeda NBS/LRR mRNA, partial cds.             34   4.0     
pir|T52348|T52348 disease resistance protein RPP1-WsC [imported]...    34   4.0     Arabidopsis thaliana [mouse-ear cress]
pir|E96682|E96682 hypothetical protein F12P19.1 [imported] - Ara...    34   4.0     Arabidopsis thaliana [mouse-ear cress]
gb:AJ719272_2501459 Gallus gallus mRNA for hypothetical protein,...    33   5.3     
gb:AK129139_2069370 Mus musculus mRNA for mKIAA0429 protein.           33   5.3     
gb:AF086645_1881782 Homo sapiens metastasis suppressor protein m...    33   5.3     
gb:AP005811_1858292 Oryza sativa (japonica cultivar-group) genom...    33   5.3     
gb:AP004869_1846308 Oryza sativa (japonica cultivar-group) genom...    33   5.3     
gb:AY091563_1574668 Pinus taeda TIR/P-loop/LRR mRNA, complete cds.     33   5.3     
gb:CR861458_1185453 Pongo pygmaeus mRNA; cDNA DKFZp459G172 (from...    33   5.3     
gb:AK030533_1162051 Mus musculus adult male pituitary gland cDNA...    33   5.3     
pir|A85189|A85189 disease resistance RPP5 like protein [imported...    33   5.3     Arabidopsis thaliana [mouse-ear cress]
pir|D71437|D71437 probable resistance gene - Arabidopsis thaliana      33   5.3     Arabidopsis thaliana [mouse-ear cress]
sp|Q8R1S4|MTS1_MOUSE|MTS1_MOUSE Metastasis suppressor protein 1 (Missing in...    33   5.3     Mus musculus [mouse]
sp|O43312|MTS1_HUMAN|MTS1_HUMAN Metastasis suppressor protein 1 (Missing in...    33   5.3     Homo sapiens [man]
sp|Q9FKZ0|DR43_ARATH|DR43_ARATH Probable disease resistance protein At5g669...    33   5.3     Arabidopsis thaliana [mouse-ear cress]
gb:AP002817_1822854 Oryza sativa (japonica cultivar-group) genom...    33   6.9     
gb:AY535010_1612309 Nicotiana tabacum N-like protein (NH) gene, ...    33   6.9     
gb:AB017914_1513685 Oryza sativa mRNA for L-zip+NBS+LRR, complet...    33   6.9     
gb:AB012240_1511686 Arabidopsis thaliana genomic DNA, chromosome...    33   6.9     
gb:AC146718_1744626 Oryza sativa chromosome 3 B1130H05 genomic s...    33   9.0     
gb:AC133930_1741600 Oryza sativa chromosome 3 BAC OSJNBa0039O18 ...    33   9.0     
gb:CEC01G12_1359899 Caenorhabditis elegans cosmid C01G12, comple...    33   9.0     
gb:AE005172_891596 Arabidopsis thaliana chromosome 1, top arm co...    33   9.0     
pir|B85189|B85189 disease resistance RPP5 like protein [imported...    33   9.0     Arabidopsis thaliana [mouse-ear cress]
pir|G85188|G85188 disease resistance RPP5 like protein [imported...    33   9.0     Arabidopsis thaliana [mouse-ear cress]
pir|B86398|B86398 protein T7N9.24 [imported] - Arabidopsis thali...    33   9.0     Arabidopsis thaliana [mouse-ear cress]
pir|B71437|B71437 probable resistance gene - Arabidopsis thaliana      33   9.0     Arabidopsis thaliana [mouse-ear cress]
pir|T18831|T18831 hypothetical protein C01G12.7 - Caenorhabditis...    33   9.0     Caenorhabditis elegans [roundworm]
pir|T06404|T06404 resistance complex protein I2C-2 - tomato>gb:A...    33   9.0     Solanum lycopersicum
gb:AB011481_1511464 Arabidopsis thaliana genomic DNA, chromosome...    30   10.0    


>gb:AC073178_1541009 Arabidopsis thaliana chromosome 1 BAC F10D13
            genomic sequence, complete sequence.
          Length = 1398

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 35/112 (31%), Positives = 56/112 (50%), Gaps = 2/112 (1%)
 Frame = +3

Query: 279  IELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHE 458
            ++L GC  L  L    P S+  L     + T+N   C  ++          +  L+ L E
Sbjct: 983  LDLSGCSSLVEL----PLSIGNLIN---LKTLNLSECSSLV-----ELPSSIGNLINLQE 1030

Query: 459  LYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCV-KLFKISDLSLS 608
            LYL ECS+L+ELP  + +L+NL+ +D+ GC +L      +  L  +  L+LS
Sbjct: 1031 LYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLS 1082



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 7/73 (9%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCV------KLFKI 590
            +  L+ L ELYL ECS+L+ELP  + +L+NL+ +D+ GC +L      +      K   +
Sbjct: 950  IGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNL 1009

Query: 591  SDLSLSLKLPQII 629
            S+ S  ++LP  I
Sbjct: 1010 SECSSLVELPSSI 1022



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 15/107 (14%)
 Frame = +3

Query: 279  IELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAG----- 440
            + L GC  L  L +  G  +LK L L G  + +     P  I +   + K+DL+G     
Sbjct: 1079 LNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVE---LPSSIGNLINLKKLDLSGCSSLV 1135

Query: 441  --------LLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
                    L+ L ELYL ECS+L+ELP  + +L+NL+ + +  C +L
Sbjct: 1136 ELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSL 1182



 Score = 43.9 bits (102), Expect = 0.004
 Identities = 29/90 (32%), Positives = 51/90 (56%), Gaps = 4/90 (4%)
 Frame = +3

Query: 303  LRALNFTGPRSLKTLSL-YG*IATINQRHCPRVILHCWKMYKI--DLAGLLRLHELYLYE 473
            L+ L+ +G  SL  L L  G +  + + +    +  C  + ++   +  L+ L ELYL E
Sbjct: 1123 LKKLDLSGCSSLVELPLSIGNLINLQELY----LSECSSLVELPSSIGNLINLQELYLSE 1178

Query: 474  CSNLIELP-GVDSLVNLEGIDIHGCITLSS 560
            CS+L+ELP  + +L+NL+ +D++ C  L S
Sbjct: 1179 CSSLVELPSSIGNLINLKKLDLNKCTKLVS 1208



 Score = 41.6 bits (96), Expect = 0.019
 Identities = 29/88 (32%), Positives = 48/88 (54%), Gaps = 14/88 (15%)
 Frame = +3

Query: 333  SLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAG-------------LLRLHELYLYE 473
            +LK L+L G  + +     P  I +   + K+DL+G             L+ L ELYL E
Sbjct: 859  NLKLLNLSGCSSLVE---LPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSE 915

Query: 474  CSNLIELP-GVDSLVNLEGIDIHGCITL 554
            CS+L+ELP  + +L+NL+ +++  C +L
Sbjct: 916  CSSLVELPSSIGNLINLKTLNLSECSSL 943



 Score = 38.5 bits (88), Expect = 0.16
 Identities = 29/89 (32%), Positives = 49/89 (55%), Gaps = 5/89 (5%)
 Frame = +3

Query: 303 LRALNFTGPRSLKTL-SLYG*IATINQRHCPRV-ILHCWKMYKI--DLAGLLRLHELYLY 470
           +++L+  G  SL  L S  G + T+     PR+ ++ C  + ++   +  L+ L  L L 
Sbjct: 740 IKSLDIQGCSSLLKLPSSIGNLITL-----PRLDLMGCSSLVELPSSIGNLINLPRLDLM 794

Query: 471 ECSNLIELPG-VDSLVNLEGIDIHGCITL 554
            CS+L+ELP  + +L+NLE    HGC +L
Sbjct: 795 GCSSLVELPSSIGNLINLEAFYFHGCSSL 823



 Score = 36.6 bits (83), Expect = 0.62
 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 1/43 (2%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
           +L+  + L E+ L +CS+LIELP  + +  N++ +DI GC +L
Sbjct: 709 NLSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSL 751



 Score = 36.2 bits (82), Expect = 0.81
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCV-KLFKISDLSL 605
            +  L+ L  L L  CS+L+ELP  + +L+NL+ +D+ GC +L      +  L  + +L L
Sbjct: 854  IGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYL 913

Query: 606  S 608
            S
Sbjct: 914  S 914



 Score = 35.4 bits (80), Expect = 1.4
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +3

Query: 426  IDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
            + +  L+ L  L L  CS+L+ELP     +NL+ +D+ GC +L
Sbjct: 1068 LSIGNLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSL 1110



 Score = 33.5 bits (75), Expect = 5.3
 Identities = 25/88 (28%), Positives = 47/88 (53%), Gaps = 4/88 (4%)
 Frame = +3

Query: 303  LRALNFTGPRSLKTLSL-YG*IATINQRHCPRVILHCWKMYKI--DLAGLLRLHELYLYE 473
            L+ L+ +G  SL  L L  G +  + + +    +  C  + ++   +  L+ L  L L E
Sbjct: 884  LKKLDLSGCSSLVELPLSIGNLINLQELY----LSECSSLVELPSSIGNLINLKTLNLSE 939

Query: 474  CSNLIELP-GVDSLVNLEGIDIHGCITL 554
            CS+L+ELP  + +L+NL+ + +  C +L
Sbjct: 940  CSSLVELPSSIGNLINLQELYLSECSSL 967



>gb:LUS310157_1685464 Linum usitatissimum N2-B gene.
          Length = 1108

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/88 (29%), Positives = 48/88 (54%)
 Frame = +3

Query: 282  ELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHEL 461
            +L   K LR L  TG R L  ++    + ++ +    R    C  + K+DLAGL++L  +
Sbjct: 950  DLTNLKNLRDLTITGCRELIEIAGLHTLESLEELSMER----CPSVRKLDLAGLIKLKTI 1005

Query: 462  YLYECSNLIELPGVDSLVNLEGIDIHGC 545
            +++ C+ L E+ G+  L +L+ + + GC
Sbjct: 1006 HIHICTQLTEIRGLGGLESLQMLFMSGC 1033



>gb:LUS310153_1685460 Linum usitatissimum N1-B gene.
          Length = 1108

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/88 (29%), Positives = 48/88 (54%)
 Frame = +3

Query: 282  ELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHEL 461
            +L   K LR L  TG R L  ++    + ++ +    R    C  + K+DLAGL++L  +
Sbjct: 950  DLTNLKNLRDLTITGCRELIEIAGLHTLESLEELSMER----CPSVRKLDLAGLIKLKTI 1005

Query: 462  YLYECSNLIELPGVDSLVNLEGIDIHGC 545
            +++ C+ L E+ G+  L +L+ + + GC
Sbjct: 1006 HIHICTRLTEIRGLGGLESLQMLFMSGC 1033



>gb:LUS310150_1685457 Linum usitatissimum variety Bombay Ngc-D, Ngc-A
            and Ngc-B genes.>gb:LUS310161_1685468 Linum usitatissimum
            Nbi-B gene.
          Length = 1108

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/88 (29%), Positives = 48/88 (54%)
 Frame = +3

Query: 282  ELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHEL 461
            +L   K LR L  TG R L  ++    + ++ +    R    C  + K+DLAGL++L  +
Sbjct: 950  DLTNLKNLRDLTITGCRELIEIAGLHTLESLEELSMER----CPSVRKLDLAGLIKLKTI 1005

Query: 462  YLYECSNLIELPGVDSLVNLEGIDIHGC 545
            +++ C+ L E+ G+  L +L+ + + GC
Sbjct: 1006 HIHICTQLTEIRGLGGLESLQMLFMSGC 1033



>pir|S13724|S13724 ESAG 8 protein - Trypanosoma
           brucei>gb:TBESAG8_1399003 T. brucei ESAG 8 gene for a
           leucine-rich repeat family protein.
          Length = 630

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C K+  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEKLQPIGIVGNLRNLKCLSTCWCANLKELGGLERLVNLEKVDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS  +   L  + +L +S
Sbjct: 320 LRNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSSLGFVANLSNLKELDIS 378



 Score = 39.7 bits (91), Expect = 0.074
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLESLKGLEELSLEG----------------CGEIMSFDPIWSLHHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC 545
             LY+ EC NL +L G+  L  LE + +HGC
Sbjct: 465 RVLYVSECGNLEDLSGLQCLTGLEELYLHGC 495



>gb:LUS310154_1685461 Linum usitatissimum N1-C gene.
          Length = 1120

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 25/66 (37%), Positives = 39/66 (59%)
 Frame = +3

Query: 429  DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
            DL+ L  L EL L  C  LIE+PG+D+L +LE + ++GC+++          K+ DLS  
Sbjct: 956  DLSNLKNLRELSLSFCEELIEVPGLDALESLEYLFLNGCLSIR---------KLPDLSGL 1006

Query: 609  LKLPQI 626
             KL ++
Sbjct: 1007 KKLKKL 1012



>gb:TBH25N7_1399063 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 676

 Score = 42.0 bits (97), Expect = 0.015
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C K+  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 584 LIVCKKITTIGVVGNLRNLKCLSTCWCANLKELGGLERLVNLEKVDLSGCCGLSS-SVFM 642

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 643 ELMSLPKLQWFYGFGSRVPDIVL 665



 Score = 40.8 bits (94), Expect = 0.033
 Identities = 34/136 (25%), Positives = 57/136 (41%), Gaps = 26/136 (19%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYK---------- 425
           +++  C ++  L    G RSL+ LSL G                CW + K          
Sbjct: 259 LDISSCHEITDLTAIAGVRSLEKLSLSG----------------CWNVTKGLEELCKLSS 302

Query: 426 ---IDLAG------------LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
              +D++G            L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS
Sbjct: 303 LRELDISGCPVLGSAVVLRNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSS 362

Query: 561 KSWCVKLFKISDLSLS 608
             +   L  + +L +S
Sbjct: 363 LGFVANLSNLKELDIS 378



 Score = 38.9 bits (89), Expect = 0.13
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 1/90 (1%)
 Frame = +3

Query: 279 IELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRLH 455
           ++L GC+++ +L+  G  +LK L  +              I  C ++   D +  L  L 
Sbjct: 421 LDLSGCERITSLS--GLETLKRLRKFK-------------IRGCKEIMSFDPIWSLHHLR 465

Query: 456 ELYLYECSNLIELPGVDSLVNLEGIDIHGC 545
            LY+ EC NL +L G++ +  LE + +HGC
Sbjct: 466 VLYVSECGNLEDLSGLEGITGLEELYLHGC 495



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 2/102 (1%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLK 614
           L +L  LY+ EC NL +L G+  L  L+ + +HGC   T+    W +   ++  +S    
Sbjct: 507 LCKLRVLYVSECGNLEDLSGLQCLTGLKELYLHGCRKCTIFDPIWNLGKLRVLYVSECGN 566

Query: 615 LPQIILFHSMW*CCLSCISPLYLYLGIAISPCTQFPEFEVIG 740
           L  +         CL+ +  LYL +      C +     V+G
Sbjct: 567 LEDLSGLQ-----CLTGLEELYLIV------CKKITTIGVVG 597



>sp|P26337|ESA8_TRYEQ Putative adenylate cyclase regulatory
           protein.>pir|S16358|BWUT8Q regulatory protein ESAG8c -
           Trypanosoma equiperdum>gb:TEEESAG_1399984 T.equiperdum
           eESAG8c gene for a regulatory protein.
          Length = 630

 Score = 42.0 bits (97), Expect = 0.015
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C ++  I + G LR L  L    C+NL EL G+D LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEEITPIGVVGNLRNLKCLSTCWCANLKELGGLDRLVNLEKLDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 4/139 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLETLKGLEELSLEG----------------CGEIMSFDPIWSLHHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQI 626
             LY+ EC NL +L G++ +  LE + +HGC   T     W ++   + +LS    L  +
Sbjct: 465 RVLYVSECGNLEDLSGLEGITGLEELYLHGCRKCTNFGPIWNLRNVCVVELSCCENLEDL 524

Query: 627 ILFHSMW*CCLSCISPLYL 683
                    CL+ +  LYL
Sbjct: 525 SGLQ-----CLTGLEELYL 538



 Score = 39.3 bits (90), Expect = 0.096
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNL+ +++ GC  +SS  +   L  + +L +S
Sbjct: 320 LKNLINLKVLSVSNCKNFKDLNGLERLVNLDKLNLSGCHGVSSLGFVANLSNLKELDIS 378



>gb:TBH25N7_1399062 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 630

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 37/139 (26%), Positives = 62/139 (44%), Gaps = 4/139 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLETLKRLEELSLEG----------------CGEIMSFDPIWSLHHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQI 626
             LY+ EC NL +L G+  L  LE + +HGC   T+    W ++   + +LS    L  +
Sbjct: 465 RVLYVSECGNLEDLSGLQCLTGLEELYLHGCRKCTIFGPIWNLRNVCVLELSCCENLEDL 524

Query: 627 ILFHSMW*CCLSCISPLYL 683
                    CL+ +  LYL
Sbjct: 525 SGLQ-----CLTGLEELYL 538



 Score = 41.2 bits (95), Expect = 0.025
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C ++  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEEITTIGIVGNLRNLKCLSTCWCANLKELGGLERLVNLEKVDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS  +   L  + +L +S
Sbjct: 320 LRNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSSLGFVANLSNLKELDIS 378



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 1/116 (0%)
 Frame = +3

Query: 303 LRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRLHELYLYECS 479
           L  LN +G   + +L     ++ + +      I  C  +   D L  L  L  LYL +  
Sbjct: 349 LEKLNLSGCHGVSSLGFVANLSNLKELD----ISGCESLVCFDGLQDLNNLEVLYLRDVK 404

Query: 480 NLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIILFHSMW 647
           +   +  + +L  +  +D+ GC  ++S S    L ++ +LSL     +I+ F  +W
Sbjct: 405 SFTNVGAIKNLSKMRELDLSGCERITSLSGLETLKRLEELSLE-GCGEIMSFDPIW 459



>gb:TB13J3_1398436 Trypanosoma brucei Bn-2 VSG expression site BAC
           13J3.
          Length = 583

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 26/136 (19%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYK---------- 425
           +++  C ++  L    G RSL+ LSL G                CW + K          
Sbjct: 259 LDISSCHEITDLTAIAGVRSLEKLSLSG----------------CWNVTKGLEELCKFSN 302

Query: 426 ---IDLAG------------LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
              +D++G            L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS
Sbjct: 303 LRELDISGCLVLGSAVVLKNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSS 362

Query: 561 KSWCVKLFKISDLSLS 608
            ++   L  + +L++S
Sbjct: 363 LAFVANLSNLKELNIS 378



 Score = 38.1 bits (87), Expect = 0.21
 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 5/140 (3%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILH--CWKMYKIDLAGLLR 449
           ++L GC+++ +L+     + L+ LSL G         C  ++     W ++         
Sbjct: 421 LDLSGCERITSLSGLETLKGLEELSLEG---------CGEIMSFGPIWSLH--------H 463

Query: 450 LHELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQ 623
           L  LY+ EC NL +L G+  L  LE + +HGC   T     W ++   + +LS    L  
Sbjct: 464 LRVLYVSECGNLEDLSGLQCLTGLEELYLHGCRKCTNFGPIWNLRNVCVLELSCCENLDD 523

Query: 624 IILFHSMW*CCLSCISPLYL 683
           +         CL+ +  LYL
Sbjct: 524 LSGLQ-----CLTGLEELYL 538



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 27/116 (23%), Positives = 53/116 (45%), Gaps = 1/116 (0%)
 Frame = +3

Query: 303 LRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRLHELYLYECS 479
           L  LN +G   + +L+    ++ + + +    I  C  +   D L  L +L  LYL +  
Sbjct: 349 LEKLNLSGCHGVSSLAFVANLSNLKELN----ISGCESLVCFDGLQDLNKLEVLYLRDVK 404

Query: 480 NLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIILFHSMW 647
           +   +  + +L  +  +D+ GC  ++S S    L  + +LSL     +I+ F  +W
Sbjct: 405 SFTNVGAIKNLSKMRELDLSGCERITSLSGLETLKGLEELSLE-GCGEIMSFGPIW 459



>gb:LUS310155_1685462 Linum usitatissimum N1-D gene.
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 26/69 (37%), Positives = 37/69 (53%)
 Frame = +3

Query: 411  WKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKI 590
            WK +  DL+ L  L  L L  C  LIE+PG+D+L +LE + + GC ++          K+
Sbjct: 951  WKQFP-DLSNLKNLRVLCLSFCQELIEVPGLDALESLEWLSMEGCRSIR---------KV 1000

Query: 591  SDLSLSLKL 617
             DLS   KL
Sbjct: 1001 PDLSGLKKL 1009



 Score = 38.5 bits (88), Expect = 0.16
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
            W+ + GC+ +R + + +G + LKTL +   I     R   R               L  L
Sbjct: 988  WLSMEGCRSIRKVPDLSGLKKLKTLDVESCIQLKEVRGLER---------------LESL 1032

Query: 453  HELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
             EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1033 EELKMSGCESIEELPNLSGLKNLRELLLKGCIQL 1066



>pir|T45787|T45787 disease resistance-like protein - Arabidopsis
            thaliana>gb:ATF26O13_1550157 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F26O13.
          Length = 1253

 Score = 41.2 bits (95), Expect = 0.025
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +3

Query: 441  LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLF 584
            L +LH L L  C NLI LP +   + L  +++HGC++L S SW  + F
Sbjct: 965  LSKLHSLRLRHCRNLILLPALPQSLKL--LNVHGCVSLESVSWGFEQF 1010



>gb:TBH25N7_1399057 Trypanosoma brucei 221 VSG expression site BAC.
          Length = 630

 Score = 40.8 bits (94), Expect = 0.033
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS  +   L  + +L++S
Sbjct: 320 LRNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSSLGFVANLSNLKELNIS 378



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C ++  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEEITTIGVVGNLRNLKCLSTCWCANLKELGGLERLVNLEKLDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.0 bits (92), Expect = 0.056
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 4/139 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLETLKRLEELSLEG----------------CGEIMSFDPIWSLHHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQI 626
             LY+ EC NL +L G+  L  LE + +HGC   T     W ++   + +LS    L  +
Sbjct: 465 RVLYVSECGNLEDLSGLQCLTGLEELYLHGCRKCTNFGSIWNLRNVCVLELSCCENLEDL 524

Query: 627 ILFHSMW*CCLSCISPLYL 683
                    CL+ +  LYL
Sbjct: 525 SGLQ-----CLTGLEELYL 538



 Score = 33.9 bits (76), Expect = 4.0
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 1/116 (0%)
 Frame = +3

Query: 303 LRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRLHELYLYECS 479
           L  LN +G   + +L     ++ + + +    I  C  +   D L  L  L  LYL +  
Sbjct: 349 LEKLNLSGCHGVSSLGFVANLSNLKELN----ISGCESLVCFDGLQDLNNLEVLYLRDVK 404

Query: 480 NLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIILFHSMW 647
           +   +  + +L  +  +D+ GC  ++S S    L ++ +LSL     +I+ F  +W
Sbjct: 405 SFTNVGAIKNLSKMRELDLSGCERITSLSGLETLKRLEELSLE-GCGEIMSFDPIW 459



>pir|G96610|G96610 probable disease resistance protein RPP1-WsA
           [imported] - Arabidopsis thaliana>gb:AE005173_893560
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC079733_1732756 Arabidopsis thaliana
           chromosome 1 BAC T8L23 genomic sequence, complete
           sequence.
          Length = 709

 Score = 40.8 bits (94), Expect = 0.033
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 4/98 (4%)
 Frame = +3

Query: 279 IELVGCKKLRALNFTGPRSLK---TLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLR 449
           I+LV  + L+ ++ T  R+LK    LS+   +  +N   C  ++          +     
Sbjct: 356 IQLV--RNLKHMDLTDSRNLKELPNLSMATNLKNLNLERCSSLV-----ELPSSIGNATS 408

Query: 450 LHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSS 560
           LH+L L++CS+L+ELP  + +L NL  +D+  C +L S
Sbjct: 409 LHDLRLFKCSSLVELPFSIGNLTNLWKLDLRECSSLVS 446



>gb:TRBKPLEUM_1400712 Trypanosoma brucei leucine repeat protein
           (T-LR) gene, complete cds.
          Length = 632

 Score = 40.4 bits (93), Expect = 0.043
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C ++  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEEITTIGVVGNLRNLKCLSTCWCANLKELGGLERLVNLEKLDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 4/139 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLETLKGLEELSLEG----------------CGEIMSFDPIWSLYHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQI 626
             LY+ EC NL +L G+  L  LE + +HGC   T     W ++   + +LS    L  +
Sbjct: 465 RVLYVSECGNLEDLSGLQCLTGLEEMYLHGCRKCTNFGPIWNLRNVCVLELSCCENLDDL 524

Query: 627 ILFHSMW*CCLSCISPLYL 683
                    CL+ +  LYL
Sbjct: 525 SGLQ-----CLTGLEELYL 538



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS  +   L  + +L +S
Sbjct: 320 LKNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSSLGFVANLSNLKELDIS 378



>sp|P23799|ESA8_TRYBB Putative adenylate cyclase regulatory protein
           (Leucine repeat protein) (VSG expression site-associated
           protein F14.9).>pir|A36359|A36359 VSG expression
           site-associated protein f14.9 - Trypanosoma brucei
          Length = 630

 Score = 40.4 bits (93), Expect = 0.043
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 5/83 (6%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLR-LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
           ++ C ++  I + G LR L  L    C+NL EL G++ LVNLE +D+ GC  LSS S  +
Sbjct: 538 LIGCEEITTIGVVGNLRNLKCLSTCWCANLKELGGLERLVNLEKLDLSGCCGLSS-SVFM 596

Query: 576 KLFKISDL----SLSLKLPQIIL 632
           +L  +  L        ++P I+L
Sbjct: 597 ELMSLPKLQWFYGFGSRVPDIVL 619



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 4/139 (2%)
 Frame = +3

Query: 279 IELVGCKKLRALN-FTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRL 452
           ++L GC+++ +L+     + L+ LSL G                C ++   D +  L  L
Sbjct: 421 LDLSGCERITSLSGLETLKGLEELSLEG----------------CGEIMSFDPIWSLYHL 464

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGC--ITLSSKSWCVKLFKISDLSLSLKLPQI 626
             LY+ EC NL +L G+  L  LE + +HGC   T     W ++   + +LS    L  +
Sbjct: 465 RVLYVSECGNLEDLSGLQCLTGLEEMYLHGCRKCTNFGPIWNLRNVCVLELSCCENLDDL 524

Query: 627 ILFHSMW*CCLSCISPLYL 683
                    CL+ +  LYL
Sbjct: 525 SGLQ-----CLTGLEELYL 538



 Score = 40.4 bits (93), Expect = 0.043
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           L  L+ L  L +  C N  +L G++ LVNLE +++ GC  +SS  +   L  + +L +S
Sbjct: 320 LKNLINLKVLSVSNCKNFKDLNGLERLVNLEKLNLSGCHGVSSLGFVANLSNLKELDIS 378



>gb:LUS310164_1685471 Linum usitatissimum Nho-C gene.
          Length = 1120

 Score = 39.7 bits (91), Expect = 0.074
 Identities = 24/63 (38%), Positives = 36/63 (57%)
 Frame = +3

Query: 429  DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
            DL+ L  L EL L  C  LIE+PG+D+L ++E + ++GC ++          K+ DLS  
Sbjct: 956  DLSNLKNLSELSLSFCEELIEVPGLDTLESMEYLYLNGCQSIR---------KVPDLSGL 1006

Query: 609  LKL 617
             KL
Sbjct: 1007 KKL 1009



>gb:LUS310151_1685458 Linum usitatissimum Ngc-C gene.
          Length = 1120

 Score = 39.7 bits (91), Expect = 0.074
 Identities = 24/63 (38%), Positives = 36/63 (57%)
 Frame = +3

Query: 429  DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
            DL+ L  L EL L  C  LIE+PG+D+L ++E + ++GC ++          K+ DLS  
Sbjct: 956  DLSNLKNLSELSLSFCEELIEVPGLDTLESMEYLYLNGCQSIR---------KVPDLSGL 1006

Query: 609  LKL 617
             KL
Sbjct: 1007 KKL 1009



>gb:AF098963_1767941 Arabidopsis thaliana disease resistance protein
           RPP1-WsB gene, partial cds.
          Length = 1221

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 6/73 (8%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL-----SSKSWCVKLFKI 590
           +L+    L EL L  CS+L+ELP  ++ L +L+ +D+H C +L        +  +++  +
Sbjct: 717 NLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNL 776

Query: 591 SDLSLSLKLPQII 629
            + S  +KLP  I
Sbjct: 777 ENCSSLVKLPPSI 789



 Score = 35.8 bits (81), Expect(2) = 0.081
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 441  LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS---- 608
            L  L  L L+ CS+L+ELP   +   LE +++  C +L      +    + +LSL+    
Sbjct: 745  LTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSR 804

Query: 609  -LKLPQIILFHSMW*C-CLSCISPLYLYLGI 695
             ++LP I    ++W    L+C S + L L I
Sbjct: 805  VVELPAIENATNLWKLNLLNCSSLIELPLSI 835



 Score = 22.7 bits (47), Expect(2) = 0.081
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +1

Query: 340 RHCLSMVELPQSI 378
           R+C S+VELP SI
Sbjct: 730 RNCSSLVELPSSI 742



>pir|T52347|T52347 disease resistance protein RPP1-WsB [imported] -
           Arabidopsis thaliana (fragment)
          Length = 1221

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 6/73 (8%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL-----SSKSWCVKLFKI 590
           +L+    L EL L  CS+L+ELP  ++ L +L+ +D+H C +L        +  +++  +
Sbjct: 717 NLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLHRCSSLVELPSFGNATKLEILNL 776

Query: 591 SDLSLSLKLPQII 629
            + S  +KLP  I
Sbjct: 777 ENCSSLVKLPPSI 789



 Score = 35.8 bits (81), Expect(2) = 0.081
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +3

Query: 441  LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS---- 608
            L  L  L L+ CS+L+ELP   +   LE +++  C +L      +    + +LSL+    
Sbjct: 745  LTSLQILDLHRCSSLVELPSFGNATKLEILNLENCSSLVKLPPSINANNLQELSLTNCSR 804

Query: 609  -LKLPQIILFHSMW*C-CLSCISPLYLYLGI 695
             ++LP I    ++W    L+C S + L L I
Sbjct: 805  VVELPAIENATNLWKLNLLNCSSLIELPLSI 835



 Score = 22.7 bits (47), Expect(2) = 0.081
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +1

Query: 340 RHCLSMVELPQSI 378
           R+C S+VELP SI
Sbjct: 730 RNCSSLVELPSSI 742



>gb:ATF2I11_1550473 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 1189

 Score = 39.3 bits (90), Expect = 0.096
 Identities = 18/43 (41%), Positives = 30/43 (69%), Gaps = 1/43 (2%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELPG-VDSLVNLEGIDIHGCITL 554
           DL+  + L +L L  CS+LI+LP  + + +NLE +D++GC +L
Sbjct: 694 DLSTAINLRKLILSNCSSLIKLPSCIGNAINLEDLDLNGCSSL 736



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
 Frame = +3

Query: 444 LRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
           + L +L L  CSNL+ELP  + + +NL  +D++ C +L
Sbjct: 746 INLQKLLLRYCSNLVELPSSIGNAINLRELDLYYCSSL 783



 Score = 31.2 bits (69), Expect(2) = 1.3
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 9/86 (10%)
 Frame = +3

Query: 399  ILHCWKMYKI--DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL----S 557
            + +C  + ++   +   + L  L L  CSNL+ELP  + + +NL+ +D+  C  L    S
Sbjct: 777  LYYCSSLIRLPSSIGNAINLLILDLNGCSNLLELPSSIGNAINLQKLDLRRCAKLLELPS 836

Query: 558  SKSWCVKL--FKISDLSLSLKLPQII 629
            S    + L    + D S  L+LP  I
Sbjct: 837  SIGNAINLQNLLLDDCSSLLELPSSI 862



 Score = 28.5 bits (62), Expect(2) = 2.8
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 6/60 (10%)
 Frame = +3

Query: 465  LYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCVKL-----FKISDLSLSLKLPQI 626
            L  CSNL+ELP  + +L  L+ + + GC  L      + L       ++D S+  + P+I
Sbjct: 873  LSNCSNLVELPLSIGNLQKLQELILKGCSKLEDLPININLESLDILVLNDCSMLKRFPEI 932



 Score = 24.6 bits (52), Expect(2) = 2.8
 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 10/51 (19%)
 Frame = +1

Query: 340 RHCLSMVELPQSIRDTVH----------ALFSIAGKCTRSTSLAY*GYMNC 462
           R C  ++ELP SI + ++          +L  +      +T+L Y    NC
Sbjct: 826 RRCAKLLELPSSIGNAINLQNLLLDDCSSLLELPSSIGNATNLVYMNLSNC 876



 Score = 23.1 bits (48), Expect(2) = 1.3
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = +1

Query: 340 RHCLSMVELPQSIRDTVH 393
           R+C ++VELP SI + ++
Sbjct: 754 RYCSNLVELPSSIGNAIN 771



>pir|T04426|T04426 hypothetical protein T18B16.20 - Arabidopsis
           thaliana>gb:ATCHRIV50_1545745 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 50.>gb:ATF13C5_1548426
           Arabidopsis thaliana DNA chromosome 4, BAC clone F13C5
           (ESSA project).
          Length = 1405

 Score = 39.3 bits (90), Expect = 0.096
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           +A ++ L++L L  CS + ELP ++ L +LE  D+ GCI L +
Sbjct: 698 IADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLKN 740



 Score = 36.6 bits (83), Expect = 0.62
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           ++ L  L EL + +CS L  LP ++ L NLE  D+ GC  L +
Sbjct: 768 ISELSNLKELIIRKCSKLKTLPNLEKLTNLEIFDVSGCTELET 810



>pir|T47438|T47438 disease resistance protein homolog - Arabidopsis
            thaliana>gb:ATT18B22_1554758 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T18B22.>gb:BT005790_1638712
            Arabidopsis thaliana clone C104929 putative disease
            resistance protein homolog (At3g44630) mRNA, complete
            cds.
          Length = 1214

 Score = 39.3 bits (90), Expect = 0.096
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 7/124 (5%)
 Frame = +3

Query: 279  IELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHE 458
            ++L  C  L  L    P S+   +L G    ++  +C RV+    K+  I+   +  LH+
Sbjct: 768  LDLRDCSSLVKL----PPSINANNLQG----LSLTNCSRVV----KLPAIE--NVTNLHQ 813

Query: 459  LYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCV------KLFKISDLSLSLKL 617
            L L  CS+LIELP  + +  NL  +DI GC +L      +      K F +S+ S  ++L
Sbjct: 814  LKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIGDMTNLKEFDLSNCSNLVEL 873

Query: 618  PQII 629
            P  I
Sbjct: 874  PSSI 877



>sp|O50052|DR25_ARATH Putative disease resistance protein At4g19050.
          Length = 1181

 Score = 39.3 bits (90), Expect = 0.096
 Identities = 17/43 (39%), Positives = 28/43 (65%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           +A ++ L++L L  CS + ELP ++ L +LE  D+ GCI L +
Sbjct: 698 IADVVNLNKLLLRNCSLIEELPSIEKLTHLEVFDVSGCIKLKN 740



 Score = 36.6 bits (83), Expect = 0.62
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           ++ L  L EL + +CS L  LP ++ L NLE  D+ GC  L +
Sbjct: 768 ISELSNLKELIIRKCSKLKTLPNLEKLTNLEIFDVSGCTELET 810



>gb:AF310958_1785050 Linum usitatissimum cv. 'Akmolinsk'
           resistance-like protein P1-A (p1-A) gene, complete cds.
          Length = 1200

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 22/52 (42%), Positives = 30/52 (57%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           I  CW+ Y  D   LL L  L L  C+NLI +P + S +NLE + + GC +L
Sbjct: 666 IQRCWEGY--DQPQLLNLIVLDLRYCANLIAIPDISSSLNLEELLLFGCRSL 715



>gb:LUS310163_1685470 Linum usitatissimum Nbi-D gene.
          Length = 1108

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 411  WKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKI 590
            WK +  DL+ L  L  L +  C  LIE+PG+D+L +L+ + + GC ++          K+
Sbjct: 951  WKQFP-DLSNLKNLRVLCMSFCQELIEVPGLDALESLKWLSMEGCRSIR---------KV 1000

Query: 591  SDLSLSLKL 617
             DLS   KL
Sbjct: 1001 PDLSGLKKL 1009



 Score = 38.5 bits (88), Expect = 0.16
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
            W+ + GC+ +R + + +G + LKTL +   I     R   R               L  L
Sbjct: 988  WLSMEGCRSIRKVPDLSGLKKLKTLDVESCIQLKEVRGLER---------------LESL 1032

Query: 453  HELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
             EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1033 EELKMSGCESIEELPNLSGLKNLRELLLKGCIQL 1066



>gb:LUS310162_1685469 Linum usitatissimum Nbi-C gene.
          Length = 1107

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLR 449
            ++ L GC+ +R + + +G + LKTL + G                C ++ +++ L  L  
Sbjct: 975  YLSLSGCQSIRKVPDLSGMKKLKTLDVEG----------------CIQLKEVEGLERLES 1018

Query: 450  LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
            L EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1019 LEELKMSGCKSIEELPNLSGLKNLRELLLKGCIQL 1053



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +3

Query: 429  DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
            +L+ L  L EL +  C  LIE+PG+D+L +LE + + GC ++          K+ DLS  
Sbjct: 943  NLSNLKNLRELGMDYCLELIEVPGLDTLESLEYLSLSGCQSIR---------KVPDLSGM 993

Query: 609  LKL 617
             KL
Sbjct: 994  KKL 996



>gb:LUS310159_1685466 Linum usitatissimum N2-D gene.
          Length = 1108

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 411  WKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKI 590
            WK +  DL+ L  L  L +  C  LIE+PG+D+L +L+ + + GC ++          K+
Sbjct: 951  WKQFP-DLSNLKNLRVLCMSFCQELIEVPGLDALESLKWLSMEGCRSIR---------KV 1000

Query: 591  SDLSLSLKL 617
             DLS   KL
Sbjct: 1001 PDLSGLKKL 1009



 Score = 38.5 bits (88), Expect = 0.16
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
            W+ + GC+ +R + + +G + LKTL +   I     R   R               L  L
Sbjct: 988  WLSMEGCRSIRKVPDLSGLKKLKTLDVESCIQLKEVRGLER---------------LESL 1032

Query: 453  HELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
             EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1033 EELKMSGCESIEELPNLSGLKNLRELLLKGCIQL 1066



>gb:LUS310158_1685465 Linum usitatissimum N2-C gene.
          Length = 1119

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 2/95 (2%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLR 449
            ++ L GC+ +R + + +G + LKTL + G                C ++ +++ L  L  
Sbjct: 987  YLSLSGCQSIRKVPDLSGMKKLKTLDVEG----------------CIQLKEVEGLERLES 1030

Query: 450  LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
            L EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1031 LEELKMSGCKSIEELPNLSGLKNLRELLLKGCIQL 1065



 Score = 37.7 bits (86), Expect = 0.28
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +3

Query: 429  DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
            +L+ L  L EL +  C  LIE+PG+D+L +LE + + GC ++          K+ DLS  
Sbjct: 955  NLSNLKNLRELGMDYCLELIEVPGLDTLESLEYLSLSGCQSIR---------KVPDLSGM 1005

Query: 609  LKL 617
             KL
Sbjct: 1006 KKL 1008



>gb:LUS310150_1685453 Linum usitatissimum variety Bombay Ngc-D, Ngc-A
            and Ngc-B genes.
          Length = 1108

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 411  WKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKI 590
            WK +  DL+ L  L  L +  C  LIE+PG+D+L +L+ + + GC ++          K+
Sbjct: 951  WKQFP-DLSNLKNLRVLCMSFCQELIEVPGLDALESLKWLSMEGCRSIR---------KV 1000

Query: 591  SDLSLSLKL 617
             DLS   KL
Sbjct: 1001 PDLSGLKKL 1009



 Score = 38.5 bits (88), Expect = 0.16
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 1/94 (1%)
 Frame = +3

Query: 276  WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
            W+ + GC+ +R + + +G + LKTL +   I     R   R               L  L
Sbjct: 988  WLSMEGCRSIRKVPDLSGLKKLKTLDVESCIQLKEVRGLER---------------LESL 1032

Query: 453  HELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
             EL +  C ++ ELP +  L NL  + + GCI L
Sbjct: 1033 EELKMSGCESIEELPNLSGLKNLRELLLKGCIQL 1066



>gb:TBBCHR1A3_1398783 Trypanosoma brucei DNA chromosome 1, segment
           3/4.
          Length = 349

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = +3

Query: 279 IELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHE 458
           + +  C  L  +N  G   LK LS                I  CW + ++ +     L  
Sbjct: 172 VRISRCGMLAEVNLDGTVKLKKLS----------------IDECWALKEVYVTRCKTLES 215

Query: 459 LYLYECSNLIELPGVDSLVNLEGIDIHGCITLS 557
           + L +CS L  L G+  LV+L+ +++ GCI+++
Sbjct: 216 VALVDCSRLKSLCGLVHLVSLKSLNLEGCISIA 248



>gb:AF310960_1785053 Linum usitatissimum cv. 'Abyssinian'
           resistance-like protein P2-A (p2-A), P2 rust resistance
           protein, and germin-like protein genes, complete cds.
          Length = 1211

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVK 578
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + + GC +L    + V+
Sbjct: 679 IRRCWEGY--DQPQLVNLIVLDLRYCTNLIAIPDISSSLNLEELLLFGCRSLVEVPFHVQ 736

Query: 579 -LFKISDLSLS 608
            L K+  L +S
Sbjct: 737 YLTKLVTLDIS 747



>gb:HVU507093_1682775 Hordeum vulgare mRNA for NBS-LRR disease
            resistance protein homologue (rga S-9201 gene).
          Length = 1262

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = +3

Query: 279  IELVGCKKLRAL--NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
            + LV CKKL +L  +  G ++L+TL                 + H  +     L GL  L
Sbjct: 807  LNLVECKKLESLPESLGGLKNLQTLDFS--------------VCHKLESVPESLGGLNNL 852

Query: 453  HELYLYECSNLIEL-PGVDSLVNLEGIDIHGCITLSS 560
              L L  C NL+ L   + SL NL+ +D+ GC  L S
Sbjct: 853  QTLKLSVCDNLVSLLKSLGSLKNLQTLDLSGCKKLES 889



 Score = 35.4 bits (80), Expect = 1.4
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 29/133 (21%)
 Frame = +3

Query: 279  IELVGCKKLRAL--NFTGPRSLKTL---------SLYG*IATINQRHCPRVILHCWKMYK 425
            ++L  C KL +L  +  G ++L+TL         SL   + ++   H  ++ + C+K+  
Sbjct: 1023 LQLSFCHKLESLPESLGGLKNLQTLTLSVCDKLESLPESLGSLKNLHTLKLQV-CYKLKS 1081

Query: 426  I--DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSS------------ 560
            +   L  +  LH L L  C NL  +P  V SL NL+ +++  C  L S            
Sbjct: 1082 LPESLGSIKNLHTLNLSVCHNLESIPESVGSLENLQILNLSNCFKLESIPKSLGSLKNLQ 1141

Query: 561  ---KSWCVKLFKI 590
                SWC +L  +
Sbjct: 1142 TLILSWCTRLVSL 1154



 Score = 33.5 bits (75), Expect = 5.3
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +3

Query: 405  HCWKMYKI--DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSS 560
            +C+K+  I   L  L  L  L L  C+ L+ LP  + +L NL+ +D+ GC  L S
Sbjct: 1123 NCFKLESIPKSLGSLKNLQTLILSWCTRLVSLPKNLGNLKNLQTLDLSGCKKLES 1177



>sp|Q9T048|DR27_ARATH Putative disease resistance protein
           At4g27190.>pir|T06049|T06049 hypothetical protein
           T24A18.140 - Arabidopsis thaliana>gb:ATCHRIV66_1546600
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 66.>gb:ATT24A18_1555399 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T24A18, partial sequence (ESSA
           project).
          Length = 985

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 2/67 (2%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWC--VKLFKISDLSL 605
           L  L  LH L+L +C  L++LP +++L  LE +D+ G   L        +K F+  DLS 
Sbjct: 570 LLRLFSLHSLFLRDCFKLVKLPSLETLAKLELLDLCGTHILEFPRGLEELKRFRHLDLSR 629

Query: 606 SLKLPQI 626
           +L L  I
Sbjct: 630 TLHLESI 636



>pir|T47442|T47442 disease resistance protein homlog - Arabidopsis
            thaliana>gb:ATT18B22_1554762 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T18B22.
          Length = 1199

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 6/66 (9%)
 Frame = +3

Query: 450  LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV------KLFKISDLSLSL 611
            L +L L  CS ++ELP +++  NL+ +D+  C +L      +      K   IS  S  +
Sbjct: 811  LQQLSLINCSRVVELPAIENATNLQKLDLGNCSSLIELPLSIGTATNLKELNISGCSSLV 870

Query: 612  KLPQII 629
            KLP  I
Sbjct: 871  KLPSSI 876



 Score = 35.4 bits (80), Expect(2) = 0.17
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSL 605
           L  L  LYL  CS+L+ELP   +   LE + +  C +L      +    +  LSL
Sbjct: 762 LTSLQRLYLQRCSSLVELPSFGNATKLEELYLENCSSLEKLPPSINANNLQQLSL 816



 Score = 21.9 bits (45), Expect(2) = 0.17
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +1

Query: 340 RHCLSMVELPQSI 378
           R C S+VELP SI
Sbjct: 747 RDCSSLVELPSSI 759



>gb:AP006164_1861172 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:B1386G10.
          Length = 1284

 Score = 38.1 bits (87), Expect = 0.21
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 4/81 (4%)
 Frame = +3

Query: 384  HCPRV--ILHCWKMYKIDLAGLLRLHELYLYECSNLIELP--GVDSLVNLEGIDIHGCIT 551
            +CP +  +LHC+    + L  L    EL + +C  L  LP  G+  LVNL+ +++  C  
Sbjct: 969  YCPNLNSLLHCFLGQNVTLTSL---RELRINQCEKLEYLPLNGLMELVNLQILEVSDCSM 1025

Query: 552  LSSKSWCVKLFKISDLSLSLK 614
            L      VKL   S   LS+K
Sbjct: 1026 LKKSGMEVKLLPSSLEQLSIK 1046



 Score = 32.7 bits (73), Expect = 9.0
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 3/46 (6%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELPGV---DSLVNLEGIDIHGCITLSS 560
            LAGL  L  L L  CS+LI LP V   ++L  L+ + ++GC  LSS
Sbjct: 1059 LAGLEALTFLELANCSHLISLPTVKTFETLTALKELRLYGCPELSS 1104



>gb:ATAC016829_1543647 Arabidopsis thaliana chromosome III BAC T6K12
           genomic sequence, complete sequence.
          Length = 896

 Score = 33.9 bits (76), Expect(2) = 0.23
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
           L  L EL L ECS+L+ELP    +L N+E ++ + C +L
Sbjct: 767 LTNLQELDLRECSSLVELPTSFGNLANVESLEFYECSSL 805



 Score = 23.1 bits (48), Expect(2) = 0.23
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +1

Query: 340 RHCLSMVELPQS 375
           R CLS+VELP S
Sbjct: 752 RECLSLVELPSS 763



>gb:AF310966_1785058 Linum usitatissimum cv. 'Koto' resistance-like
           protein P-B (p-B) gene, complete cds.
          Length = 1211

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + + GC +L
Sbjct: 679 IRRCWEGY--DQPQLVNLIVLDLRYCTNLIAIPDISSSLNLEELLLFGCRSL 728



>gb:AF310962_1785056 Linum usitatissimum cv. 'Leona' resistance-like
           protein P3-B (p3-B) gene, complete cds.
          Length = 1188

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVK 578
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +N+E + + GC +L    + V+
Sbjct: 664 IQRCWEGY--DQPQLVNLIVLDLCYCANLIAIPDISSSLNIEELLLFGCKSLVEVPFHVQ 721

Query: 579 -LFKISDLSLS 608
            L K+  L +S
Sbjct: 722 YLTKLVTLDIS 732



>pir|B36359|B36359 VSG expression site-associated protein ES88 -
           Trypanosoma brucei (fragment)
          Length = 76

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
 Frame = +3

Query: 282 ELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKID-LAGLLRLHE 458
           +L GC+++ +L+  G  +LK L  +              I  C ++   D +  L  L  
Sbjct: 1   DLSGCERITSLS--GLETLKGLRKFK-------------IRGCKEIMSFDPIWSLHHLRV 45

Query: 459 LYLYECSNLIELPGVDSLVNLEGIDIHGC 545
           LY+ EC NL +L G++ +  LE + +HGC
Sbjct: 46  LYVSECGNLEDLSGLEGITGLEELYLHGC 74



>gb:AF310968_1785059 Linum usitatissimum cv. 'Hoshangabad'
           resistance-like protein PH-B (pH-B) gene, complete cds.
          Length = 1202

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVK 578
           I  CW+ Y  D   L+ L  L L  C+N+I +P + S +N+E + + GC +L    + V+
Sbjct: 679 IRRCWEGY--DQPQLVNLIVLDLCYCANIIAIPDISSSLNIEELLLFGCKSLVEVPFHVQ 736

Query: 579 -LFKISDLSLS 608
            L K+  L +S
Sbjct: 737 YLTKLVTLDIS 747



>gb:OSJN00045_1693805 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0012E08, complete sequence.
          Length = 1028

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 7/107 (6%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWC------VKLFKISDL 599
           +++L EL L  CSNL ELP  + +L +L  ++I G    S   W       ++L K+ + 
Sbjct: 429 MIKLEELLLSMCSNLEELPRSISALSSLLTLEISGTKLTSLPDWMFIEMQQLQLLKLIEN 488

Query: 600 SLSLKLPQIILFHSMW*CCLSCISPLYLYLGIAISPCTQFPEFEVIG 740
            L + +P+ I          SC++ L++ LG     C +  E EV G
Sbjct: 489 KLLVSVPRSI-------SKASCLNKLHI-LG-----CDELDEIEVFG 522



>gb:AB018113_1513800 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFC19.
          Length = 1214

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +3

Query: 282 ELVGCKKLRALNFTGPRSLKTLS--LYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLH 455
           EL    KL  L  +G  SL  +S   +     +   H   + +   +     ++GL  LH
Sbjct: 651 ELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKI---ESSPPSISGLKELH 707

Query: 456 ELYLYECSNLIELPGVDSLVNLEGIDIHG 542
            L + +C  L +LP +  LVNLE +D+ G
Sbjct: 708 CLIIKDCPLLQDLPNIQELVNLEVVDVSG 736



 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLS 557
           L  L+EL L +C NL  +P ++ L NLE ID+ G   L+
Sbjct: 862 LSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLA 900



>gb:AB017065_1513377 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFC16.
          Length = 1187

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 16/77 (20%)
 Frame = +3

Query: 387  CPRVILHCWKMYKIDLAGLL------------RLHELYLYECSNLIELP-GVDSLVNLEG 527
            CP  +L+  ++  ++L+G L             L  LYL +CS+L+ELP  +++  NL+ 
Sbjct: 816  CPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSLMELPFTIENATNLDT 875

Query: 528  IDIHGC---ITLSSKSW 569
            + + GC   + L S  W
Sbjct: 876  LYLDGCSNLLELPSSIW 892



 Score = 33.5 bits (75), Expect = 5.3
 Identities = 15/54 (27%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +3

Query: 399 ILHCWKMYKI--DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           +L+C  + +    +  L RL +L L  C +L++LP + +++NL+ + +  C +L
Sbjct: 807 LLNCSSLMECPSSMLNLTRLEDLNLSGCLSLVKLPSIGNVINLQSLYLSDCSSL 860



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 441  LLRLHELYLYECSNLIELPG-VDSLVNLEGIDIHGC---ITLSSKSWCVKLFKISDLS 602
            +  L  LYL  CS+L ELP  V++ +NL+ + +  C   + L S  W +      D+S
Sbjct: 894  ITNLQSLYLNGCSSLKELPSLVENAINLQSLSLMKCSSLVELPSSIWRISNLSYLDVS 951



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 15/108 (13%)
 Frame = +3

Query: 276 WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDL------ 434
           W++L  C  L+ L +F+   +L+ L L   ++ +     P  I +   + ++DL      
Sbjct: 661 WMDLSFCVNLKELPDFSTATNLQELRLINCLSLVE---LPSSIGNATNLLELDLIDCSSL 717

Query: 435 -------AGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
                    L  L +L+L  CS+L++LP    ++ +L+ +++ GC +L
Sbjct: 718 VKLPSSIGNLTNLKKLFLNRCSSLVKLPSSFGNVTSLKELNLSGCSSL 765



>pir|T47430|T47430 disease resistence-like protein - Arabidopsis
           thaliana>gb:ATT22K7_1555297 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22K7.
          Length = 1007

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 7/66 (10%)
 Frame = +3

Query: 450 LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS--KSWCVKLFKISDLSLS----- 608
           L EL L  CS ++ELP +++  NL  + +  C +L     SW  ++ ++  L+L+     
Sbjct: 765 LQELSLRNCSRVVELPAIENATNLRELKLQNCSSLIELPLSWVKRMSRLRVLTLNNCNNL 824

Query: 609 LKLPQI 626
           + LPQ+
Sbjct: 825 VSLPQL 830



 Score = 35.4 bits (80), Expect = 1.4
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 1/111 (0%)
 Frame = +3

Query: 276 WIELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRL 452
           W++L   + L+ L N +   +L+ L L         R C  ++     + K+    +L L
Sbjct: 674 WMDLSDSEDLKELPNLSTATNLEELKL---------RRCSSLVELPSSIEKLTSLQILDL 724

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSL 605
           H      CS+L+ELP   +   LE +D+  C +L      +    + +LSL
Sbjct: 725 HS-----CSSLVELPSFGNATKLEKLDLENCSSLVKLPPSINANNLQELSL 770



>sp|Q8VZC7|DR36_ARATH Probable disease resistance protein
           At5g45510.>gb:AY065063_1566217 Arabidopsis thaliana
           AT5g45510/MFC19_18 mRNA, complete cds.
          Length = 1202

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)
 Frame = +3

Query: 282 ELVGCKKLRALNFTGPRSLKTLS--LYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLH 455
           EL    KL  L  +G  SL  +S   +     +   H   + +   +     ++GL  LH
Sbjct: 651 ELKALTKLNTLEVSGASSLSKISEKFFESFPELRSLHLSGLKI---ESSPPSISGLKELH 707

Query: 456 ELYLYECSNLIELPGVDSLVNLEGIDIHG 542
            L + +C  L +LP +  LVNLE +D+ G
Sbjct: 708 CLIIKDCPLLQDLPNIQELVNLEVVDVSG 736



 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLS 557
           L  L+EL L +C NL  +P ++ L NLE ID+ G   L+
Sbjct: 862 LSSLNELLLRDCINLDAIPNIEKLENLEVIDVSGSAKLA 900



>pir|T05207|T05207 hypothetical protein F24J7.30 - Arabidopsis
           thaliana>gb:ATCHRIV50_1545787 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 50.>gb:ATF24J7_1549918
           Arabidopsis thaliana DNA chromosome 4, BAC clone F24J7
           (ESSA project).
          Length = 417

 Score = 36.6 bits (83), Expect = 0.62
 Identities = 21/52 (40%), Positives = 30/52 (57%)
 Frame = +3

Query: 441 LLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISD 596
           L  L  LYL  C NLI LP + S    + +D+HGCI+L + S  + L  I++
Sbjct: 74  LHHLKSLYLKNCKNLISLPVLPSN---QYLDVHGCISLETVSKPMTLLVIAE 122



>gb:AF310964_1785057 Linum usitatissimum cv. 'CI 1911 Punjab'
           resistance-like protein P4-B (p4-B) gene, complete cds.
          Length = 1202

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + +  C++L
Sbjct: 679 IRRCWEGY--DQPQLVNLIVLDLCYCANLITIPDISSSLNLEELLLLRCVSL 728



>gb:AF310961_1785055 Linum usitatissimum cv. 'Leona' resistance-like
           protein P3-A (p3-A) gene, complete cds.
          Length = 1110

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + +  C++L
Sbjct: 663 IRRCWEGY--DQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSL 712



>gb:AF310960_1785052 Linum usitatissimum cv. 'Abyssinian'
           resistance-like protein P2-A (p2-A), P2 rust resistance
           protein, and germin-like protein genes, complete cds.
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + +  C++L
Sbjct: 663 IRRCWEGY--DQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCRCVSL 712



>gb:AF310959_1785051 Linum usitatissimum cv. 'Akmolinsk'
           resistance-like protein P1-B (p1-B) gene, complete cds.
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 399 ILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVK 578
           I  CW+ Y  D   L+ L  L L  C+NLI +P + S +NLE + +  C++L    + V+
Sbjct: 664 IRRCWEGY--DQPQLVNLIVLDLRYCANLIAIPDISSSLNLEELLLCLCVSLVEVPFHVQ 721

Query: 579 -LFKISDLSLS 608
            L K+  L +S
Sbjct: 722 YLTKLVTLDIS 732



>gb:AB025639_1516695 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 1285

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 26/84 (30%), Positives = 43/84 (51%), Gaps = 8/84 (9%)
 Frame = +3

Query: 402 LHCWKMYKIDLA--GLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL----SSK 563
           L C ++ K+ L+      L +  L  CS+L+ELP + +  NL+ +D+  C +L    SS 
Sbjct: 725 LGCLRLLKLPLSIVKFTNLKKFILNGCSSLVELPFMGNATNLQNLDLGNCSSLVELPSSI 784

Query: 564 SWCVKL--FKISDLSLSLKLPQII 629
              + L    +S+ S  +KLP  I
Sbjct: 785 GNAINLQNLDLSNCSSLVKLPSFI 808



>gb:AE011952_278006 Xanthomonas axonopodis pv. citri str. 306,
           section 330 of 469 of the complete
           genome.>gb:AE008923_919781 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 497

 Score = 36.2 bits (82), Expect = 0.81
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +3

Query: 414 KMYKIDLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLS 557
           + Y     G   L  L L +CSNL+ LP  +  L  LE +D+ GC+ LS
Sbjct: 234 RSYPPIFGGSAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLS 282



>gb:AF499727_1806151 Cucumis melo BAC clone PIT92-60K17, complete
           sequence.
          Length = 1092

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 28/72 (38%), Positives = 34/72 (47%), Gaps = 16/72 (22%)
 Frame = +3

Query: 450 LHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL-----SSKSW----------CVKL 581
           L ELYL  CSNL  +P    SL  L  +D+H C+ L     S  SW          C KL
Sbjct: 653 LEELYLSNCSNLKTIPKSFLSLRKLVTLDLHHCVNLKKIPRSYISWEALEDLDLSHCKKL 712

Query: 582 FKISDLSLSLKL 617
            KI D+S +  L
Sbjct: 713 EKIPDISSASNL 724



 Score = 34.7 bits (78), Expect = 2.4
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +3

Query: 279  IELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLH 455
            + L  CKKL  + +F+   +LK LSL           C  +     ++    +  L +L 
Sbjct: 774  LNLSWCKKLEEIPDFSSTSNLKHLSL---------EQCTSL-----RVVHDSIGSLSKLV 819

Query: 456  ELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
             L L +CSNL +LP    L +L+ + + GC  L +
Sbjct: 820  SLNLEKCSNLEKLPSYLKLKSLQNLTLSGCCKLET 854



 Score = 34.7 bits (78), Expect = 2.4
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +3

Query: 279 IELVGCKKLRAL-NFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLH 455
           ++L  CKKL  + + +   +L++LS            C  ++     M    +  L +L 
Sbjct: 704 LDLSHCKKLEKIPDISSASNLRSLSF---------EQCTNLV-----MIHDSIGSLTKLV 749

Query: 456 ELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIIL 632
            L L  CSNL +LP   S   L+ +++         SWC KL +I D S +  L  + L
Sbjct: 750 TLKLQNCSNLKKLPRYISWNFLQDLNL---------SWCKKLEEIPDFSSTSNLKHLSL 799



>gb:AY091558_1574663 Pinus taeda NBS/LRR mRNA, partial cds.
          Length = 967

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
 Frame = +3

Query: 333 SLKTLSLYG*IATINQRHCPRVIL-----HCWKMYKID-LAGLLRLHELYLYECSNLIEL 494
           SLKTL +Y     +    C   +      +C ++  I   +  +RL +L L  C  L E+
Sbjct: 684 SLKTLEVYACKNLVRAEICSTTLTEVSLKNCLQLRTISGFSADMRLTKLCLRNCQELFEV 743

Query: 495 PGVDSLVNLEGIDIHGCITLSSKS--WCVKLFKISDLSLS 608
             +  L  LE +DI GC+ L S+      K  ++ D+S++
Sbjct: 744 TSLGDLHFLETLDISGCLKLFSEGGLHLFKQLEVLDISVT 783



>gb:AC006528_1534363 Arabidopsis thaliana chromosome 2 clone F9B22
           map mi398, complete sequence.
          Length = 972

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +3

Query: 396 VILHCW--KMYKI--DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSK 563
           V L+ W  K+ K+  ++  L  L  + L+   NL ELP + S  NLE ++++GC +L   
Sbjct: 654 VELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVEL 713

Query: 564 SWCV----KLFK--ISDLSLSLKLPQII 629
            + +    KL K  +S  S  L+LP  I
Sbjct: 714 PFSIGNATKLLKLELSGCSSLLELPSSI 741



 Score = 35.4 bits (80), Expect = 1.4
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 8/117 (6%)
 Frame = +3

Query: 303  LRALNFTGPRSLKTL-SLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECS 479
            L+ L+ +   SLK L S  G    + + H   +     K     +     L EL+L  CS
Sbjct: 771  LKELDLSCCSSLKELPSSIGNCTNLKKLHL--ICCSSLKELPSSIGNCTNLKELHLTCCS 828

Query: 480  NLIELP-GVDSLVNLEGIDIHGCITL------SSKSWCVKLFKISDLSLSLKLPQII 629
            +LI+LP  + + +NLE + + GC +L        K+  +K+  +  LS  ++LP  I
Sbjct: 829  SLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFI 885



>pir|H84513|H84513 probable disease resistance protein [imported] -
           Arabidopsis thaliana
          Length = 1215

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 10/88 (11%)
 Frame = +3

Query: 396 VILHCW--KMYKI--DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSK 563
           V L+ W  K+ K+  ++  L  L  + L+   NL ELP + S  NLE ++++GC +L   
Sbjct: 654 VELNMWGSKLEKLWEEIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVEL 713

Query: 564 SWCV----KLFK--ISDLSLSLKLPQII 629
            + +    KL K  +S  S  L+LP  I
Sbjct: 714 PFSIGNATKLLKLELSGCSSLLELPSSI 741



 Score = 35.4 bits (80), Expect = 1.4
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 8/117 (6%)
 Frame = +3

Query: 303  LRALNFTGPRSLKTL-SLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECS 479
            L+ L+ +   SLK L S  G    + + H   +     K     +     L EL+L  CS
Sbjct: 771  LKELDLSCCSSLKELPSSIGNCTNLKKLHL--ICCSSLKELPSSIGNCTNLKELHLTCCS 828

Query: 480  NLIELP-GVDSLVNLEGIDIHGCITL------SSKSWCVKLFKISDLSLSLKLPQII 629
            +LI+LP  + + +NLE + + GC +L        K+  +K+  +  LS  ++LP  I
Sbjct: 829  SLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFI 885



>gb:AC007197_1535539 Arabidopsis thaliana chromosome 2 clone T22C12
           map mi398, complete sequence.
          Length = 554

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 8/117 (6%)
 Frame = +3

Query: 303 LRALNFTGPRSLKTL-SLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECS 479
           L+ L+ +   SLK L S  G    + + H   +     K     +     L EL+L  CS
Sbjct: 110 LKELDLSCCSSLKELPSSIGNCTNLKKLHL--ICCSSLKELPSSIGNCTNLKELHLTCCS 167

Query: 480 NLIELP-GVDSLVNLEGIDIHGCITL------SSKSWCVKLFKISDLSLSLKLPQII 629
           +LI+LP  + + +NLE + + GC +L        K+  +K+  +  LS  ++LP  I
Sbjct: 168 SLIKLPSSIGNAINLEKLILAGCESLVELPSFIGKATNLKILNLGYLSCLVELPSFI 224



 Score = 35.0 bits (79), Expect = 1.8
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV----KLFK--I 590
           ++  L  L  + L+   NL ELP + S  NLE ++++GC +L    + +    KL K  +
Sbjct: 8   EIQPLRNLKRMDLFSSKNLKELPDLSSATNLEVLNLNGCSSLVELPFSIGNATKLLKLEL 67

Query: 591 SDLSLSLKLPQII 629
           S  S  L+LP  I
Sbjct: 68  SGCSSLLELPSSI 80



>gb:AB006706_1510012 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MVA3.
          Length = 1295

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 39/118 (33%), Positives = 51/118 (43%), Gaps = 17/118 (14%)
 Frame = +3

Query: 336  LKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAG------------LLRLHELYLYECS 479
            L+ LSL    + +N    P  I + W + ++DL+G            L RL+ L L  C 
Sbjct: 958  LRALSL----SNMNMTEIPNSIGNLWNLLELDLSGNNFEFIPASIKRLTRLNRLNLNNCQ 1013

Query: 480  NLIELPGVDSLV-NLEGIDIHGCITLSSKSWCVKLFKISDLSLS--LKLPQI--ILFH 638
             L  LP  D L   L  I IH C +L S S C   + +  L  S   KL Q   IL H
Sbjct: 1014 RLQALP--DELPRGLLYIYIHSCTSLVSISGCFNQYCLRKLVASNCYKLDQAAQILIH 1069



>gb:ATRPP5LE2_1554110 Arabidopsis thaliana RPP5 disease resistance
            locus, main contig.
          Length = 1361

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 11/78 (14%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL------SSKSWCVKL---- 581
            +  L  L  LY+  C+ L  LP   +L +LE +D+ GC +L      S+   C+ L    
Sbjct: 966  IGNLQNLRRLYMNRCTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISTNIVCLYLENTA 1025

Query: 582  -FKISDLSLSLKLPQIIL 632
              +I DLS + KL  +IL
Sbjct: 1026 IEEIPDLSKATKLESLIL 1043



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +3

Query: 450 LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           L E+ L   +NL E+P +   +NLE +D+ GC++L
Sbjct: 759 LKEMNLRYSNNLKEIPDLSLAINLEELDLFGCVSL 793



>gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segment
           3/4.
          Length = 713

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 36/122 (29%), Positives = 54/122 (44%), Gaps = 11/122 (9%)
 Frame = +3

Query: 294 CKKLRALNFTGPRSLKTLSLYG*IATINQRHCPR----VILHCWKMYKIDLAGL---LRL 452
           C+ L+ L+ +G  SL  +S          R C R    V+  C  +   DL+GL     L
Sbjct: 455 CRFLKTLDLSGCSSLCDISAL--------RECARLKTLVLSRCTGLR--DLSGLGECATL 504

Query: 453 HELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS----KSWCVKLFKISDLSLSLKLP 620
             L L EC +L+++  +   VNL  + + GC  L      K W  K  ++ DLS   KL 
Sbjct: 505 VSLDLSECHSLVDISALGGCVNLVALYLRGCNGLQDLNALKEW--KSLRMLDLSGFRKLE 562

Query: 621 QI 626
            +
Sbjct: 563 DV 564



>pir|T47431|T47431 disease resistence-like protein - Arabidopsis
           thaliana>gb:ATT22K7_1555298 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22K7.
          Length = 199

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +3

Query: 438 GLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWC 572
           G+ RL  L LY+C+NL+ LP + +  +L  ID + C +L     C
Sbjct: 35  GMSRLRVLRLYDCNNLVSLPQLSN--SLSWIDANNCKSLERMDCC 77



>pir|T48928|T48928 disease resistance protein-like - Arabidopsis
           thaliana>gb:ATF14L2_1548579 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14L2.
          Length = 1220

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSL 605
           +L+    L EL L  CS+L+ELP  ++ L +L+ +D+  C +L          K+ +L L
Sbjct: 732 NLSTATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENCSSLEKLPAIENATKLRELKL 791



>pir|T52346|T52346 disease resistance protein RPP1-WsA [imported] -
           Arabidopsis thaliana>gb:AF098962_1767940 Arabidopsis
           thaliana disease resistance protein RPP1-WsA gene,
           complete cds.
          Length = 1189

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 8/68 (11%)
 Frame = +3

Query: 450 LHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL--------SSKSWCVKLFKISDLSL 605
           L +L L  CS ++ELP +++  NL  +++  C +L        ++++  +K   IS  S 
Sbjct: 762 LQKLSLRNCSRIVELPAIENATNLWELNLLNCSSLIELPLSIGTARNLFLKELNISGCSS 821

Query: 606 SLKLPQII 629
            +KLP  I
Sbjct: 822 LVKLPSSI 829



>gb:AF098964_1767942 Arabidopsis thaliana disease resistance protein
           RPP1-WsC gene, partial cds.
          Length = 1217

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 7/52 (13%)
 Frame = +3

Query: 420 YKIDLAGL------LRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
           Y IDL  L        L EL L  CS+L+ELP  ++ L +L+ +D+  C +L
Sbjct: 716 YSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSL 767



>gb:AY091561_1574666 Pinus taeda NBS/LRR mRNA, partial cds.
          Length = 363

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%)
 Frame = +3

Query: 372 INQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGC 545
           IN  HCP +     K        L  L  + +  C  L +LP G  +L NL+ ID+ GC
Sbjct: 299 INMSHCPGL-----KQLPDGFGNLANLQHINMSHCPGLKQLPDGFGNLANLQHIDMSGC 352



>pir|T52348|T52348 disease resistance protein RPP1-WsC [imported] -
           Arabidopsis thaliana (fragment)
          Length = 1217

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 7/52 (13%)
 Frame = +3

Query: 420 YKIDLAGL------LRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL 554
           Y IDL  L        L EL L  CS+L+ELP  ++ L +L+ +D+  C +L
Sbjct: 716 YSIDLKELPNLSTATNLEELKLSNCSSLVELPSSIEKLTSLQILDLQSCSSL 767



>pir|E96682|E96682 hypothetical protein F12P19.1 [imported] -
           Arabidopsis thaliana>gb:AE005173_894233 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F12P19_1677365 Sequence of BAC F12P19 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 1036

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +3

Query: 429 DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITL-SSKSWCVKLFKISDLS 602
           DL+    L EL+L +CS+L+ELP  +    NL+ + ++ C +L    S    L K+  L+
Sbjct: 674 DLSTATNLQELFLVKCSSLVELPSSIGKATNLQKLYLNMCTSLVELPSSIGNLHKLQKLT 733

Query: 603 LS 608
           L+
Sbjct: 734 LN 735



>gb:AJ719272_2501459 Gallus gallus mRNA for hypothetical protein,
           clone 1a13.
          Length = 701

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 179 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISDD 225



>gb:AK129139_2069370 Mus musculus mRNA for mKIAA0429 protein.
          Length = 773

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 207 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 253



>gb:AF086645_1881782 Homo sapiens metastasis suppressor protein
           mRNA, complete cds.
          Length = 755

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 179 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 225



>gb:AP005811_1858292 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0706E03.
          Length = 427

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 4/97 (4%)
 Frame = +3

Query: 276 WIELVGCKKLRALNFTGPRSLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLH 455
           ++ L  C+KLR L    PR+L  L     +  +N  +CP V          D   L  LH
Sbjct: 163 YLNLQRCEKLRNL----PRTLGDLKR---LEYLNLSYCPGV--------SEDADYLCSLH 207

Query: 456 ELYLYE---CSNLIELPGV-DSLVNLEGIDIHGCITL 554
            L   +   CS L +LP +  +L NLE +++ GC  L
Sbjct: 208 ALRFLDLSGCSELQQLPHLFGNLTNLEDLNLSGCFRL 244



>gb:AP004869_1846308 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0419A09.
          Length = 136

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = -3

Query: 149 CFTPT---ASPTPPSERLRCSGSRRLALGISLPIDC 51
           C TPT   ASP+P S R R S  RRL+   S PI C
Sbjct: 98  CSTPTRAPASPSPASSRRRGSRRRRLSCAPSSPISC 133



>gb:AY091563_1574668 Pinus taeda TIR/P-loop/LRR mRNA, complete cds.
          Length = 348

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = +3

Query: 474 CSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           CS L ELP +++LV+LE +  +GC+ L S
Sbjct: 263 CSELAELPSLETLVSLEQLWANGCVNLRS 291



>gb:CR861458_1185453 Pongo pygmaeus mRNA; cDNA DKFZp459G172 (from
           clone DKFZp459G172).
          Length = 730

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 179 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 225



>gb:AK030533_1162051 Mus musculus adult male pituitary gland cDNA,
           RIKEN full-length enriched library, clone:5330428E08
           product:METASTASIS SUPPRESSOR PROTEIN homolog [Homo
           sapiens], full insert sequence.
          Length = 678

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 102 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 148



>pir|A85189|A85189 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545496 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551744 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1103

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +3

Query: 447 RLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           +L  + L EC N+IE+P +    NLE +D+  C +L
Sbjct: 759 KLKRVDLSECENMIEIPDLSKATNLEILDLSNCKSL 794



>pir|D71437|D71437 probable resistance gene - Arabidopsis thaliana
          Length = 2467

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +3

Query: 447  RLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
            +L  + L EC N+IE+P +    NLE +D+  C +L
Sbjct: 1907 KLKRVDLSECENMIEIPDLSKATNLEILDLSNCKSL 1942



 Score = 32.7 bits (73), Expect = 9.0
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 11/78 (14%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL-------SSKSWC----VK 578
           +  L +L  L + EC+ L  LP   +L +LE +D+ GC +L        S  W       
Sbjct: 749 IGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTA 808

Query: 579 LFKISDLSLSLKLPQIIL 632
           + +I DLS + KL  +IL
Sbjct: 809 IEEILDLSKATKLESLIL 826



>sp|Q8R1S4|MTS1_MOUSE Metastasis suppressor protein 1 (Missing in
           metastasis protein).>gb:AY214918_2079633 Mus musculus
           actin monomer-binding protein MIM (Mim) mRNA, complete
           cds.>gb:BC024131_2094402 Mus musculus metastasis
           suppressor 1, mRNA (cDNA clone MGC:37896 IMAGE:5101888),
           complete cds.
          Length = 759

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 183 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 229



>sp|O43312|MTS1_HUMAN Metastasis suppressor protein 1 (Missing in
           metastasis protein) (Metastasis suppressor YGL-1).
          Length = 755

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 474 THKDTIHVALISQRGRSCTFSSNGE*RVDSVSD*LWQFNHRETVSSD 334
           T K  +  ALI +RGR CTF S     ++     L +  H +T+S D
Sbjct: 179 TEKQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISED 225



>sp|Q9FKZ0|DR43_ARATH Probable disease resistance protein
           At5g66910.>gb:AB010700_1511268 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MUD21.>gb:AF462802_1801920 Arabidopsis thaliana
           AT5g66910/MUD21_17 mRNA, complete cds.
          Length = 815

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 6/115 (5%)
 Frame = +3

Query: 279 IELVGCKKLRALNFTGPR--SLKTLSLYG*IATINQRHCPRVILHCWKMYKID--LAGLL 446
           I++  C  L  L +  P   SLKTLS                I +C K+ ++   +  L 
Sbjct: 660 IDIDYCYDLDELPYWIPEVVSLKTLS----------------ITNCNKLSQLPEAIGNLS 703

Query: 447 RLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCV-KLFKISDLSL 605
           RL  L +  C NL ELP   + L NL  +DI  C+ L      + KL K+ ++S+
Sbjct: 704 RLEVLRMCSCMNLSELPEATERLSNLRSLDISHCLGLRKLPQEIGKLQKLENISM 758



>gb:AP002817_1822854 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0699D11.
          Length = 1292

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLS 608
           ++ L  L  L+LY C NL  LP  V +L NLE +++  C   S       L  + DL+LS
Sbjct: 614 ISSLHNLQTLHLYNCINLNVLPMSVCALENLEILNLSACNFHSLPDSIGHLQNLQDLNLS 673

Query: 609 L 611
           L
Sbjct: 674 L 674



>gb:AY535010_1612309 Nicotiana tabacum N-like protein (NH) gene,
            complete cds.
          Length = 941

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 26/71 (36%), Positives = 32/71 (45%)
 Frame = +3

Query: 333  SLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSL 512
            SLK L L G     N  H PR I            G LR+ EL    C  L +LP    +
Sbjct: 862  SLKKLYLSG----NNFEHLPRSIAQL---------GALRILELR--NCKRLTQLPEFTGM 906

Query: 513  VNLEGIDIHGC 545
            +NLE +D+ GC
Sbjct: 907  LNLEYLDLEGC 917



>gb:AB017914_1513685 Oryza sativa mRNA for L-zip+NBS+LRR, complete
           cds.
          Length = 1101

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 3/54 (5%)
 Frame = +3

Query: 405 HCWKMYKI--DLAGLLRLHELYLYECSNLIELP-GVDSLVNLEGIDIHGCITLS 557
           +C K+ K+  ++  L RLH+L L  C  L ELP  +  + +LE + + GC +L+
Sbjct: 630 YCGKLQKLHRNICRLSRLHKLDLEGCRYLSELPQNISKINSLEYLSVLGCASLT 683



>gb:AB012240_1511686 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18C1.
          Length = 697

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +3

Query: 405 HCWKMYKID-LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL 554
           H  K+ ++D LA    L ++ L  C++L  +P  D L NL+ +++ GC ++
Sbjct: 611 HSQKLLEVDELAKACNLEKIDLQGCTSLKSIPHTDRLKNLQFLNLSGCTSI 661



>gb:AC146718_1744626 Oryza sativa chromosome 3 B1130H05 genomic
           sequence, complete sequence.
          Length = 1094

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)
 Frame = +1

Query: 43  SRKQSIGREMPKANRREPEQRRRS-----DGGVGEAVGVK--HYK*RKASSIFTQDQFRR 201
           SR++S+  E+P A+      RR S     DG  GE++ ++  +Y+     SIFT ++ R+
Sbjct: 122 SRRESLDPELPGASSSSSSSRRTSGAFSMDGNGGESLSIEAQNYELNNTGSIFTPEELRQ 181



>gb:AC133930_1741600 Oryza sativa chromosome 3 BAC OSJNBa0039O18
           genomic sequence, complete sequence.
          Length = 1142

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)
 Frame = +1

Query: 43  SRKQSIGREMPKANRREPEQRRRS-----DGGVGEAVGVK--HYK*RKASSIFTQDQFRR 201
           SR++S+  E+P A+      RR S     DG  GE++ ++  +Y+     SIFT ++ R+
Sbjct: 170 SRRESLDPELPGASSSSSSSRRTSGAFSMDGNGGESLSIEAQNYELNNTGSIFTPEELRQ 229



>gb:CEC01G12_1359899 Caenorhabditis elegans cosmid C01G12, complete
           sequence.
          Length = 584

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 23/58 (39%), Positives = 32/58 (55%)
 Frame = +3

Query: 504 DSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIILFHSMW*CCLSCISPL 677
           +S+V +EG DIHG   L     C  +F I +  LS+ LPQ+++F         CISPL
Sbjct: 313 ESMVKVEGADIHGDREL--LLMCCTVFGIYE--LSILLPQLLIFF--------CISPL 358



>gb:AE005172_891596 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC000348_1530075 Genomic sequence
            for Arabidopsis thaliana BAC T7N9 from chromosome I,
            complete sequence.
          Length = 1560

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 2/76 (2%)
 Frame = +3

Query: 399  ILHCWKMYKI-DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
            + +C+ +  + DL+ L  L +L L  C+ ++++PG++ L  L+ + + GC +  S +   
Sbjct: 1313 LANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKK 1372

Query: 576  KLFKIS-DLSLSLKLP 620
            +L K S  +  +L LP
Sbjct: 1373 RLSKASLKMMRNLSLP 1388



>pir|B85189|B85189 disease resistance RPP5 like protein [imported] -
            Arabidopsis thaliana>gb:ATCHRIV45_1545497 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            45.>gb:ATFCA7_1551745 Arabidopsis thaliana DNA chromosome
            4, ESSA I FCA contig fragment No. 7.
          Length = 1317

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 11/78 (14%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL-------SSKSWC----VK 578
            +  L +L  L + EC+ L  LP   +L +LE +D+ GC +L        S  W       
Sbjct: 959  IGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTA 1018

Query: 579  LFKISDLSLSLKLPQIIL 632
            + +I DLS + KL  +IL
Sbjct: 1019 IEEILDLSKATKLESLIL 1036



>pir|G85188|G85188 disease resistance RPP5 like protein [imported] -
            Arabidopsis thaliana>gb:ATCHRIV45_1545494 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            45.>gb:ATFCA7_1551742 Arabidopsis thaliana DNA chromosome
            4, ESSA I FCA contig fragment No. 7.
          Length = 1304

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 11/78 (14%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL-------SSKSWC----VK 578
            +  L +L  L + EC+ L  LP   +L +LE +D+ GC +L        S  W       
Sbjct: 953  IGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTA 1012

Query: 579  LFKISDLSLSLKLPQIIL 632
            + +I DLS + KL  +IL
Sbjct: 1013 IEEILDLSKATKLESLIL 1030



>pir|B86398|B86398 protein T7N9.24 [imported] - Arabidopsis
            thaliana>gb:AE005172_891597 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC000348_1530076 Genomic sequence for
            Arabidopsis thaliana BAC T7N9 from chromosome I, complete
            sequence.
          Length = 1590

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 2/76 (2%)
 Frame = +3

Query: 399  ILHCWKMYKI-DLAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSSKSWCV 575
            + +C+ +  + DL+ L  L +L L  C+ ++++PG++ L  L+ + + GC +  S +   
Sbjct: 1345 LANCFSLESVSDLSELTILTDLNLTNCAKVVDIPGLEHLTALKRLYMTGCNSNYSLAVKK 1404

Query: 576  KLFKIS-DLSLSLKLP 620
            +L K S  +  +L LP
Sbjct: 1405 RLSKASLKMMRNLSLP 1420



>pir|B71437|B71437 probable resistance gene - Arabidopsis thaliana
          Length = 1422

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 11/78 (14%)
 Frame = +3

Query: 432  LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITL-------SSKSWC----VK 578
            +  L +L  L + EC+ L  LP   +L +LE +D+ GC +L        S  W       
Sbjct: 950  IGNLQKLVRLEMKECTGLEVLPTDVNLSSLETLDLSGCSSLRTFPLISKSIKWLYLENTA 1009

Query: 579  LFKISDLSLSLKLPQIIL 632
            + +I DLS + KL  +IL
Sbjct: 1010 IEEILDLSKATKLESLIL 1027



>pir|T18831|T18831 hypothetical protein C01G12.7 - Caenorhabditis
           elegans
          Length = 599

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 23/58 (39%), Positives = 32/58 (55%)
 Frame = +3

Query: 504 DSLVNLEGIDIHGCITLSSKSWCVKLFKISDLSLSLKLPQIILFHSMW*CCLSCISPL 677
           +S+V +EG DIHG   L     C  +F I +  LS+ LPQ+++F         CISPL
Sbjct: 328 ESMVKVEGADIHGDREL--LLMCCTVFGIYE--LSILLPQLLIFF--------CISPL 373



>pir|T06404|T06404 resistance complex protein I2C-2 -
            tomato>gb:AF004879_1760752 Lycopersicon esculentum
            resistance complex protein I2C-2 (I2C-2) gene, complete
            cds.
          Length = 1240

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 19/71 (26%), Positives = 36/71 (50%)
 Frame = +3

Query: 333  SLKTLSLYG*IATINQRHCPRVILHCWKMYKIDLAGLLRLHELYLYECSNLIELPGVDSL 512
            SLK   ++G         CP V+ +  ++ +  L G+ ++ E+Y+ +C+++   P     
Sbjct: 882  SLKRFRVFG---------CP-VVFYDAQVLRSQLEGMKQIEEIYIRDCNSVTSFPFSILP 931

Query: 513  VNLEGIDIHGC 545
              L+ IDI GC
Sbjct: 932  TTLKTIDISGC 942



>gb:AB011481_1511464 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSI17.
          Length = 1059

 Score = 30.4 bits (67), Expect(2) = 10.0
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +3

Query: 432 LAGLLRLHELYLYECSNLIELPGVDSLVNLEGIDIHGCITLSS 560
           +  L +L EL L  CS L  LP   SL +L+ +DI  C  L S
Sbjct: 746 IGSLHKLRELRLRGCSKLEVLPTNISLESLDNLDITDCSLLKS 788



 Score = 20.8 bits (42), Expect(2) = 10.0
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 346 CLSMVELPQSI 378
           C S+VELP SI
Sbjct: 736 CTSLVELPSSI 746


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 908,842,471
Number of Sequences: 1806583
Number of extensions: 18351829
Number of successful extensions: 41132
Number of sequences better than 10.0: 96
Number of HSP's better than 10.0 without gapping: 39189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41046
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57553322560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)