BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4190
         (680 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP002048_1821663 Arabidopsis thaliana genomic DNA, chromosome...   270   1e-71   
pir|T04859|T04859 extensin homolog F28A21.80 - Arabidopsis thali...   258   5e-68   Arabidopsis thaliana [mouse-ear cress]
pir|T06291|T06291 extensin homolog T9E8.80 - Arabidopsis thalian...   249   2e-65   Arabidopsis thaliana [mouse-ear cress]
pir|T01456|T01456 extensin homolog F24O1.18 - Arabidopsis thalia...   199   5e-50   Arabidopsis thaliana [mouse-ear cress]
pir|E86255|E86255 hypothetical protein [imported] - Arabidopsis ...   189   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome...   189   4e-47   
gb:AY091043_1574272 Arabidopsis thaliana unknown protein (At3g19...   189   4e-47   
pir|F96531|F96531 hypothetical protein F13F21.7 [imported] - Ara...   186   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AP003253_1826372 Oryza sativa (japonica cultivar-group) genom...   184   2e-45   
gb:AP003253_1826371 Oryza sativa (japonica cultivar-group) genom...   184   2e-45   
pir|C84534|C84534 hypothetical protein At2g15880 [imported] - Ar...   182   6e-45   Arabidopsis thaliana [mouse-ear cress]
pir|T05225|T05225 extensin homolog F17I5.160 - Arabidopsis thali...   177   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AF159296_1773220 Lycopersicon esculentum pollen extensin-like...   174   1e-42   
gb:AF159297_1773221 Zea mays pollen extensin-like protein (Pex2)...   173   3e-42   
pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731...   170   2e-41   Zea mays [maize]
pir|T04609|T04609 hypothetical protein F20O9.70 - Arabidopsis th...   169   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AP002524_1822400 Oryza sativa (japonica cultivar-group) genom...   168   7e-41   
gb:AC120505_1739755 Oryza sativa chromosome 3 BAC OSJNBa0066H15 ...   163   2e-39   
gb:AC130610_1740883 Oryza sativa (japonica cultivar-group) chrom...   162   7e-39   
gb:AY008306_1558198 Lilium longiflorum extensin-like protein mRN...   162   7e-39   
gb:AB022223_1515180 Arabidopsis thaliana genomic DNA, chromosome...   160   1e-38   
gb:AP003312_1827837 Oryza sativa (japonica cultivar-group) genom...   159   3e-38   
gb:AC092076_1735179 Oryza sativa chromosome 3 BAC OSJNBb0021G19 ...   159   3e-38   
gb:AP003761_1833074 Oryza sativa (japonica cultivar-group) genom...   152   4e-36   
gb:AP005647_1855410 Oryza sativa (japonica cultivar-group) genom...   149   3e-35   
gb:AP004307_1839965 Oryza sativa (japonica cultivar-group) genom...   147   2e-34   
pir|T13435|T13435 hypothetical protein T17A13.60 - Arabidopsis t...   122   8e-27   Arabidopsis thaliana [mouse-ear cress]
pir|A84581|A84581 probable disease resistance protein [imported]...   120   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AB073166_1523152 Arabidopsis thaliana DNA, chromosome 4 centr...   114   2e-24   
gb:OSJN00038_1693719 Oryza sativa genomic DNA, chromosome 4, BAC...    91   2e-17   
gb:AB025624_1516460 Arabidopsis thaliana genomic DNA, chromosome...    87   2e-16   
gb:OSJN00032_1693604 Oryza sativa genomic DNA, chromosome 4, BAC...    85   1e-15   
pir|B96534|B96534 hypothetical protein F14J22.4 [imported] - Ara...    79   6e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AK117932_1815939 Arabidopsis thaliana At1g63430 mRNA for puta...    76   6e-13   
gb:AE005173_894011 Arabidopsis thaliana chromosome 1, bottom arm...    71   2e-11   
pir|T48216|T48216 hypothetical protein T20L15.220 - Arabidopsis ...    70   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP000607_1820463 Arabidopsis thaliana genomic DNA, chromosome...    68   2e-10   
gb:AP004097_1837688 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
gb:AP004097_1837687 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
gb:AP003489_1829912 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genom...    66   5e-10   
gb:AP005245_1849450 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:AK117435_1815469 Arabidopsis thaliana At5g41180 mRNA for puta...    61   2e-08   
gb:AF177674_1774650 Arabidopsis thaliana cultivar Wassilewskia r...    61   2e-08   
gb:OSJN00196_1696553 Oryza sativa genomic DNA, chromosome 4, BAC...    61   2e-08   
gb:AB010072_1510934 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-08   
pir|C96745|C96745 hypothetical protein T9N14.3 [imported] - Arab...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF177673_1774649 Arabidopsis thaliana cultivar Lansberg erect...    60   4e-08   
pir|T02361|T02361 hypothetical protein T8F5.16 - Arabidopsis tha...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AC121364_1740170 Oryza sativa (japonica cultivar-group) chrom...    60   5e-08   
gb:OSJN00195_1696530 Oryza sativa genomic DNA, chromosome 4, BAC...    60   5e-08   
gb:BT003880_1637007 Arabidopsis thaliana clone RAFL15-22-I19 (R2...    60   5e-08   
gb:AB010698_1511224 Arabidopsis thaliana genomic DNA, chromosome...    60   5e-08   
pir|B84431|B84431 probable receptor protein kinase [imported] - ...    60   5e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...    60   5e-08   Solanum peruvianum [Peruvian tomato]
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    60   5e-08   Solanum lycopersicum
gb:BT010407_1640353 Arabidopsis thaliana At3g43740 mRNA, complet...    59   8e-08   
gb:AY530952_1611931 Zea mays unknown (Z576C20.2), putative heme ...    59   8e-08   
gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    59   8e-08   
gb:CQ768541_1451788 Sequence 36 from Patent WO2004007712.              59   8e-08   
gb:AE016959_1020675 Oryza sativa (japonica cultivar-group) chrom...    59   8e-08   
gb:AX120067_1461713 Sequence 50 from Patent WO0129240.                 59   1e-07   
pir|T07079|T07079 leucine-rich repeat protein LRP - tomato>gb:LE...    58   1e-07   Solanum lycopersicum
pir|H84421|H84421 probable receptor-like protein kinase [importe...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP005846_1858989 Oryza sativa (japonica cultivar-group) genom...    57   2e-07   
gb:AP005846_1858988 Oryza sativa (japonica cultivar-group) genom...    57   2e-07   
pir|B84852|B84852 probable receptor-like protein kinase [importe...    57   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T02154|T02154 protein kinase homolog T1F15.2 - Arabidopsis t...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AC137619_1743655 Oryza sativa (japonica cultivar-group) chrom...    57   4e-07   
gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complet...    57   4e-07   
gb:ATF28A21_1550253 Arabidopsis thaliana DNA chromosome 4, BAC c...    57   4e-07   
pir|T49292|T49292 hypothetical protein T16L24.60 - Arabidopsis t...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T46005|T46005 receptor-like protein kinase - Arabidopsis tha...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T04856|T04856 hypothetical protein F28A21.50 - Arabidopsis t...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
pir|C86203|C86203 hypothetical protein [imported] - Arabidopsis ...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genom...    56   5e-07   
gb:AP005896_1859828 Oryza sativa (japonica cultivar-group) genom...    56   5e-07   
gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat...    56   5e-07   
gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat...    56   5e-07   
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...    56   5e-07   
gb:AB026644_1517155 Arabidopsis thaliana genomic DNA, chromosome...    56   5e-07   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...    56   5e-07   
pir|C96519|C96519 probable disease resistance protein, 3954-7013...    56   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|O22476|BRI1_ARATH|BRI1_ARATH BRASSINOSTEROID INSENSITIVE 1 precursor (EC...    56   5e-07   Arabidopsis thaliana [mouse-ear cress]
gb:ATCHRIV49_1545665 Arabidopsis thaliana DNA chromosome 4, cont...    55   9e-07   
pir|A86383|A86383 76.4K protein kinase homolog F4F7.29 - Arabido...    55   9e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AK117178_1815224 Arabidopsis thaliana At1g73080 mRNA for unkn...    55   1e-06   
gb:AY226583_1591035 X Citrofortunella mitis leucine-rich repeat ...    55   1e-06   
gb:AY139779_1582396 Arabidopsis thaliana At1g73080/F3N23_28 mRNA...    55   1e-06   
gb:AY128385_1580684 Arabidopsis thaliana putative disease resist...    55   1e-06   
pir|G84524|G84524 probable disease resistance protein [imported]...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
pir|C96756|C96756 receptor-like protein kinase homolog [imported...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
pir|D96756|D96756 receptor-like protein kinase homolog [imported...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC...    55   1e-06   
gb:ATAC011620_1543300 Arabidopsis thaliana chromosome III BAC F1...    55   1e-06   
gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP002862_1823249 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP001551_1821338 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AP000815_1820620 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AK176791_1818779 Arabidopsis thaliana mRNA, complete cds, clo...    54   2e-06   
gb:AF466199_1802194 Sorghum bicolor putative receptor protein ki...    54   2e-06   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...    54   2e-06   
gb:LHJ002235_1684902 Lycopersicon hirsutum Cf-4 resistance gene ...    54   2e-06   
gb:BT002951_1636538 Arabidopsis thaliana clone RAFL15-05-K09 (R2...    54   2e-06   
gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putativ...    54   2e-06   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...    54   2e-06   
gb:AY332472_1600054 Oryza sativa (japonica cultivar-group) trans...    54   2e-06   
gb:AB162660_1528632 Ipomoea batatas CLAVATA-1 gene for protein k...    54   2e-06   
gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome...    54   2e-06   
gb:AE016959_1023555 Oryza sativa (japonica cultivar-group) chrom...    54   2e-06   
gb:AE005172_891598 Arabidopsis thaliana chromosome 1, top arm co...    54   2e-06   
gb:AJ585978_1811746 Arabidopsis thaliana rpp27 gene, exons 1-6.>...    54   3e-06   
gb:OSJN00299_1698204 Oryza sativa genomic DNA, chromosome 4, BAC...    54   3e-06   
gb:AY237117_1592110 Capsicum annuum leucine-rich repeat protein ...    54   3e-06   
pir|F96586|F96586 hypothetical protein F20D21.29 [imported] - Ar...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AF528600_1808627 Arabidopsis thaliana ecotype Chi-1 receptor-...    54   3e-06   
gb:AF528597_1808624 Arabidopsis thaliana ecotype An-2 receptor-l...    54   3e-06   
gb:AF528594_1808621 Arabidopsis thaliana ecotype Cvi-0 receptor-...    54   3e-06   
gb:AF528565_1808577 Zea mays cultivar BSSS53 chromosome 4 clone ...    54   3e-06   
gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1 (E...    54   3e-06   
gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome...    54   3e-06   
pir|E86308|E86308 hypothetical protein F20D23.7 - Arabidopsis th...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genom...    53   4e-06   
gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genom...    53   4e-06   
gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genom...    53   4e-06   
gb:AP000412_1820059 Arabidopsis thaliana genomic DNA, chromosome...    53   4e-06   
gb:OSJN00297_1698139 Oryza sativa genomic DNA, chromosome 4, BAC...    53   4e-06   
gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor ...    53   4e-06   
gb:BT010940_1640886 Arabidopsis thaliana At3g24954 gene, complet...    53   4e-06   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...    53   4e-06   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.              53   4e-06   
gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chrom...    53   4e-06   
pir|H96510|H96510 probable disease resistance protein [imported]...    53   4e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP003633_1831828 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:AF528603_1808630 Arabidopsis thaliana ecotype Jl-3 receptor-l...    53   6e-06   
gb:AF527809_1808449 Sorghum bicolor clone BAC SB_BBc0234M12 php2...    53   6e-06   
gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chrom...    53   6e-06   
gb:AC087553_1734109 Oryza sativa (japonica cultivar-group) chrom...    53   6e-06   
gb:AC084817_1733844 Oryza sativa (japonica cultivar-group) chrom...    53   6e-06   
gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich r...    53   6e-06   
gb:AB029327_1518169 Nicotiana tabacum mRNA for elicitor-inducibl...    53   6e-06   
gb:AX008789_1456287 Sequence 1 from Patent WO9964600.>gb:AF05312...    53   6e-06   
gb:CQ768539_1451787 Sequence 34 from Patent WO2004007712.              53   6e-06   
gb:CQ768537_1451786 Sequence 32 from Patent WO2004007712.              53   6e-06   
gb:A67825_1450281 Sequence 30 from Patent WO9743427.                   53   6e-06   
gb:A67821_1450279 Sequence 26 from Patent WO9743427.                   53   6e-06   
gb:A67819_1450278 Sequence 24 from Patent WO9743427.>gb:AY081542...    53   6e-06   
gb:A67817_1450277 Sequence 22 from Patent WO9743427.                   53   6e-06   
pir|B86460|B86460 hypothetical protein F14M2.19 [imported] - Ara...    53   6e-06   Arabidopsis thaliana [mouse-ear cress]
pir|H86208|H86208 protein F22G5.26 [imported] - Arabidopsis thal...    53   6e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AF528604_1808631 Arabidopsis thaliana ecotype Ler-0 receptor-...    52   7e-06   
gb:AF528602_1808629 Arabidopsis thaliana ecotype Ita-0 receptor-...    52   7e-06   
gb:AF528591_1808618 Arabidopsis thaliana ecotype Columbia recept...    52   7e-06   
gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 ...    52   7e-06   
gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    52   7e-06   
gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich...    52   7e-06   
gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich...    52   7e-06   
gb:AY059776_1564626 Arabidopsis thaliana putative disease resist...    52   7e-06   
gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F1...    52   7e-06   
pir|T05260|T05260 probable disease resistance protein F18A5.300 ...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T05257|T05257 probable disease resistance protein F18A5.270 ...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
pir|A71400|A71400 probable disease resistance protein - Arabidop...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T00502|T00502 probable receptor-like protein kinase At2g2330...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP006156_1861014 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP003708_1832227 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP002522_1822355 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...    52   1e-05   
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...    52   1e-05   
gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-ric...    52   1e-05   
gb:AY534122S2_1612167 Aegilops tauschii transposons Caspar, XJ, ...    52   1e-05   
gb:AY084350_1569441 Arabidopsis thaliana clone 105146 mRNA, comp...    52   1e-05   
gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-...    52   1e-05   
gb:ATAC009991_1543120 Arabidopsis thaliana chromosome III BAC F9...    52   1e-05   
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...    52   1e-05   
gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
gb:AB010699_1511239 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
pir|G86459|G86459 Hypothetical 55.6 kDa protein - Arabidopsis th...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...    52   1e-05   Daucus carota [carrots]
pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis t...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|A85357|A85357 receptor-like kinase homolog [imported] - Arab...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP003044_1824339 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AP002522_1822351 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
gb:AK117429_1815463 Arabidopsis thaliana At3g11010 mRNA for puta...    52   1e-05   
gb:AF137354_1771222 Pisum sativum leucine-rich repeat protein (L...    52   1e-05   
gb:AF049920_1764119 Petunia x hybrida PGPS/D4 (PGPS/D4) mRNA, co...    52   1e-05   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...    52   1e-05   
gb:T1N24_1723666 Arabidopsis thaliana BAC T1N24.                       52   1e-05   
gb:OSJN00195_1696527 Oryza sativa genomic DNA, chromosome 4, BAC...    52   1e-05   
gb:OSJN00174_1696186 Oryza sativa genomic DNA, chromosome 4, BAC...    52   1e-05   
gb:OSB6015_1692796 Oryza sativa indica(GLA4) genomic DNA, chromo...    52   1e-05   
gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    52   1e-05   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...    52   1e-05   
gb:AB028609_1517928 Arabidopsis thaliana genomic DNA, chromosome...    52   1e-05   
gb:AE005172_890258 Arabidopsis thaliana chromosome 1, top arm co...    52   1e-05   
pir|T00475|T00475 probable disease resistance protein [imported]...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T01105|T01105 disease resistance protein homolog T21L14.4 - ...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|D84740|D84740 hypothetical protein At2g33020 [imported] - Ar...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|C84524|C84524 probable disease resistance protein [imported]...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...    52   1e-05   Glycine max [soybeans]
pir|H96740|H96740 hypothetical protein F14O23.21 [imported] - Ar...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP003513_1830178 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (...    51   2e-05   
gb:AC097367_1736630 Oryza sativa chromosome 3 BAC OSJNBa0051C19 ...    51   2e-05   
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...    51   2e-05   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                  51   2e-05   
gb:BT003164_1636745 Arabidopsis thaliana At2g32660 mRNA, complet...    51   2e-05   
gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRN...    51   2e-05   
gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,...    51   2e-05   
gb:AC026815_1539693 Oryza sativa chromosome 10 BAC OSJNBa0079L16...    51   2e-05   
gb:AC005312_1532514 Arabidopsis thaliana chromosome 2 clone T16F...    51   2e-05   
gb:AX138089_1462210 Sequence 35 from Patent EP1094113.                 51   2e-05   
gb:CQ768549_1451792 Sequence 44 from Patent WO2004007712.>gb:AX1...    51   2e-05   
gb:AE016959_1023026 Oryza sativa (japonica cultivar-group) chrom...    51   2e-05   
pir|T05250|T05250 probable disease resistance protein F18A5.200 ...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|D84648|D84648 probable disease resistance protein [imported]...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T02565|T02565 disease resistance protein homolog At2g32660 [...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis ...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|B85440|B85440 receptor kinase-like protein [imported] - Arab...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZVR7|PSKR_ARATH|PSKR_ARATH Putative phytosulfokine receptor precursor ...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004262_1839356 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:AJ863559_1814979 Coffea canephora partial mRNA for somatic em...    51   2e-05   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...    51   2e-05   
gb:F15P11_1677567 Arabidopsis thaliana BAC F15P11.                     51   2e-05   
gb:BT000466_1634744 Arabidopsis thaliana putative disease resist...    51   2e-05   
gb:AB025629_1516537 Arabidopsis thaliana genomic DNA, chromosome...    51   2e-05   
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                 51   2e-05   
gb:AC084329_1205439 Leishmania major strain Friedlin chromosome ...    51   2e-05   
gb:AE016959_1023024 Oryza sativa (japonica cultivar-group) chrom...    51   2e-05   
gb:AE016959_1020712 Oryza sativa (japonica cultivar-group) chrom...    51   2e-05   
pir|T05259|T05259 probable disease resistance protein F18A5.290 ...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T17460|T17460 disease resistance protein - tomato>gb:AF11904...    51   2e-05   Solanum lycopersicum
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP005896_1859825 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AP003489_1829914 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AP003278_1827099 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AK118516_1816488 Arabidopsis thaliana At1g17230 mRNA for puta...    50   3e-05   
gb:AC087553_1734111 Oryza sativa (japonica cultivar-group) chrom...    50   3e-05   
gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogen...    50   3e-05   
gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich rep...    50   3e-05   
gb:LPJ002236_1685271 Lycopersicon pimpinellifolium Cf-9 resistan...    50   3e-05   
gb:AY756174_1627012 Oryza rufipogon putative leucine-rich repeat...    50   3e-05   
gb:AY714492_1624023 Oryza sativa (indica cultivar-group) clone O...    50   3e-05   
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...    50   3e-05   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...    50   3e-05   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...    50   3e-05   
gb:AB028616_1518004 Arabidopsis thaliana genomic DNA, chromosome...    50   3e-05   
gb:AB025621_1516426 Arabidopsis thaliana genomic DNA, chromosome...    50   3e-05   
gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome...    50   3e-05   
gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome...    50   3e-05   
pir|T00800|T00800 disease resistance protein homolog F24L7.18 - ...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T10504|T10504 disease resistance protein Cf-2.1 - currant to...    50   3e-05   Solanum pimpinellifolium [currant tomato]
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|B84742|B84742 probable receptor-like protein kinase [importe...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|B84659|B84659 probable receptor-like protein kinase, ERECTA ...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP005966_1860364 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP005841_1858891 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP004126_1837999 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP002526_1822452 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP002522_1822349 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AP002521_1822300 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for puta...    50   4e-05   
gb:AC129718_1740646 Oryza sativa (japonica cultivar-group) chrom...    50   4e-05   
gb:AY791293_1628466 Cocos nucifera somatic embryogenesis recepto...    50   4e-05   
gb:AY736123_1626037 Triticum aestivum leucine-rich repeat protei...    50   4e-05   
gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (E...    50   4e-05   
gb:AY091081_1574308 Arabidopsis thaliana putative leucine-rich r...    50   4e-05   
gb:AC005936_1533211 Arabidopsis thaliana chromosome 2 clone F5O4...    50   4e-05   
gb:AB026655_1517319 Arabidopsis thaliana genomic DNA, chromosome...    50   4e-05   
gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome...    50   4e-05   
gb:AE016959_1023029 Oryza sativa (japonica cultivar-group) chrom...    50   4e-05   
pir|G84740|G84740 hypothetical protein At2g33050 [imported] - Ar...    50   4e-05   
pir|T48489|T48489 receptor-like protein kinase - Arabidopsis tha...    50   4e-05   
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...    50   4e-05   
pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis tha...    50   4e-05   
gb:AP005064_1847423 Oryza sativa (japonica cultivar-group) genom...    50   5e-05   
gb:AP003768_1833268 Oryza sativa (japonica cultivar-group) genom...    50   5e-05   
gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genom...    50   5e-05   
gb:AP000412_1820057 Arabidopsis thaliana genomic DNA, chromosome...    50   5e-05   
gb:AP000386_1819927 Arabidopsis thaliana genomic DNA, chromosome...    50   5e-05   
gb:AP000366_1819745 Oryza sativa (japonica cultivar-group) genom...    50   5e-05   
gb:AF528680_1808705 Arabidopsis lyrata CLAVATA2 (CLV2) gene, par...    50   5e-05   
gb:AF053993_1764487 Lycopersicon esculentum disease resistance p...    50   5e-05   
gb:OSJN00195_1696533 Oryza sativa genomic DNA, chromosome 4, BAC...    50   5e-05   
gb:OSJN00123_1695267 Oryza sativa genomic DNA, chromosome 4, BAC...    50   5e-05   
gb:AY288911_1594827 Cucumis melo polygalacturonase-inhibiting pr...    50   5e-05   
gb:AY182166_1587874 Elaeis guineensis clone Rlk-OPmf receptor-li...    50   5e-05   
gb:AC016163_1538127 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    50   5e-05   
gb:AB182388_1529231 Oryza sativa (japonica cultivar-group) FON1 ...    50   5e-05   
gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome...    50   5e-05   
gb:AY560578_1188334 Zea mays chromosome 10S clone Z409L08, *** S...    50   5e-05   
pir|T48486|T48486 hypothetical protein T28J14.90 - Arabidopsis t...    50   5e-05   
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...    50   5e-05   
pir|C96772|C96772 probable receptor protein kinase F1M20.4 [impo...    50   5e-05   
pir|C84527|C84527 probable receptor-like protein kinase [importe...    50   5e-05   
sp|Q8LPB4|PSKR_DAUCA|PSKR_DAUCA Phytosulfokine receptor precursor (EC 2.7.1...    50   5e-05   
gb:AP005536_1853704 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP005473_1852497 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP004564_1841662 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP004326_1840210 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP004039_1836723 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP003705_1832164 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genom...    49   6e-05   
gb:AF196917_1776075 Potentilla anserina isolate Po_an_7 polygala...    49   6e-05   
gb:AF053995_1764489 Lycopersicon esculentum Hcr2-0B (Hcr2-0B) ge...    49   6e-05   
gb:AC132489_1741183 Oryza sativa (japonica cultivar-group) chrom...    49   6e-05   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...    49   6e-05   
gb:AY182165_1587873 Elaeis guineensis clone Rlk-OPff receptor-li...    49   6e-05   
gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mR...    49   6e-05   
gb:AY059422_1564540 Solanum tuberosum clone StVe1-03 Ve resistan...    49   6e-05   
gb:AB104529_1526474 Pisum sativum LKA mRNA for brassinosteroid r...    49   6e-05   
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...    49   6e-05   
gb:AB018110_1513754 Arabidopsis thaliana genomic DNA, chromosome...    49   6e-05   
gb:AE016959_1020714 Oryza sativa (japonica cultivar-group) chrom...    49   6e-05   
pir|G84652|G84652 probable receptor-like protein kinase [importe...    49   6e-05   
pir|H84632|H84632 probable receptor-like protein kinase [importe...    49   6e-05   
pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis thal...    49   6e-05   
pir|T03784|T03784 probable receptor protein kinase - rice>gb:OSL...    49   6e-05   
pir|E86312|E86312 F11A6.9 protein - Arabidopsis thaliana>gb:AE00...    49   6e-05   
pir|B85089|B85089 receptor protein kinase-like protein [imported...    49   6e-05   
gb:AP005769_1857548 Oryza sativa (japonica cultivar-group) genom...    49   8e-05   
gb:AP003302_1827702 Oryza sativa (japonica cultivar-group) genom...    49   8e-05   
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...    49   8e-05   
gb:AF119041_1769650 Lycopersicon esculentum haplotype Southern C...    49   8e-05   
gb:AF083807_1767037 Arabidopsis thaliana clone sps952 unknown mRNA.    49   8e-05   
gb:AC151804_1745136 Solanum demissum chromosome 5 BAC PGEC475B22...    49   8e-05   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...    49   8e-05   
gb:AY074386_1567540 Arabidopsis thaliana putative receptor prote...    49   8e-05   
gb:AY072083_1566979 Arabidopsis thaliana putative receptor prote...    49   8e-05   
gb:AY062559_1565215 Arabidopsis thaliana receptor-like protein k...    49   8e-05   
gb:AB178084_1528917 Daucus carota LRR-S/T-RLK mRNA for putative ...    49   8e-05   
gb:AB025613_1516374 Arabidopsis thaliana genomic DNA, chromosome...    49   8e-05   
gb:AB020745_1514593 Arabidopsis thaliana genomic DNA, chromosome...    49   8e-05   
gb:AE016959_1023590 Oryza sativa (japonica cultivar-group) chrom...    49   8e-05   
pir|T01817|T01817 hypothetical protein T27D20.9 - Arabidopsis th...    49   8e-05   
pir|H84740|H84740 hypothetical protein At2g33060 [imported] - Ar...    49   8e-05   
pir|T10659|T10659 probable serine/threonine-specific protein kin...    49   8e-05   
gb:AP005740_1856930 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AP004747_1844315 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AP004256_1839206 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AP003708_1832231 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AP002063_1821824 Arabidopsis thaliana genomic DNA, chromosome...    49   1e-04   
gb:AJ698919_1813451 Populus deltoides x Populus maximowiczii par...    49   1e-04   
gb:AF364177_1791593 Oryza sativa leucine-rich repeat protein mRN...    49   1e-04   
gb:AF272367_1782238 Lycopersicon esculentum verticillium wilt di...    49   1e-04   
gb:AF272366_1782237 Lycopersicon esculentum verticillium wilt di...    49   1e-04   
gb:OSJN00057_1694034 Oryza sativa genomic DNA, chromosome 4, BAC...    49   1e-04   
gb:BT020271_1642666 Arabidopsis thaliana At1g13230 mRNA, complet...    49   1e-04   
gb:AY268139_1593942 Hordeum vulgare BAC 184G9, complete sequece.       49   1e-04   
gb:AY262015_1593658 Solanum lycopersicoides resistance protein S...    49   1e-04   
gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonin...    49   1e-04   
gb:AY090373_1574121 Arabidopsis thaliana AT3g05370/T12H1_34 mRNA...    49   1e-04   
gb:AY050870_1562365 Arabidopsis thaliana putative receptor prote...    49   1e-04   
gb:ATAC009177_1542875 Arabidopsis thaliana chromosome III BAC T1...    49   1e-04   
gb:CQ768555_1451795 Sequence 50 from Patent WO2004007712.>gb:AX1...    49   1e-04   
gb:AE016959_1021913 Oryza sativa (japonica cultivar-group) chrom...    49   1e-04   
pir|H86266|H86266 hypothetical protein F3F19.26 - Arabidopsis th...    49   1e-04   
pir|T46170|T46170 disease resistance-like protein - Arabidopsis ...    49   1e-04   
pir|C84633|C84633 probable disease resistance protein [imported]...    49   1e-04   
pir|T50817|T50817 protein serine/threonine kinase-like protein -...    49   1e-04   
pir|B84664|B84664 probable receptor-like protein kinase [importe...    49   1e-04   
pir|D84889|D84889 probable receptor-like protein kinase [importe...    49   1e-04   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...    49   1e-04   
gb:AP005966_1860355 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AP004747_1844313 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AP003952_1835675 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AP003237_1825947 Oryza sativa (japonica cultivar-group) genom...    48   1e-04   
gb:AK117863_1815873 Arabidopsis thaliana At1g79620 mRNA for unkn...    48   1e-04   
gb:AF467245_1802414 Solanum tuberosum clone StVe1-02g Ve resista...    48   1e-04   
gb:AF466620_1802305 Solanum tuberosum clone StVe1-02b Ve resista...    48   1e-04   
gb:AF466618_1802303 Solanum tuberosum clone StVe1-02c Ve resista...    48   1e-04   
gb:AF466358_1802293 Oryza sativa (japonica cultivar-group) flora...    48   1e-04   
gb:AF053996_1764490 Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-...    48   1e-04   
gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chrom...    48   1e-04   
gb:LHJ002235_1684903 Lycopersicon hirsutum Cf-4 resistance gene ...    48   1e-04   
gb:CRU303349_1673665 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...    48   1e-04   
gb:AY569331_1615488 Lycopersicon pimpinellifolium 9DC resistance...    48   1e-04   
gb:AY212939_1589832 Solanum tuberosum clone StVe1-02j Ve resista...    48   1e-04   
gb:AE005173_895483 Arabidopsis thaliana chromosome 1, bottom arm...    48   1e-04   
pir|G84648|G84648 probable disease resistance protein [imported]...    48   1e-04   
pir|A55173|A55173 cf-9 protein precursor - tomato>gb:A45237_1449...    48   1e-04   
pir|G96746|G96746 hypothetical protein T9N14.20 [imported] - Ara...    48   1e-04   
gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AP003943_1835570 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AP003238_1825989 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AF467244_1802413 Solanum tuberosum clone StVe1-02f Ve resista...    48   2e-04   
gb:AF365929_1791620 Lycopersicon esculentum verticillium wilt di...    48   2e-04   
gb:OST17804_1698364 Oryza sativa indica(GLA4) genomic DNA, chrom...    48   2e-04   
gb:OSJN00057_1694032 Oryza sativa genomic DNA, chromosome 4, BAC...    48   2e-04   
gb:OSJN00011_1693238 Oryza sativa genomic DNA, chromosome 4, BAC...    48   2e-04   
gb:LPJ002236_1685267 Lycopersicon pimpinellifolium Cf-9 resistan...    48   2e-04   
gb:LHJ002235_1684900 Lycopersicon hirsutum Cf-4 resistance gene ...    48   2e-04   
gb:BT005989_1638911 Arabidopsis thaliana At5g24100 gene, complet...    48   2e-04   
gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat...    48   2e-04   
gb:AY756174_1627013 Oryza rufipogon putative leucine-rich repeat...    48   2e-04   
gb:AY714493_1624024 Oryza sativa (indica cultivar-group) clone O...    48   2e-04   
gb:AY569331_1615487 Lycopersicon pimpinellifolium 9DC resistance...    48   2e-04   
gb:AY364476_1602838 Oryza sativa (indica cultivar-group) bacteri...    48   2e-04   
gb:AY282579_1594709 Solanum lycopersicoides disease resistance p...    48   2e-04   
gb:AY212941_1589834 Solanum tuberosum clone StVe1-02l Ve resista...    48   2e-04   
gb:AB026655_1517331 Arabidopsis thaliana genomic DNA, chromosome...    48   2e-04   
gb:LMFL1177_1387731 Leishmania major Friedlin chromosome 21 cosm...    48   2e-04   
pir|T10727|T10727 protein kinase Xa21 (EC 2.7.1.-) D, receptor t...    48   2e-04   
pir|T10650|T10650 hypothetical protein T5F17.10 - Arabidopsis th...    48   2e-04   
pir|G85332|G85332 hypothetical protein AT4g28560 [imported] - Ar...    48   2e-04   
pir|T30553|T30553 disease resistance protein Hcr2-5D - tomato>gb...    48   2e-04   
pir|T07039|T07039 Hcr9-0 protein - tomato>gb:LEJ002237_1684342 L...    48   2e-04   
pir|T04587|T04587 hypothetical protein F23E13.70 - Arabidopsis t...    48   2e-04   
pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis t...    48   2e-04   
pir|T05897|T05897 protein kinase homolog F6H11.160 - Arabidopsis...    48   2e-04   
pir|E84846|E84846 probable receptor-like protein kinase [importe...    48   2e-04   
gb:AP007224_1863291 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AP006064_1860783 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AP005966_1860351 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AP005689_1856088 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AP004070_1837224 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AF497474_1805875 Aegilops tauschii leucine-rich-like protein ...    47   2e-04   
gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (...    47   2e-04   
gb:AC105364_1737972 Oryza sativa (japonica cultivar-group) chrom...    47   2e-04   
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...    47   2e-04   
gb:OSJN00072_1694323 Oryza sativa genomic DNA, chromosome 4, BAC...    47   2e-04   
gb:AY714497_1624028 Oryza sativa (japonica cultivar-group) clone...    47   2e-04   
gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone O...    47   2e-04   
gb:AY615303_1618125 Solanum aethiopicum verticillium wilt diseas...    47   2e-04   
gb:AY536526_1612394 Solanum aethiopicum verticillium wilt diseas...    47   2e-04   
gb:AY368673_1602931 Triticum turgidum HMW-glutenin locus, comple...    47   2e-04   
gb:ATAC009177_1542874 Arabidopsis thaliana chromosome III BAC T1...    47   2e-04   
gb:AB120627_1527973 Populus nigra PnLRK1 mRNA for leucine-rich r...    47   2e-04   
gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene ...    47   2e-04   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.              47   2e-04   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...    47   2e-04   
gb:AE016959_1022232 Oryza sativa (japonica cultivar-group) chrom...    47   2e-04   
gb:AE005173_895101 Arabidopsis thaliana chromosome 1, bottom arm...    47   2e-04   
pir|S61925|S61925 cyst wall protein 1 precursor - Giardia lambli...    47   2e-04   
pir|H96769|H96769 hypothetical protein F9E11.7 [imported] - Arab...    47   2e-04   
pir|T17461|T17461 disease resistance protein D - tomato>gb:AF119...    47   2e-04   
pir|T10725|T10725 protein kinase Xa21 (EC 2.7.1.-) A1, receptor ...    47   2e-04   
pir|F96598|F96598 protein F20N2.4 [imported] - Arabidopsis thali...    47   2e-04   
pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis t...    47   2e-04   
sp|P93194|RPK1_PHANI|RPK1_PHANI Receptor-like protein kinase precursor (EC ...    47   2e-04   
gb:AP005457_1852174 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP005394_1851023 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP004771_1844782 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP003770_1833318 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP003434_1829316 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AF531457_1809325 Brassica napus polygalacturonase inhibitory ...    47   3e-04   
gb:AF196916_1776074 Potentilla anserina isolate Po_an_5 polygala...    47   3e-04   
gb:AF172282_1774418 Oryza sativa adh1-adh2 region.                     47   3e-04   
gb:AF049870_1764105 Arabidopsis thaliana beta tubulin 1, thaumat...    47   3e-04   
gb:AC149290_1744952 Solanum demissum chromosome 5 clone PGEC093P...    47   3e-04   
gb:AC079633_1732635 Genomic Sequence for Oryza sativa, Nipponbar...    47   3e-04   
gb:OSJN00042_1693769 Oryza sativa genomic DNA, chromosome 4, BAC...    47   3e-04   
gb:AY534122S2_1612173 Aegilops tauschii transposons Caspar, XJ, ...    47   3e-04   
gb:AY070134_1566748 Arabidopsis thaliana AT5g10020/T31P16_9 mRNA...    47   3e-04   
gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09...    47   3e-04   
gb:AX196315_1463942 Sequence 22 from Patent WO0151627.                 47   3e-04   
gb:AX196312_1463939 Sequence 19 from Patent WO0151627.>gb:AX1963...    47   3e-04   
gb:AX196311_1463938 Sequence 18 from Patent WO0151627.>gb:AX1963...    47   3e-04   
gb:AX196310_1463937 Sequence 17 from Patent WO0151627.                 47   3e-04   
gb:AX196309_1463936 Sequence 16 from Patent WO0151627.                 47   3e-04   
gb:AX196306_1463933 Sequence 13 from Patent WO0151627.                 47   3e-04   
gb:AX196305_1463932 Sequence 12 from Patent WO0151627.                 47   3e-04   
gb:AX196296_1463926 Sequence 3 from Patent WO0151627.>gb:AX19630...    47   3e-04   
gb:AX196295_1463925 Sequence 2 from Patent WO0151627.>gb:AX19630...    47   3e-04   
gb:A67823_1450280 Sequence 28 from Patent WO9743427.                   47   3e-04   
gb:LMFL5856_1388224 Leishmania major Friedlin chromosome 5 cosmi...    47   3e-04   
gb:AE016959_1023023 Oryza sativa (japonica cultivar-group) chrom...    47   3e-04   
gb:AE016959_1021015 Oryza sativa (japonica cultivar-group) chrom...    47   3e-04   
pir|T01104|T01104 disease resistance protein homolog T21L14.3 - ...    47   3e-04   
pir|E84740|E84740 hypothetical protein At2g33030 [imported] - Ar...    47   3e-04   
pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil (Ja...    47   3e-04   
pir|T45647|T45647 receptor protein kinase-like protein - Arabido...    47   3e-04   
pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis thali...    47   3e-04   
pir|B86234|B86234 hypothetical protein [imported] - Arabidopsis ...    47   3e-04   
sp|Q9SYQ8|CLV1_ARATH|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor ...    47   3e-04   
gb:AP005966_1860358 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP005896_1859826 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP005394_1851029 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP005064_1847429 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP005064_1847421 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP004039_1836725 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP004014_1836382 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP003491_1829947 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP003278_1827101 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AP000377_1819848 Arabidopsis thaliana genomic DNA, chromosome...    47   4e-04   
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...    47   4e-04   


>gb:AP002048_1821663 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXP5.
          Length = 494

 Score =  270 bits (691), Expect = 1e-71
 Identities = 126/157 (80%), Positives = 140/157 (89%)
 Frame = +3

Query: 210 NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS 389
           N PLSD+EV +IQRRQLLYYRDEFGDRGE VTVDPSL FEN R+R+AYIALQAWKQAI+S
Sbjct: 31  NAPLSDTEVRFIQRRQLLYYRDEFGDRGENVTVDPSLIFENPRLRSAYIALQAWKQAILS 90

Query: 390 DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV 569
           DP N T +W+GS+VCNYTGVFC+ A DN KIRTVA IDLNH DIAGYLPEELGLL DL +
Sbjct: 91  DPNNITVNWIGSNVCNYTGVFCSKALDNRKIRTVAGIDLNHADIAGYLPEELGLLTDLAL 150

Query: 570 FHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           FH+NSNRFCGT+P KFK LK+LFELD+SNNRFAGKFP
Sbjct: 151 FHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAGKFP 187



>pir|T04859|T04859 extensin homolog F28A21.80 - Arabidopsis
           thaliana>gb:ATCHRIV49_1545668 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           49.>gb:ATF28A21_1550256 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28A21 (ESSA project).
          Length = 839

 Score =  258 bits (660), Expect = 5e-68
 Identities = 120/157 (76%), Positives = 137/157 (87%)
 Frame = +3

Query: 210 NGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIIS 389
           NG LSD+EV  I +RQLLY+RDEFGDRGE V VDPSL FEN R+RNAYIALQAWKQAI+S
Sbjct: 35  NGDLSDNEVRLITQRQLLYFRDEFGDRGENVDVDPSLVFENPRLRNAYIALQAWKQAILS 94

Query: 390 DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGV 569
           DP N T++W+GSDVC+YTGV+CAPA DN +IRTVA IDLNH DIAGYLP+ELGLL DL +
Sbjct: 95  DPNNFTTNWIGSDVCSYTGVYCAPALDNRRIRTVAGIDLNHADIAGYLPQELGLLTDLAL 154

Query: 570 FHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           FHINSNRFCGT+P +F  LK+LFELD+SNNRFAG FP
Sbjct: 155 FHINSNRFCGTVPHRFNRLKLLFELDLSNNRFAGIFP 191



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R +  I    +     LP ++G L ++ VF  + N   G++P     +  + +L++++N
Sbjct: 267 MRNLEEIIFMENGFNSCLPSQIGRLKNVTVFDFSFNELVGSLPASIGGMVSMEQLNVAHN 326

Query: 660 RFAGKFP 680
           RF+GK P
Sbjct: 327 RFSGKIP 333



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ V   D + +++ G LP  +G +  +   ++  NRF G IP     L  L     S 
Sbjct: 290 RLKNVTVFDFSFNELVGSLPASIGGMVSMEQLNVAHNRFSGKIPATICQLPRLENFTFSY 349

Query: 657 NRFAGKFP 680
           N F G+ P
Sbjct: 350 NFFTGEPP 357



>pir|T06291|T06291 extensin homolog T9E8.80 - Arabidopsis
           thaliana>gb:ATCHRIV36_1545098 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 36.>gb:ATT9E8_1556618
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9E8,
           partial sequence (ESSA project).
          Length = 760

 Score =  249 bits (637), Expect = 2e-65
 Identities = 118/158 (74%), Positives = 136/158 (86%)
 Frame = +3

Query: 207 DNGPLSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAII 386
           D G LSD+EV +IQRRQLL    EF +R  ++TVDPSL FEN R+RNAYIALQAWKQAI+
Sbjct: 26  DGGVLSDNEVRHIQRRQLL----EFAERSVKITVDPSLNFENPRLRNAYIALQAWKQAIL 81

Query: 387 SDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG 566
           SDP N TS+W+GS+VCNYTGVFC+PA DN KIRTVA IDLNH DIAGYLPEELGLL+DL 
Sbjct: 82  SDPNNFTSNWIGSNVCNYTGVFCSPALDNRKIRTVAGIDLNHADIAGYLPEELGLLSDLA 141

Query: 567 VFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +FH+NSNRFCGT+P +F  LK+LFELD+SNNRFAGKFP
Sbjct: 142 LFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAGKFP 179



>pir|T01456|T01456 extensin homolog F24O1.18 - Arabidopsis
           thaliana>gb:AE005173_893914 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC003113_1531113 Genomic sequence for
           Arabidopsis thaliana BAC F24O1 from chromosome I,
           complete sequence.>gb:AC005698_1532897 Genomic sequence
           for Arabidopsis thaliana BAC T3P18 from Chromosome 1,
           complete sequence.
          Length = 786

 Score =  199 bits (505), Expect = 5e-50
 Identities = 90/136 (66%), Positives = 109/136 (80%)
 Frame = +3

Query: 273 DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF 452
           D+  D  + + VDPSL FEN  +R AYIALQ+WKQAI SDP N T++W GSDVC+Y G+F
Sbjct: 33  DDISD--DNIKVDPSLKFENPSLRQAYIALQSWKQAIFSDPFNFTANWNGSDVCSYNGIF 90

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           CAP+P +PK R VA IDLNH D+AGYLP ELGLL DL +FH+NSNRFCG +P  FK++K+
Sbjct: 91  CAPSPSSPKTRVVAGIDLNHADMAGYLPRELGLLTDLALFHLNSNRFCGEVPLTFKHMKL 150

Query: 633 LFELDISNNRFAGKFP 680
           LFELD+SNNRF GKFP
Sbjct: 151 LFELDLSNNRFVGKFP 166



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 28/76 (36%), Positives = 45/76 (59%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P       +T+  I L++D++ G LP ++G L ++ VF I+ NR  G +P    N+K 
Sbjct: 234 CIPGSIGLMGKTLNEIILSNDNLTGCLPPQIGNLKNVTVFDISFNRLSGPLPSSIGNMKS 293

Query: 633 LFELDISNNRFAGKFP 680
           L +L+++NNRF G  P
Sbjct: 294 LEQLNVANNRFTGVIP 309



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 26/82 (31%), Positives = 39/82 (47%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TG  C P P    ++ V   D++ + ++G LP  +G +  L   ++ +NRF G IP  
Sbjct: 255 NLTG--CLP-PQIGNLKNVTVFDISFNRLSGPLPSSIGNMKSLEQLNVANNRFTGVIPSS 311

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  L     S+N F G  P
Sbjct: 312 ICQLSNLENFTYSSNFFTGDAP 333



>pir|E86255|E86255 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890219 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY026364_1559030 Arabidopsis thaliana
           leucine-rich repeat/extensin 1 (LRX1) mRNA, complete
           cds.>gb:F12F1_1677340 Arabidopsis thaliana chromosome 1
           BAC F12F1 sequence, complete sequence.
          Length = 744

 Score =  189 bits (481), Expect = 3e-47
 Identities = 85/136 (62%), Positives = 105/136 (77%)
 Frame = +3

Query: 273 DEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVF 452
           D+  D G  + VD  L FEN ++R AYIALQ+WK+AI SDP N T++W GSDVC+Y G++
Sbjct: 29  DDESDLGSDIKVDKRLKFENPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIY 88

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           CAP+P  PK R VA IDLNH D+AGYL  ELGLL+DL +FHINSNRFCG +P  F  +K+
Sbjct: 89  CAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKL 148

Query: 633 LFELDISNNRFAGKFP 680
           L+ELD+SNNRF GKFP
Sbjct: 149 LYELDLSNNRFVGKFP 164



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 28/76 (36%), Positives = 42/76 (55%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P       +T+  + L++D++ G LP ++G L  + VF I SNR  G +P    N+K 
Sbjct: 232 CIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKS 291

Query: 633 LFELDISNNRFAGKFP 680
           L EL ++NN F G  P
Sbjct: 292 LEELHVANNAFTGVIP 307



>gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13E13.
          Length = 956

 Score =  189 bits (480), Expect = 4e-47
 Identities = 91/156 (58%), Positives = 112/156 (71%), Gaps = 2/156 (1%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD 392
           L+D E  ++ RRQLL    E GD  + +   VD  L F N+R++ AYIALQAWK+A  SD
Sbjct: 31  LTDEEASFLTRRQLLAL-SENGDLPDDIEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD 89

Query: 393 PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF 572
           P NT ++WVG DVC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct: 90  PFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALF 149

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H+NSNRFCG IPK    L +++E D+SNNRF G FP
Sbjct: 150 HVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFP 185



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +3

Query: 426 DVCN--YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           DV N  + G F   A   P ++    +D+ ++D  G LP E+    DL    +N+NRF  
Sbjct: 174 DVSNNRFVGPFPTVALSWPSLKF---LDIRYNDFEGKLPPEI-FDKDLDAIFLNNNRFES 229

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
           TIP+          +  ++N+F+G  P
Sbjct: 230 TIPETI-GKSTASVVTFAHNKFSGCIP 255



>gb:AY091043_1574272 Arabidopsis thaliana unknown protein
           (At3g19020) mRNA, partial cds.
          Length = 712

 Score =  189 bits (480), Expect = 4e-47
 Identities = 91/156 (58%), Positives = 112/156 (71%), Gaps = 2/156 (1%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD 392
           L+D E  ++ RRQLL    E GD  + +   VD  L F N+R++ AYIALQAWK+A  SD
Sbjct: 31  LTDEEASFLTRRQLLAL-SENGDLPDDIEYEVDLDLKFANNRLKRAYIALQAWKKAFYSD 89

Query: 393 PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF 572
           P NT ++WVG DVC+Y GVFCAPA D+P +  VA IDLNH DIAGYLP ELGLL D+ +F
Sbjct: 90  PFNTAANWVGPDVCSYKGVFCAPALDDPSVLVVAGIDLNHADIAGYLPPELGLLTDVALF 149

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H+NSNRFCG IPK    L +++E D+SNNRF G FP
Sbjct: 150 HVNSNRFCGVIPKSLSKLTLMYEFDVSNNRFVGPFP 185



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +3

Query: 426 DVCN--YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           DV N  + G F   A   P ++    +D+ ++D  G LP E+    DL    +N+NRF  
Sbjct: 174 DVSNNRFVGPFPTVALSWPSLKF---LDIRYNDFEGKLPPEI-FDKDLDAIFLNNNRFES 229

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
           TIP+          +  ++N+F+G  P
Sbjct: 230 TIPETI-GKSTASVVTFAHNKFSGCIP 255



>pir|F96531|F96531 hypothetical protein F13F21.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_892885 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007504_1535854 Arabidopsis thaliana
           chromosome I BAC F13F21 genomic sequence, complete
           sequence.
          Length = 847

 Score =  186 bits (471), Expect = 4e-46
 Identities = 82/125 (65%), Positives = 101/125 (80%)
 Frame = +3

Query: 306 VDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR 485
           VDP+L FENDR++ AYIALQAWK+AI SDP  TT++WVGSDVC+Y GV+CAPA D+  + 
Sbjct: 48  VDPNLKFENDRLKRAYIALQAWKKAIYSDPFKTTANWVGSDVCSYNGVYCAPALDDDSLT 107

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
            VA +DLNH DIAG+LP ELGL+ DL +FHINSNRFCG IPK    L +++E D+SNNRF
Sbjct: 108 VVAGVDLNHADIAGHLPPELGLMTDLALFHINSNRFCGIIPKSLSKLALMYEFDVSNNRF 167

Query: 666 AGKFP 680
            G+FP
Sbjct: 168 VGQFP 172



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 19/64 (29%), Positives = 36/64 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  I    +++ G  P E+GLL ++ VF  + N F G++P     L  + +LD+S+N
Sbjct: 248 MKNLNEIVFTGNNLTGCFPNEIGLLNNVTVFDASKNGFVGSLPSTLSGLASVEQLDLSHN 307

Query: 660 RFAG 671
           +  G
Sbjct: 308 KLTG 311



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/62 (32%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I LN++     +P  +G  +   V    +N+F G IPK   N+K L E+  + N   G 
Sbjct: 206 AIFLNNNRFESVIPGTIGK-SKASVVTFANNKFSGCIPKSIGNMKNLNEIVFTGNNLTGC 264

Query: 675 FP 680
           FP
Sbjct: 265 FP 266



>gb:AP003253_1826372 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0451D05.>gb:AP003333_1828082 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1103C09.
          Length = 551

 Score =  184 bits (466), Expect = 2e-45
 Identities = 87/146 (59%), Positives = 107/146 (73%), Gaps = 1/146 (0%)
 Frame = +3

Query: 246 QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG 422
           QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct: 38  QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG 97

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT 602
            DVC Y GVFCA A D+P +  VAS+DLNH D+AG+LP+ELGLLADL V H NSNRFCG 
Sbjct: 98  PDVCAYEGVFCAAARDDPHLVVVASVDLNHADMAGHLPDELGLLADLAVLHANSNRFCGA 157

Query: 603 IPKKFKNLKILFELDISNNRFAGKFP 680
           +P   + L +L ELD+SNNR  G FP
Sbjct: 158 VPSTLERLHLLHELDLSNNRLVGAFP 183



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C PA       T+  I L +  +   +P ELG+L  L V  ++ N   G IP +   L+ 
Sbjct: 251 CLPASVANMSGTLDEIILMNTGLKSCIPPELGMLTGLAVLDVSHNSLMGAIPGELARLEN 310

Query: 633 LFELDISNNRFAGKFP 680
           + +LD+ +NR  G  P
Sbjct: 311 IEQLDLGHNRLTGDVP 326



>gb:AP003253_1826371 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0451D05.>gb:AP003333_1828081 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1103C09.
          Length = 570

 Score =  184 bits (466), Expect = 2e-45
 Identities = 87/146 (59%), Positives = 107/146 (73%), Gaps = 1/146 (0%)
 Frame = +3

Query: 246 QRRQLL-YYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVG 422
           QRR+LL Y+    G  G  V VDPS TF N R+R+AY+A+QAWK+A++SDP N T  W+G
Sbjct: 38  QRRRLLDYHGGGGGHGGGDVYVDPSYTFPNARLRDAYVAMQAWKRAVLSDPHNVTGTWIG 97

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT 602
            DVC Y GVFCA A D+P +  VAS+DLNH D+AG+LP+ELGLLADL V H NSNRFCG 
Sbjct: 98  PDVCAYEGVFCAAARDDPHLVVVASVDLNHADMAGHLPDELGLLADLAVLHANSNRFCGA 157

Query: 603 IPKKFKNLKILFELDISNNRFAGKFP 680
           +P   + L +L ELD+SNNR  G FP
Sbjct: 158 VPSTLERLHLLHELDLSNNRLVGAFP 183



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 24/76 (31%), Positives = 37/76 (48%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C PA       T+  I L +  +   +P ELG+L  L V  ++ N   G IP +   L+ 
Sbjct: 251 CLPASVANMSGTLDEIILMNTGLKSCIPPELGMLTGLAVLDVSHNSLMGAIPGELARLEN 310

Query: 633 LFELDISNNRFAGKFP 680
           + +LD+ +NR  G  P
Sbjct: 311 IEQLDLGHNRLTGDVP 326



>pir|C84534|C84534 hypothetical protein At2g15880 [imported] -
           Arabidopsis thaliana>gb:AC006438_1534269 Arabidopsis
           thaliana chromosome 2 clone F19G14 map mi398, complete
           sequence.
          Length = 727

 Score =  182 bits (461), Expect = 6e-45
 Identities = 88/156 (56%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD 392
           L+D+EV +I +RQLL    E G+  + +   VD  +TF N R++ AYIALQAWK+A+ SD
Sbjct: 19  LTDAEVSFIAQRQLLTL-PENGELPDDIEYEVDLKVTFANHRLKRAYIALQAWKKAVYSD 77

Query: 393 PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF 572
           P NTT +W G  VC YTGVFCAPA D+P +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct: 78  PFNTTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADIAGHLPAELGLMTDVAMF 137

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H+NSNRFCG IPK F+ L ++ E D+SNNRF G FP
Sbjct: 138 HLNSNRFCGIIPKSFEKLSLMHEFDVSNNRFVGPFP 173



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  I    + + G  P E+G LA++ VF  + N F G +P  F  L  + E DIS N
Sbjct: 249 MKNLNEIIFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTSMEEFDISGN 308

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 309 KLTGFIP 315



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 21/64 (32%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V  ID+ ++D  G +P EL    DL    +N+NRF  TIP           +  ++N+F+
Sbjct: 182 VKFIDVRYNDFEGQVPPEL-FKKDLDAIFLNNNRFTSTIPDSLGESSASV-VTFAHNKFS 239

Query: 669 GKFP 680
           G  P
Sbjct: 240 GCIP 243



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 20/62 (32%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I LN++     +P+ LG  +   V     N+F G IP+   N+K L E+   +N   G 
Sbjct: 207 AIFLNNNRFTSTIPDSLGE-SSASVVTFAHNKFSGCIPRSIGNMKNLNEIIFKDNSLGGC 265

Query: 675 FP 680
           FP
Sbjct: 266 FP 267



>pir|T05225|T05225 extensin homolog F17I5.160 - Arabidopsis
           thaliana>gb:ATCHRIV80_1547358 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 80.>gb:ATF17I5_1548950
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17I5
           (ESSA project).
          Length = 699

 Score =  177 bits (448), Expect = 2e-43
 Identities = 87/156 (55%), Positives = 110/156 (70%), Gaps = 2/156 (1%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVT--VDPSLTFENDRIRNAYIALQAWKQAIISD 392
           L+D+E  +I +RQLL   D  G+  + +   VD   TF N R++ AYIALQAWK+AI SD
Sbjct: 45  LTDTEAAFIVQRQLLTLPDN-GELPDDIEYEVDLKATFANTRLKRAYIALQAWKKAIFSD 103

Query: 393 PRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF 572
           P NTT +W G  VC YTGV CAPA D+  +  VA +DLN  DIAG+LP ELGL+ D+ +F
Sbjct: 104 PFNTTGNWHGPHVCGYTGVVCAPALDDSDVTVVAGVDLNGADIAGHLPAELGLMTDVAMF 163

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H+NSNRFCG IPK F+ LK++ E D+SNNRF G FP
Sbjct: 164 HLNSNRFCGIIPKSFEKLKLMHEFDVSNNRFVGPFP 199



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +D+ G  P E+G L+++ VF  + N F G +P  F  L  + E+DIS N+  G  P
Sbjct: 286 NDLGGCFPSEIGKLSNVTVFDASKNSFIGRLPTSFVGLTSVEEIDISGNKLTGLVP 341



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 22/62 (35%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I LN +     +PE LG  +   V    +N+F G IPK   N+K L E+   +N   G 
Sbjct: 233 AIFLNDNRFTSVIPESLGE-SPASVVTFANNKFTGCIPKSIGNMKNLNEIVFMDNDLGGC 291

Query: 675 FP 680
           FP
Sbjct: 292 FP 293



>gb:AF159296_1773220 Lycopersicon esculentum pollen extensin-like
           protein (Pex1) gene, complete cds.
          Length = 711

 Score =  174 bits (442), Expect = 1e-42
 Identities = 89/155 (57%), Positives = 109/155 (70%), Gaps = 1/155 (0%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGE-RVTVDPSLTFENDRIRNAYIALQAWKQAIISDP 395
           LSD E   I RRQLL    +  +  E  +T++  + FEN R++ AY+ALQAWK++I SDP
Sbjct: 24  LSDIEAASIARRQLLSNNGQLSNTYESEMTIN--MKFENARLKKAYVALQAWKKSIYSDP 81

Query: 396 RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH 575
            N T++W GS+VC Y GVFC  A D+P I  VA IDLNH DIAG+LP ELGLLAD+ + H
Sbjct: 82  TNFTANWEGSNVCAYNGVFCDNALDDPNISVVAGIDLNHADIAGHLPVELGLLADVSLIH 141

Query: 576 INSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           INSNRFCG IPK   NL +L E+D SNNRF G FP
Sbjct: 142 INSNRFCGIIPKSITNLTLLDEIDFSNNRFVGPFP 176



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 21/76 (27%), Positives = 44/76 (57%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P+       ++  +   +++++G LPEE+  L  L +  I+ N+F G++P+  K+++ 
Sbjct: 244 CIPSSIGKMGNSLDELVFTNNELSGCLPEEITKLTSLTLLDISGNKFVGSLPQDLKSMQK 303

Query: 633 LFELDISNNRFAGKFP 680
           +   DI++N+F G  P
Sbjct: 304 VEIFDIASNKFMGNVP 319



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 19/63 (30%), Positives = 33/63 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ ++  +D++ +   G LP++L  +  + +F I SN+F G +PK    L  L     S 
Sbjct: 276 KLTSLTLLDISGNKFVGSLPQDLKSMQKVEIFDIASNKFMGNVPKNLCTLPSLKNFTFSK 335

Query: 657 NRF 665
           N F
Sbjct: 336 NYF 338



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 26/81 (32%), Positives = 38/81 (46%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           + G F     D PK+     +DL  +D  G +P  L    +L    IN+NRF  TIP+  
Sbjct: 171 FVGPFPDVVLDLPKLNY---LDLRFNDFEGQVPSAL-FEKNLDAILINNNRFHSTIPESL 226

Query: 618 KNLKILFELDISNNRFAGKFP 680
            N      + ++NN+F G  P
Sbjct: 227 GNSNASVVV-LANNKFYGCIP 246



>gb:AF159297_1773221 Zea mays pollen extensin-like protein (Pex2)
           gene, complete cds.
          Length = 1016

 Score =  173 bits (438), Expect = 3e-42
 Identities = 85/161 (52%), Positives = 103/161 (63%), Gaps = 7/161 (4%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVTVD-------PSLTFENDRIRNAYIALQAWKQ 377
           ++ +E  YI RRQLL  ++     G  +  D        +  F N R+R AYIALQAW++
Sbjct: 32  VTSAEASYIARRQLLAMKEAGAGEGGDLPADFEFDDRVGAANFPNPRLRRAYIALQAWRR 91

Query: 378 AIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           A  SDP+  T++WVG DVC Y GV C  A D+PK+  VA IDLN  DIAGYLP ELGLL 
Sbjct: 92  AFYSDPKGYTANWVGEDVCKYNGVICTEALDDPKVTVVAGIDLNGADIAGYLPPELGLLT 151

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL  FHIN+NRFCG IPK    L +L E D+SNNRF G FP
Sbjct: 152 DLAFFHINTNRFCGIIPKSMSRLSLLHEFDVSNNRFVGVFP 192



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 27/79 (34%), Positives = 42/79 (53%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N   V C P      ++T+  I   ++ + G LP E+GLL +  V  ++ N   GTIP++
Sbjct: 254 NNAFVGCIPKSIGRMVKTLDEIIFLNNKLDGCLPLEMGLLVNTTVIDVSGNMLVGTIPEQ 313

Query: 615 FKNLKILFELDISNNRFAG 671
             N+  L +LD+S N F G
Sbjct: 314 LSNIAKLEQLDVSRNVFTG 332



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF-KNLKILFELDISNNRFAG 671
           +I +N +   GY+PE LG  +   V    +N F G IPK   + +K L E+   NN+  G
Sbjct: 226 AIFVNTNRFVGYIPENLG-NSTASVIVFANNAFVGCIPKSIGRMVKTLDEIIFLNNKLDG 284

Query: 672 KFP 680
             P
Sbjct: 285 CLP 287



>pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731842
           Z.mays (B73) gene for extensin-like protein.
          Length = 1188

 Score =  170 bits (431), Expect = 2e-41
 Identities = 85/161 (52%), Positives = 101/161 (62%), Gaps = 7/161 (4%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVTVD-------PSLTFENDRIRNAYIALQAWKQ 377
           ++ +E  YI  RQLL  ++  G     +  D        +  F N R+R AYIALQAW +
Sbjct: 32  VTSAEASYIAHRQLLAMKEAGGGEAGDLPADFEFDDRVGAANFPNPRLRRAYIALQAWHR 91

Query: 378 AIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           A  SDP+  T++WVG DVC Y GV C  A D+PKI  VA IDLN  DIAGYLP ELGLL 
Sbjct: 92  AFYSDPKGYTANWVGEDVCKYNGVICTEALDDPKITVVAGIDLNGADIAGYLPPELGLLT 151

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL  FHIN+NRFCG IPK    L +L E D+SNNRF G FP
Sbjct: 152 DLAFFHINTNRFCGIIPKSMSRLSLLHEFDVSNNRFVGVFP 192



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 27/79 (34%), Positives = 42/79 (53%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N   V C P      ++T+  I   ++ + G LP E+GLL +  V  ++ N   GTIP++
Sbjct: 254 NNAFVGCIPKSIGRMVKTLDEIIFLNNKLDGCLPLEMGLLVNTTVIDVSGNMLVGTIPEQ 313

Query: 615 FKNLKILFELDISNNRFAG 671
             N+  L +LD+S N F G
Sbjct: 314 LSNIAKLEQLDVSRNVFTG 332



>pir|T04609|T04609 hypothetical protein F20O9.70 - Arabidopsis
           thaliana>gb:ATCHRIV68_1546718 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 68.>gb:ATF20O9_1549537
           Arabidopsis thaliana DNA chromosome 4, BAC clone F20O9
           (ESSA project).
          Length = 391

 Score =  169 bits (429), Expect = 3e-41
 Identities = 73/120 (60%), Positives = 92/120 (76%)
 Frame = +3

Query: 321 TFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASI 500
           T     ++ AY AL+AWK+ I SDP+N T+DWVG  VC+YTG+FCAP+P NP    VA I
Sbjct: 36  TNPKQHLQQAYRALKAWKKVIYSDPKNLTADWVGPSVCSYTGIFCAPSPSNPNTLVVAGI 95

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DLNH DIAG+LPE +GLL+DL + H+NSNRFCG +P+ F NL +L+ELD+SNNRF G FP
Sbjct: 96  DLNHGDIAGFLPEAIGLLSDLALIHLNSNRFCGILPRSFANLSLLYELDLSNNRFVGPFP 155



>gb:AP002524_1822400 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP003118_1824789 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1174_D05.
          Length = 520

 Score =  168 bits (426), Expect = 7e-41
 Identities = 80/134 (59%), Positives = 99/134 (73%), Gaps = 1/134 (0%)
 Frame = +3

Query: 282 GDRGERVTVDPSLTFENDRIRNAYIALQAWK-QAIISDPRNTTSDWVGSDVCNYTGVFCA 458
           GD G  V  +    F + R+R+AY+ALQ W+ +AI SDP N T+DWVG DVCNYTGVFCA
Sbjct: 30  GDGGGGVAAE--WRFPSSRMRDAYVALQTWRREAIFSDPGNLTADWVGPDVCNYTGVFCA 87

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           P P + +   VA +DLNH DIAGYLP ELGLLADL + H+NSNRFCG +P   + L++L 
Sbjct: 88  PLPWDRREVAVAGVDLNHGDIAGYLPPELGLLADLALLHLNSNRFCGVLPATLRRLRLLH 147

Query: 639 ELDISNNRFAGKFP 680
           ELD+SNNRF G+FP
Sbjct: 148 ELDLSNNRFVGRFP 161



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/76 (28%), Positives = 40/76 (52%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C PA       T+  I L +  ++  LP E+G+L ++ VF ++ NR  G +P     ++ 
Sbjct: 229 CLPASLGNMSGTLNEILLINTGLSSCLPPEVGMLREVTVFDVSFNRLAGPLPSAVAGMRK 288

Query: 633 LFELDISNNRFAGKFP 680
           + +LD+++N   G  P
Sbjct: 289 VEQLDVAHNLLTGAIP 304



>gb:AC120505_1739755 Oryza sativa chromosome 3 BAC OSJNBa0066H15
           genomic sequence, complete sequence.
          Length = 394

 Score =  163 bits (413), Expect = 2e-39
 Identities = 74/125 (59%), Positives = 93/125 (74%), Gaps = 2/125 (1%)
 Frame = +3

Query: 312 PSLTFE--NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR 485
           PSL     N+R+  AY+A QAWK AI  DP+N T DW G  VCNYTGV+CA APD+P + 
Sbjct: 51  PSLPLSPFNERLEAAYVAFQAWKHAITEDPKNLTEDWCGPFVCNYTGVYCAAAPDDPHVL 110

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           TVA +DLNH DIAG LP+ LGLLAD+ + H+NSNRF GT+P   +++++LFELD+SNN  
Sbjct: 111 TVAGVDLNHGDIAGCLPDHLGLLADVALLHLNSNRFRGTLPPSMQHMRLLFELDVSNNLL 170

Query: 666 AGKFP 680
           AG FP
Sbjct: 171 AGAFP 175



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/71 (32%), Positives = 39/71 (54%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P P+  K++ +  +DL+H+++AG LP  +G +  L V ++  N   G +P+    L  
Sbjct: 271 CIP-PEIGKLKKLRVLDLSHNELAGELPASVGDMESLEVLNVGHNMLAGEVPEAICELPR 329

Query: 633 LFELDISNNRF 665
           L  L I+ N F
Sbjct: 330 LRNLTIAGNYF 340



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 20/76 (26%), Positives = 36/76 (47%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P        T+  + L +  I+  +P E+G L  L V  ++ N   G +P    +++ 
Sbjct: 246 CLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSHNELAGELPASVGDMES 305

Query: 633 LFELDISNNRFAGKFP 680
           L  L++ +N  AG+ P
Sbjct: 306 LEVLNVGHNMLAGEVP 321



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 1/66 (1%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSN-RFCGTIPKKFKNLKILFELDISNNR 662
           T + I L +  +AG LP  +G +AD  V  I  N      IP +   LK L  LD+S+N 
Sbjct: 232 TASVIVLANTRLAGCLPPSIGDMADTLVELILLNTSISSCIPPEIGKLKKLRVLDLSHNE 291

Query: 663 FAGKFP 680
            AG+ P
Sbjct: 292 LAGELP 297



>gb:AC130610_1740883 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0478F09, complete
           sequence.>gb:AC135425_1742337 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0453H11, complete
           sequence.
          Length = 414

 Score =  162 bits (409), Expect = 7e-39
 Identities = 79/131 (60%), Positives = 93/131 (70%), Gaps = 4/131 (3%)
 Frame = +3

Query: 300 VTVDPSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDWVGSDVCNYTGVFCAPAPDN- 473
           V VDP+  F + R+R+AY+ALQ WKQ AI SDP+N T+DWVG  VC YTGVFCAP P   
Sbjct: 33  VVVDPAWRFPSARLRDAYVALQTWKQTAIFSDPKNLTADWVGPAVCAYTGVFCAPLPGAG 92

Query: 474 --PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
             P    VA +DLNH DIAGYLP ELGLL DL + H+NSNRFCG +P   + L+ L ELD
Sbjct: 93  GAPGEVAVAGVDLNHGDIAGYLPAELGLLTDLALLHLNSNRFCGLVPDALRRLRRLHELD 152

Query: 648 ISNNRFAGKFP 680
           +SNNR  G FP
Sbjct: 153 LSNNRLVGAFP 163



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 42/76 (55%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C PA       T+  I L ++ +   +P E+GLL ++ VF ++ N   G +P +   ++ 
Sbjct: 231 CLPASLGNMSATLNEILLINNGLDSCVPPEVGLLREVTVFDVSFNSLAGPLPPEVTGMRK 290

Query: 633 LFELDISNNRFAGKFP 680
           + +LD+++NR AG  P
Sbjct: 291 VEQLDVAHNRLAGAVP 306



>gb:AY008306_1558198 Lilium longiflorum extensin-like protein mRNA,
           partial cds.
          Length = 134

 Score =  162 bits (409), Expect = 7e-39
 Identities = 75/121 (61%), Positives = 88/121 (72%)
 Frame = +3

Query: 318 LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS 497
           L  +N R++ A+IALQAWK+AI SDP N T++W G DVC+Y GVFC  A D+P I  VA 
Sbjct: 4   LKIKNPRLKRAFIALQAWKKAIYSDPFNFTANWDGPDVCSYNGVFCTSALDDPTIDVVAG 63

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DLN  DIAGYLP ELGLL D  +FHINSNRFCG IPK    L +L E D+SNNRF G F
Sbjct: 64  VDLNGADIAGYLPAELGLLTDTAIFHINSNRFCGIIPKSMSKLTLLHEFDVSNNRFVGSF 123

Query: 678 P 680
           P
Sbjct: 124 P 124



>gb:AB022223_1515180 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MWI23.
          Length = 470

 Score =  160 bits (406), Expect = 1e-38
 Identities = 76/117 (64%), Positives = 89/117 (76%)
 Frame = +3

Query: 330 NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLN 509
           N R+  A+ ALQAWK  I SDP   TS+W G +VCNYTGVFCAPA DNP + TVA IDLN
Sbjct: 48  NPRLLKAFTALQAWKFTITSDPNGFTSNWCGPNVCNYTGVFCAPALDNPYVLTVAGIDLN 107

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H +IAGYLP ELGLL DL +FHINSNRF G +PK  K L +L ELD+SNN+ +G+FP
Sbjct: 108 HANIAGYLPLELGLLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLSGEFP 164



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P       +T+  I + +  + G L  E+GLL  L VF ++ N   G++P+   ++K 
Sbjct: 233 CVPPSFYKMGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLPETIGDMKS 292

Query: 633 LFELDISNNRFAGKFP 680
           L +L+I++N+F+G  P
Sbjct: 293 LEQLNIAHNKFSGYIP 308



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           D++++++ G LPE +G +  L   +I  N+F G IP+    L  L     S N F+G+ P
Sbjct: 273 DVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENFTYSYNFFSGEPP 332



>gb:AP003312_1827837 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0025H06.
          Length = 503

 Score =  159 bits (403), Expect = 3e-38
 Identities = 78/154 (50%), Positives = 102/154 (66%)
 Frame = +3

Query: 219 LSDSEVHYIQRRQLLYYRDEFGDRGERVTVDPSLTFENDRIRNAYIALQAWKQAIISDPR 398
           ++  E   I RRQLL + ++ GD    + +D  +   N R+  A+ AL A K+A+ SDP 
Sbjct: 28  VTSHEAAAIARRQLLNF-EKHGDH-VHIDIDIEIKVSNPRLAAAHRALHALKRALYSDPG 85

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHI 578
           N T DW G DVC Y GV CAP+PDN     VAS+D+N  D+AGYLP E+GLL+DL V H+
Sbjct: 86  NFTGDWAGPDVCAYNGVLCAPSPDNASASAVASLDMNAADVAGYLPREIGLLSDLAVLHL 145

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           NSNRFCG IP++  N+  L+ELD+SNNR  G FP
Sbjct: 146 NSNRFCGVIPEEVANMTRLYELDVSNNRLVGAFP 179



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 25/76 (32%), Positives = 36/76 (47%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P        T+      ++ + G LP E GLLA+  VF ++ N   G IP     L  
Sbjct: 247 CIPPTIGQAAATLDQFVFLNNSLTGCLPLESGLLANATVFDVSHNLLTGAIPATMGGLAK 306

Query: 633 LFELDISNNRFAGKFP 680
           + +LD+S+N F G  P
Sbjct: 307 VEQLDLSHNTFTGVVP 322



>gb:AC092076_1735179 Oryza sativa chromosome 3 BAC OSJNBb0021G19
           genomic sequence, complete sequence.
          Length = 393

 Score =  159 bits (403), Expect = 3e-38
 Identities = 71/117 (60%), Positives = 87/117 (74%)
 Frame = +3

Query: 330 NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLN 509
           N R+  AY+ALQA K+AI  DP+N T  W G +VC Y GV+CA APD+P  RTVA +DLN
Sbjct: 44  NSRLEKAYVALQALKRAITDDPKNLTHSWCGPEVCGYFGVYCAAAPDDPCARTVAGVDLN 103

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H D+AG LPEELGLL DL VFH+NSNRFCG++P   +NL  L E+D+SNN  +G FP
Sbjct: 104 HGDLAGTLPEELGLLTDLAVFHLNSNRFCGSLPDSLRNLHRLHEIDVSNNHLSGSFP 160



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/76 (27%), Positives = 41/76 (53%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P+       T+  + L +  I+  +P E+G L  L V  ++ N F G +P+   +++ 
Sbjct: 229 CLPSSIGDMAETLNELVLLNSGISSCIPPEIGKLDKLTVLDLSFNDFAGALPETIGHMRA 288

Query: 633 LFELDISNNRFAGKFP 680
           L +L++++N  AG+ P
Sbjct: 289 LEQLNVAHNGLAGEIP 304



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 24/74 (32%), Positives = 36/74 (48%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P P+  K+  +  +DL+ +D AG LPE +G +  L   ++  N   G IP     L  
Sbjct: 254 CIP-PEIGKLDKLTVLDLSFNDFAGALPETIGHMRALEQLNVAHNGLAGEIPDSICALPH 312

Query: 633 LFELDISNNRFAGK 674
           L     S+N F G+
Sbjct: 313 LKNFTYSHNFFCGE 326



>gb:AP003761_1833074 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0018H04.
          Length = 538

 Score =  152 bits (385), Expect = 4e-36
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 2/125 (1%)
 Frame = +3

Query: 312 PSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRT 488
           PS  F N R+R AY+ALQAW++ AI SDP N T++W G DVC Y GVFCA  P + ++R 
Sbjct: 31  PSWAFPNARLRAAYVALQAWRRTAIFSDPANFTANWSGPDVCGYNGVFCAAHPTDGRVRV 90

Query: 489 VASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           VA +DLNH DIAGY+P  L   L DL + H+NSNRFCG +P  F +L++L ELDISNNRF
Sbjct: 91  VAGLDLNHADIAGYIPASLPEGLPDLALLHLNSNRFCGVLPDTFSHLRLLHELDISNNRF 150

Query: 666 AGKFP 680
            G FP
Sbjct: 151 VGGFP 155



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P        T+  I L  D++ G +P ++GLL  + VF ++ N   G +P     L  
Sbjct: 223 CIPPSIGRMAETLNEIVLIDDELTGCIPPQVGLLRKVTVFDVSGNHLQGPLPGSVAGLAA 282

Query: 633 LFELDISNNRFAGKFP 680
           + +LD++ N F G  P
Sbjct: 283 VEQLDVAGNLFEGPVP 298



>gb:AP005647_1855410 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0026E05.
          Length = 694

 Score =  149 bits (377), Expect = 3e-35
 Identities = 77/134 (57%), Positives = 90/134 (67%), Gaps = 6/134 (4%)
 Frame = +3

Query: 297 RVTVDPSLTFENDRIRNAYIALQAWKQ-AIISDPRNTTSDWVGSDVCNYTGVFCAPAPD- 470
           R    PS  F N R+R AY ALQAWKQ AI SDP N T+ WVG++VC Y GV+CAP+P  
Sbjct: 40  RYDAPPSWAFPNPRLRAAYAALQAWKQTAIFSDPSNFTASWVGANVCAYNGVYCAPSPGY 99

Query: 471 ---NPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILF 638
                    VA IDLNH DIAGYLP  L L L DL + H+NSNRFCG +P  F+ L++L 
Sbjct: 100 GGGGGGGLVVAGIDLNHADIAGYLPASLPLGLPDLALIHLNSNRFCGVVPDTFRRLRLLH 159

Query: 639 ELDISNNRFAGKFP 680
           ELD+SNNRF G FP
Sbjct: 160 ELDLSNNRFVGAFP 173



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 23/76 (30%), Positives = 37/76 (48%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P        T+  I L  D++ G +P ++GLL  + VF ++ N   G IP     +  
Sbjct: 241 CIPPSIGKMADTLNEIVLIADELTGCVPTQVGLLRKVTVFDVSDNHLQGPIPASVAGMAA 300

Query: 633 LFELDISNNRFAGKFP 680
           + +LD++ N F G  P
Sbjct: 301 VEQLDVARNLFEGAVP 316



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 1/75 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD-LGVFHINSNRFCGTIPKKFKNLKIL 635
           P P N      + + L H+++ G +P  +G +AD L    + ++   G +P +   L+ +
Sbjct: 218 PIPANLGNSPASVVVLAHNNLGGCIPPSIGKMADTLNEIVLIADELTGCVPTQVGLLRKV 277

Query: 636 FELDISNNRFAGKFP 680
              D+S+N   G  P
Sbjct: 278 TVFDVSDNHLQGPIP 292



>gb:AP004307_1839965 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0534H07.
          Length = 328

 Score =  147 bits (371), Expect = 2e-34
 Identities = 67/117 (57%), Positives = 82/117 (70%)
 Frame = +3

Query: 330 NDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLN 509
           N R++ AY+ALQA ++ +  DP+N T  W G DVC Y GV+CA APD+P   TVA IDLN
Sbjct: 42  NPRLQRAYVALQALRRRVTDDPKNLTGGWCGPDVCRYFGVYCAAAPDDPCAATVAGIDLN 101

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H D+A  LP+ELGLL DL V H+NSNRF G +P     L +L ELD+SNNR AG FP
Sbjct: 102 HGDLAATLPDELGLLTDLAVLHLNSNRFSGALPDTLPKLSLLHELDVSNNRLAGGFP 158



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 20/76 (26%), Positives = 40/76 (52%)
 Frame = +3

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C P+       T+  + + +  +   +P E+G L +L V  +++N+  GT+P+    ++ 
Sbjct: 226 CIPSSVGRMAATLNELVVLNSGVRSCIPPEIGHLGELTVLDVSNNQLQGTLPESMAWMRS 285

Query: 633 LFELDISNNRFAGKFP 680
           L +LD++ N  AG  P
Sbjct: 286 LEQLDVARNELAGHIP 301



>pir|T13435|T13435 hypothetical protein T17A13.60 - Arabidopsis
           thaliana>gb:ATCHRIV70_1546845 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           70.>gb:AY091036_1574265 Arabidopsis thaliana putative
           extensin (At4g29240) mRNA, complete
           cds.>gb:AY117248_1579289 Arabidopsis thaliana putative
           extensin (At4g29240) mRNA, complete cds.
          Length = 415

 Score =  122 bits (305), Expect = 8e-27
 Identities = 59/113 (52%), Positives = 76/113 (67%)
 Frame = +3

Query: 342 RNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDI 521
           R AY ALQ WK A+  DP N    WVGSDVC+Y GVFC+        +++ SIDLNH ++
Sbjct: 74  RVAYNALQVWKSAMREDPSNVLKTWVGSDVCSYKGVFCSG-------QSITSIDLNHANL 126

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            G L ++L LL+DL + H+NSNRF G IP  FK+L  L ELD+SNN+ +G FP
Sbjct: 127 KGTLVKDLALLSDLNILHLNSNRFSGQIPDSFKSLASLQELDLSNNKLSGPFP 179



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I  +  +DL  + + G++PEEL     L    +N+N+F G IP+   N      ++++NN
Sbjct: 185 IPNLVYLDLRFNSLTGFIPEEL-FNKRLDAILLNNNQFVGEIPRNLGNSPASV-INLANN 242

Query: 660 RFAGKFP 680
           RF+G+ P
Sbjct: 243 RFSGEIP 249



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 14/57 (24%), Positives = 35/57 (61%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           D++++ + G++P+ +  L+ + + ++  N+F G +P    +L+ L  L ++ N F+G
Sbjct: 287 DVSYNALMGHVPDTISCLSAIEILNLAHNKFSGEVPDLVCSLRNLINLTVAFNFFSG 343



>pir|A84581|A84581 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005169_1532269 Arabidopsis
           thaliana chromosome 2 clone F6F22 map mi148, complete
           sequence.>gb:BT004135_1637234 Arabidopsis thaliana clone
           RAFL15-20-F01 (R20712) putative disease resistance
           protein (At2g19780) mRNA, complete
           cds.>gb:BT005020_1637966 Arabidopsis thaliana clone
           U20712 putative disease resistance protein (At2g19780)
           mRNA, complete cds.
          Length = 402

 Score =  120 bits (301), Expect = 2e-26
 Identities = 58/111 (52%), Positives = 74/111 (66%)
 Frame = +3

Query: 348 AYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           AY ALQ+WK AI  DP      WVG DVC+Y GVFC+ +       ++ SIDLN  ++ G
Sbjct: 71  AYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGS-------SITSIDLNKANLKG 123

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            + ++L LL+DL + H+NSNRF G IP  FKNL  L ELD+SNNRF+G FP
Sbjct: 124 TIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFP 174



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 16/57 (28%), Positives = 34/57 (59%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           D++ + + G++P+ +  L+++ V ++  N+F G +P     L+ L  L +S N F+G
Sbjct: 282 DVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSG 338



>gb:AB073166_1523152 Arabidopsis thaliana DNA, chromosome 4
           centromere region, BAC clone:F15N16.
          Length = 404

 Score =  114 bits (285), Expect = 2e-24
 Identities = 58/126 (46%), Positives = 75/126 (59%), Gaps = 5/126 (3%)
 Frame = +3

Query: 318 LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS 497
           L+F + R+   Y  +Q +K  I  DP N T  W+GSD+C+Y G  C   P N    TVAS
Sbjct: 38  LSFLDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDICSYRGFHCDNPPHNKTAVTVAS 97

Query: 498 IDLNH-----DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           ID N        I G++ +     ADL +FH+NSN F GT+P K  NL+ L+ELDISNNR
Sbjct: 98  IDFNGFQLSAPSIEGFIDQ----FADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNR 153

Query: 663 FAGKFP 680
           F G+FP
Sbjct: 154 FTGQFP 159



>gb:OSJN00038_1693719 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0014K14, complete
           sequence.>gb:OSJN00283_1697932 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0116K07, complete
           sequence.
          Length = 454

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 48/117 (41%), Positives = 71/117 (60%), Gaps = 2/117 (1%)
 Frame = +3

Query: 324 FENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCN-YTGVFCAPAPDNPKIRTVASI 500
           FEN+R+  AY  +Q +++ +  DP+N  S W G+D+C+ Y G FC   P N   RT+AS+
Sbjct: 79  FENERLYKAYKVIQKFRRTVTCDPQNIISSWSGADLCSTYKGFFC-ERPPNITDRTIASV 137

Query: 501 DLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           D N  ++ A  L E +  L DL +FH NSN F G +P     L+  +ELD+SNN+ +
Sbjct: 138 DFNGYNLQASSLKEFVDALPDLALFHANSNNFGGAVP-DLSRLQYFYELDLSNNKLS 193



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG    P        T+  +   ++ ++G LP ELGLLA   V    +N+  G IP  
Sbjct: 264 NFTGEI--PKSIARMANTLFEVLFLNNKLSGCLPYELGLLAKATVIDAGTNQLTGPIPAS 321

Query: 615 FKNLKILFELDISNNRFAGKFP 680
           F  L+ + +L++++N   G+ P
Sbjct: 322 FACLRKVEQLNLADNLLYGEVP 343



>gb:AB025624_1516460 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.
          Length = 493

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 48/129 (37%), Positives = 73/129 (56%), Gaps = 6/129 (4%)
 Frame = +3

Query: 312 PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVC---NYTGVFCAPAPDNPKI 482
           P L F +  I+  Y  ++ ++  I  DP++    WVG+D+C    Y G+ CA  P    +
Sbjct: 115 PPLHFSSPLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICAQDKYIGLECAKLPGTNDL 174

Query: 483 RTVASIDLNHDDIAGY---LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
             +ASI  N+ ++ G    L   L  L ++ +FH NSN F G++P  F  LK LFELD+S
Sbjct: 175 -ALASIQFNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGSVPN-FSKLKYLFELDLS 232

Query: 654 NNRFAGKFP 680
           NN+ +G+FP
Sbjct: 233 NNKLSGEFP 241



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +N++++   LPE LG +  L +   N NRF G IP    ++K L E+   NN+  G  P
Sbjct: 278 INNNNLVQRLPENLGSITALYLTFAN-NRFTGPIPGSIGDIKSLQEVLFLNNKLTGCLP 335



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           TV  ++LN   + G +P   G L  +   ++  N F GTIP+    L  L  L +S N F
Sbjct: 345 TVFDVELNQ--LTGPIPYSFGCLKKMEQLNLARNNFYGTIPEIVCELSALKNLSLSYNYF 402



>gb:OSJN00032_1693604 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043A12, complete sequence.
          Length = 446

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 18/150 (12%)
 Frame = +3

Query: 285 DRGERVTVDPSLT-FENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCN-------Y 440
           DRG +    PS   F N+ ++  Y  +QA+K  I SDPR  T+ WVG ++C+       Y
Sbjct: 50  DRGGQGKPAPSPEDFLNENLQALYPVIQAFKATITSDPRGVTASWVGPNLCDSYFGGDMY 109

Query: 441 TGVFC--APAP-------DNPKIRTVASIDLNHDDI-AGYLPEELGLLADLGVFHINSNR 590
            G +C   PAP       DN  + T+ASID N   + A  L   +    DL +FH NSN 
Sbjct: 110 KGFYCEHPPAPPGATTPKDNTTL-TIASIDFNGYGLGAPSLSGFVDAFPDLALFHANSNN 168

Query: 591 FCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           F G +P     L   +ELD+SNN F+G FP
Sbjct: 169 FSGEVP-DLTGLPYFYELDLSNNNFSGAFP 197



>pir|B96534|B96534 hypothetical protein F14J22.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_892906 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537446 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.>gb:BT011626_1641148 Arabidopsis thaliana
           At1g49750 mRNA, complete cds.>gb:BT012269_1641475
           Arabidopsis thaliana At1g49750 gene, complete cds.
          Length = 494

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 47/130 (36%), Positives = 70/130 (53%), Gaps = 7/130 (5%)
 Frame = +3

Query: 312 PSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCN-YTGVFCAPAPDNPKIRT 488
           P L F +  ++  Y  LQ +K  +  D   +   W G D+CN Y G+ CA  P    +  
Sbjct: 115 PDLPFASSLLKKVYPVLQRFKDLVADDKLKS---WEGPDICNKYLGLKCAIFPKTKHL-A 170

Query: 489 VASIDLNHDDIAGYLPEELGL------LADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +AS+  N  ++ G + + L L      L ++ +FH NSN F G++P  F NLK L+ELD+
Sbjct: 171 LASVQFNGLNLRGKIGKILKLDNFLDKLEEVTIFHANSNGFTGSVPD-FSNLKFLYELDL 229

Query: 651 SNNRFAGKFP 680
           SNN+  G FP
Sbjct: 230 SNNKLTGDFP 239



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +N++++   LP  LG +  L +   N NRF G IP+   N+K L E+   NN+  G  P
Sbjct: 276 INNNNLVQKLPLNLGSITALYLTFAN-NRFTGPIPESIGNIKYLQEVLFLNNKLTGCLP 333



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           D+  + + G +P   G L  +   ++  N+F GTIP+    +  L  + +SNN F
Sbjct: 346 DVGFNQLTGPIPYSFGCLETMEQLNLAGNKFYGTIPEIVCEIACLQNVSLSNNYF 400



>gb:AK117932_1815939 Arabidopsis thaliana At1g63430 mRNA for
           putative receptor protein kinase, complete cds, clone:
           RAFL19-12-F18.
          Length = 664

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 43/114 (37%), Positives = 63/114 (55%), Gaps = 2/114 (1%)
 Frame = +3

Query: 345 NAYIALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD 518
           N   AL+ +K+AI  DP    S+W    SD C++TG++C+P+ D+     V  I+++   
Sbjct: 26  NEVQALRRFKEAIYEDPLLVMSNWDDPNSDPCDWTGIYCSPSKDH-----VIKINISASS 80

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           I G+L  ELG +  L    ++ N   GTIPK+  NLK L  LD+ NN   G  P
Sbjct: 81  IKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLKILDLGNNHLMGPIP 134



>gb:AE005173_894011 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC008047_1536506 Genomic sequence
           for Arabidopsis thaliana BAC F2K11 from chromosome I,
           complete sequence.
          Length = 705

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 43/117 (36%), Positives = 65/117 (55%), Gaps = 5/117 (4%)
 Frame = +3

Query: 345 NAYIALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNP-KIRTV--ASIDLN 509
           N   AL+ +K+AI  DP    S+W    SD C++TG++C+P+ D+  KI  +  +  +++
Sbjct: 26  NEVQALRRFKEAIYEDPLLVMSNWNDPNSDPCDWTGIYCSPSKDHVIKILWIFFSCRNIS 85

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              I G+L  ELG +  L    ++ N   GTIPK+  NLK L  LD+ NN   G  P
Sbjct: 86  ASSIKGFLAPELGQITYLQELILHGNILIGTIPKEIGNLKNLKILDLGNNHLMGPIP 142



>pir|T48216|T48216 hypothetical protein T20L15.220 - Arabidopsis
           thaliana>gb:ATT20L15_1555048 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA project).
          Length = 984

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 40/110 (36%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVC--NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL++ K++++ DP++   +W   D C  N+TGV C           V  + LN + ++G 
Sbjct: 116 ALRSVKRSLL-DPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLNGNKLSGT 174

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LP ELG L++L  F I+ N   G IPK F NLK +  L  +NN   G+ P
Sbjct: 175 LPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIP 224



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 22/72 (30%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD  KIR +  +DL+ +++ G +P       D+   ++++N   G+IP+ F +L +L  L
Sbjct: 297 PDFSKIRHLKYLDLSWNELTGPIPSS-NFSKDVTTINLSNNILNGSIPQSFSDLPLLQML 355

Query: 645 DISNNRFAGKFP 680
            + NN  +G  P
Sbjct: 356 LLKNNMLSGSVP 367



>gb:AP000607_1820463 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T25O11.
          Length = 943

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVC--NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           + DP N   DW  +D C  N+TGV C P P +  +  V  + L+ + + G LP+ELG L+
Sbjct: 43  LKDPLNHLQDWKKTDPCASNWTGVICIPDPSDGFLH-VKELLLSGNQLTGSLPQELGSLS 101

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L +  I+ N   G +P    NLK L    ++NN   G+ P
Sbjct: 102 NLLILQIDYNEISGKLPTSLANLKKLKHFHMNNNSITGQIP 142



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 23/83 (27%), Positives = 40/83 (48%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           CN  G    P PD  K   +  +D++ + + G +P+     A++   ++ +N   G+IP 
Sbjct: 208 CNLEG----PIPDLSKSLVLYYLDISSNKLTGEIPKNK-FSANITTINLYNNLLSGSIPS 262

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
            F  L  L  L + NN  +G+ P
Sbjct: 263 NFSGLPRLQRLQVQNNNLSGEIP 285



>gb:AP004097_1837688 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1792_D02.
          Length = 438

 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 4/116 (3%)
 Frame = +3

Query: 324 FENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVC---NYTGVFCAPAPDNPKIRTVA 494
           F N+ +   Y+ +Q +K+ I SDP+N T+ W G D+C    Y G +CA  P   K  TV 
Sbjct: 51  FPNEELYRNYLVIQRFKKTITSDPKNITATWTGHDICGNTTYLGFYCAALPGRTKKPTVT 110

Query: 495 SIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            +  N   + A  L   +  L DL +FH  SN F G IP     L   +++++ +N
Sbjct: 111 VVIFNGYGLRAPKLEGFIDHLPDLALFHAASNDFGGDIP-YLTGLAYNYKINVDSN 165



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L ++ ++G LP ELG+L    VF    N+  G IP  F  L  + +L++  NR  G+ P
Sbjct: 271 LLNNQLSGCLPHELGMLTKAAVFDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIP 329



>gb:AP004097_1837687 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1792_D02.
          Length = 407

 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 39/116 (33%), Positives = 59/116 (50%), Gaps = 4/116 (3%)
 Frame = +3

Query: 324 FENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVC---NYTGVFCAPAPDNPKIRTVA 494
           F N+ +   Y+ +Q +K+ I SDP+N T+ W G D+C    Y G +CA  P   K  TV 
Sbjct: 51  FPNEELYRNYLVIQRFKKTITSDPKNITATWTGHDICGNTTYLGFYCAALPGRTKKPTVT 110

Query: 495 SIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            +  N   + A  L   +  L DL +FH  SN F G IP     L   +++++ +N
Sbjct: 111 VVIFNGYGLRAPKLEGFIDHLPDLALFHAASNDFGGDIP-YLTGLAYNYKINVDSN 165



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L ++ ++G LP ELG+L    VF    N+  G IP  F  L  + +L++  NR  G+ P
Sbjct: 271 LLNNQLSGCLPHELGMLTKAAVFDAGMNQLTGPIPSSFSCLTSVEQLNLGGNRLYGEIP 329



>gb:AP003489_1829912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0568D10.
          Length = 1060

 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 42/133 (31%), Positives = 65/133 (48%), Gaps = 21/133 (15%)
 Frame = +3

Query: 345 NAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFC---------------------AP 461
           N + AL ++K  + +DP    ++W   +VCN+TGV C                     +P
Sbjct: 30  NDHSALMSFKSGVSNDPNGALANWGSLNVCNWTGVSCDASRRRVVKLMLRDQKLSGEVSP 89

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           A  N  +  +  ++L+ +  AG +P ELG L  L +  I+SN F G +P +  NL  L  
Sbjct: 90  ALGN--LSHLNILNLSGNLFAGRVPPELGNLFRLTLLDISSNTFVGRVPAELGNLSSLNT 147

Query: 642 LDISNNRFAGKFP 680
           LD+S N F G+ P
Sbjct: 148 LDLSRNLFTGEVP 160



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/85 (27%), Positives = 43/85 (50%)
 Frame = +3

Query: 426 DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI 605
           D+ + T V   PA +   + ++ ++DL+ +   G +P ELG L+ L    + +N   G I
Sbjct: 125 DISSNTFVGRVPA-ELGNLSSLNTLDLSRNLFTGEVPPELGDLSKLQQLSLGNNLLEGKI 183

Query: 606 PKKFKNLKILFELDISNNRFAGKFP 680
           P +   +  L  L++  N  +G+ P
Sbjct: 184 PVELTRMSNLSYLNLGENNLSGRIP 208



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+H+ +AG +P  +    +L    ++ N   G IP     L  L  L++S+N   G  P
Sbjct: 450 LHHNHLAGVIPPGIAQCVNLQNLDLSHNMLRGKIPDDLSELSGLLYLNLSSNLLEGMIP 508



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEE-LGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           P   ++  +  +DL+ + +AG +P   L  L  L    ++ N   G IP        L  
Sbjct: 412 PSLGEVPRLGLVDLSRNRLAGGIPAAALSNLTQLRWLVLHHNHLAGVIPPGIAQCVNLQN 471

Query: 642 LDISNNRFAGKFP 680
           LD+S+N   GK P
Sbjct: 472 LDLSHNMLRGKIP 484



>gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0479C12.>gb:AP004665_1842911 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0429B05.
          Length = 1112

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 34/98 (34%), Positives = 57/98 (58%), Gaps = 2/98 (2%)
 Frame = +3

Query: 393 PRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLG 566
           P + +S W  SD   CN+ GV C       K  +V S+DL+   ++G L  ++GL+  L 
Sbjct: 40  PHSISSTWKASDTTPCNWDGVSCN------KKNSVVSLDLSSSGVSGSLGPQIGLMKSLQ 93

Query: 567 VFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           V  +++N   G+IP++  N  +L +LD+S+N F+G+ P
Sbjct: 94  VLSLSNNSISGSIPQELGNCSMLDQLDLSSNSFSGEIP 131



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/67 (31%), Positives = 41/67 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R ++ + L+ + ++G +P E+G    L    +++N+  GT+PK+  NL+ L +L +  N
Sbjct: 304 LRNLSQLLLSENSLSGPIPPEIGNCQLLVWLELDANQLNGTVPKELANLRKLEKLFLFEN 363

Query: 660 RFAGKFP 680
           R  G+FP
Sbjct: 364 RLIGEFP 370



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/74 (28%), Positives = 38/74 (51%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           P P       ++ IDL+H+ ++G +P  LG   ++ +   + N+  G IP + ++L  L 
Sbjct: 488 PIPQFRNCANLSYIDLSHNSLSGNIPASLGRCVNITMIKWSENKLVGPIPSEIRDLVNLR 547

Query: 639 ELDISNNRFAGKFP 680
            L++S N   G  P
Sbjct: 548 VLNLSQNSLQGVLP 561



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 17/57 (29%), Positives = 31/57 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           L+ + ++G LP+ +G    L   ++  N+  G++PK    +K L   DI+ N F G+
Sbjct: 193 LHGNKLSGVLPDSIGNCTKLEELYLLDNQLSGSLPKTLSYIKGLKIFDITANSFTGE 249



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/61 (26%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ + + G LP ++   + L +  ++ N   G+      NLK L +L +  N+F+G  
Sbjct: 549 LNLSQNSLQGVLPVQISSCSKLYLLDLSFNSLNGSALTTVSNLKFLSQLRLQENKFSGGI 608

Query: 678 P 680
           P
Sbjct: 609 P 609



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ + + G     +  L  L    +  N+F G IP     L +L EL +  N   G  
Sbjct: 573 LDLSFNSLNGSALTTVSNLKFLSQLRLQENKFSGGIPDSLSQLDMLIELQLGGNVLGGSI 632

Query: 678 P 680
           P
Sbjct: 633 P 633



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 20/67 (29%), Positives = 31/67 (46%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I+++ S+ +  +   G LP  L  L  L    + +N F G IP        L ++D +NN
Sbjct: 376 IKSLQSVLIYENSFTGRLPPVLAELKFLKNITLFNNFFTGVIPPDLGVNSRLTQIDFTNN 435

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 436 SFVGGIP 442



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  I  + + + G +P E+  L +L V +++ N   G +P +  +   L+ LD+S N   
Sbjct: 522 ITMIKWSENKLVGPIPSEIRDLVNLRVLNLSQNSLQGVLPVQISSCSKLYLLDLSFNSLN 581

Query: 669 G 671
           G
Sbjct: 582 G 582



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 16/61 (26%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +  +G +P  LG +  L    + SN   G IP+     + L ++ +  N+ +G  
Sbjct: 119 LDLSSNSFSGEIPASLGDIKKLSSLSLYSNSLTGEIPEGLFKNQFLEQVYLHYNKLSGSI 178

Query: 678 P 680
           P
Sbjct: 179 P 179



>gb:AP005245_1849450 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0025J22.
          Length = 657

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 38/111 (34%), Positives = 57/111 (51%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           +AL A K A+  DP    S W    +D C ++GV C           VA ++L +  +AG
Sbjct: 32  LALLALKFAVSEDPNGALSTWRDADNDPCGWSGVTCVDGGGG----RVAGVELANFSLAG 87

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           YLP EL LL++L    +  N+  G IP     L+ L  LD+++N  +G+ P
Sbjct: 88  YLPSELSLLSELVTLSLPYNQLAGQIPVAITALQKLAALDLAHNLLSGQVP 138



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           ++ +++ +DL+ + + G LP  +  L  L GV +++ N F G IP +F  + +   LD+ 
Sbjct: 143 RLVSLSRLDLSSNQLNGSLPPAIAGLPRLSGVLNLSYNHFTGGIPPEFGGIPVAVSLDLR 202

Query: 654 NNRFAGKFP 680
            N  AG+ P
Sbjct: 203 GNDLAGEIP 211



>gb:AK117435_1815469 Arabidopsis thaliana At5g41180 mRNA for
           putative receptor kinase, complete cds, clone:
           RAFL17-03-N15.
          Length = 565

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           A++ +K+AI  DP    S+W   ++  C++ G+ C+P+ D+     +  I+++   + G+
Sbjct: 35  AVRRFKEAIYKDPLLVMSNWNVPNLSPCDWNGIKCSPSKDH-----IIKINISGTSMRGF 89

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG +  L    +  N   GTIPK+   LK L  LD+ NN   G  P
Sbjct: 90  LVPELGQITYLQELILRGNILMGTIPKEIGKLKKLKILDLGNNHLTGPIP 139



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 17/85 (20%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK--------- 629
           K+  + +I+L  + + G LP E+G L  L    I  NR  G+IP   K  K         
Sbjct: 144 KLSRIKTINLQSNGLIGKLPPEIGNLKHLKELLIGRNRLRGSIPIAAKTSKKYASNPSAN 203

Query: 630 -------ILFEL-DISNNRFAGKFP 680
                   LF++ D S N F G+ P
Sbjct: 204 ISGLCKSSLFKVADFSYNFFEGRVP 228



>gb:AF177674_1774650 Arabidopsis thaliana cultivar Wassilewskia
           receptor-like protein CLAVATA2 (CLV2) gene, complete
           cds.
          Length = 720

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 19/115 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPA-------------------PDNPKIRTVASIDL 506
           I D   + S W GS   N+TG+ C                      P   K+ ++ S+DL
Sbjct: 45  IHDLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTSSGLNLSGQIHPSLCKLSSLQSLDL 104

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +H++ +G +P   G L +L + +++ NRF G+IP  F +LK L E+ +S NR  G
Sbjct: 105 SHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPATFVSLKELREVVLSENRDLG 159



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/66 (28%), Positives = 36/66 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++++ ++ L+H+ + G +P  +G L  L V  ++ N   G+IP        L  L ISN
Sbjct: 337 ELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALMISN 396

Query: 657 NRFAGK 674
           N  +G+
Sbjct: 397 NNLSGE 402



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+H+ + G +P  +     L    I++N   G I  +   L  L  LDISNN  +G+ 
Sbjct: 368 IDLSHNALTGSIPLNIVGCFQLLALMISNNNLSGEIQPELDALDSLKILDISNNHISGEI 427

Query: 678 P 680
           P
Sbjct: 428 P 428



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/67 (23%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++  +D++ ++++G L E +   ++L    +  N+F GT+P        +  +D S+N
Sbjct: 434 LKSLEIVDISSNNLSGNLNEAITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSN 493

Query: 660 RFAGKFP 680
           RF+   P
Sbjct: 494 RFSWFIP 500



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 241 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 300

Query: 666 AGKFP 680
           +G+ P
Sbjct: 301 SGRLP 305



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G    N   V   FC+   + P+    ++++  +
Sbjct: 141 FVSLKELREVVLSENRDLGGVIPHWFGDFSMNLERVDISFCSFVGELPESLLYLKSLKYL 200

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   G  P
Sbjct: 201 NLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLP 257



>gb:OSJN00196_1696553 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020O11, complete sequence.
          Length = 664

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 44/136 (32%), Positives = 67/136 (49%), Gaps = 6/136 (4%)
 Frame = +3

Query: 291 GERVTVDPSLTFENDRIR---NAYI-ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVF 452
           G  + V PS +  +D I    + Y+ AL A+K+AI  DP    SDW   D   C +TGV 
Sbjct: 15  GCALLVAPSESAADDGINCPSHVYLSALLAFKKAIFEDPLAKLSDWNSKDENPCGWTGVG 74

Query: 453 CAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
           C+P         V +++L +  + G+L  E+  L+ L    ++ N   G IPK    L+ 
Sbjct: 75  CSPFDSR-----VVTLELANSSLKGFLALEIESLSSLQKLILDHNTLMGPIPKGIGKLRN 129

Query: 633 LFELDISNNRFAGKFP 680
           L  L++S N+  G  P
Sbjct: 130 LIMLNLSTNQLDGPIP 145



>gb:AB010072_1510934 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MEE6.
          Length = 664

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           A++ +K+AI  DP    S+W   ++  C++ G+ C+P+ D+     +  I+++   + G+
Sbjct: 35  AVRRFKEAIYKDPLLVMSNWNVPNLSPCDWNGIKCSPSKDH-----IIKINISGTSMRGF 89

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG +  L    +  N   GTIPK+   LK L  LD+ NN   G  P
Sbjct: 90  LVPELGQITYLQELILRGNILMGTIPKEIGKLKKLKILDLGNNHLTGPIP 139



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 17/85 (20%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK--------- 629
           K+  + +I+L  + + G LP E+G L  L    I  NR  G+IP   K  K         
Sbjct: 144 KLSRIKTINLQSNGLIGKLPPEIGNLKHLKELLIGRNRLRGSIPIAAKTSKKYASNPSAN 203

Query: 630 -------ILFEL-DISNNRFAGKFP 680
                   LF++ D S N F G+ P
Sbjct: 204 ISGLCKSSLFKVADFSYNFFEGRVP 228



>pir|C96745|C96745 hypothetical protein T9N14.3 [imported] -
           Arabidopsis thaliana>gb:AE005173_894765 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540317 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.
          Length = 977

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/72 (38%), Positives = 42/72 (58%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +   D++ + ++G LPEELG+L +L VFH + N F G  P  F +L  L  L
Sbjct: 260 PEIKNLTRLREFDISSNQLSGVLPEELGVLKELRVFHCHENNFTGEFPSGFGDLSHLTSL 319

Query: 645 DISNNRFAGKFP 680
            I  N F+G+FP
Sbjct: 320 SIYRNNFSGEFP 331



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  +  I L++++++G +P E+G L +L   H+ +N   G IPK+ KN   L +L+++ 
Sbjct: 456 RLTNIERIYLSNNNLSGEIPMEVGDLKELSSLHLENNSLTGFIPKELKNCVKLVDLNLAK 515

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 516 NFLTGEIP 523



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 9/134 (6%)
 Frame = +3

Query: 303 TVDPSLTFE-NDRIRNAYIALQAWK--------QAIISDPRNTTSDWVGSDVCNYTGVFC 455
           TV+    F   +R+ +++  LQ+WK        + I  DP +     +     N +G   
Sbjct: 32  TVEKQALFRFKNRLDDSHNILQSWKPSDSPCVFRGITCDPLSGEVIGISLGNVNLSGTI- 90

Query: 456 APAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL 635
             +P    +  ++++ L  + I+G +P E+    +L V ++ SNR  GTIP     LK L
Sbjct: 91  --SPSISALTKLSTLSLPSNFISGRIPPEIVNCKNLKVLNLTSNRLSGTIP-NLSPLKSL 147

Query: 636 FELDISNNRFAGKF 677
             LDIS N   G+F
Sbjct: 148 EILDISGNFLNGEF 161



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+ +++ G +  ++GL  +L    + +NRF G IP++   L  +  + +SNN  +G+ 
Sbjct: 415 IDLSDNELTGEVSPQIGLSTELSQLILQNNRFSGKIPRELGRLTNIERIYLSNNNLSGEI 474

Query: 678 P 680
           P
Sbjct: 475 P 475



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 21/68 (30%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  +  I+L ++ + G +P E+  L  L  F I+SN+  G +P++   LK L       
Sbjct: 240 RLVNLTKIELFNNSLTGKIPPEIKNLTRLREFDISSNQLSGVLPEELGVLKELRVFHCHE 299

Query: 657 NRFAGKFP 680
           N F G+FP
Sbjct: 300 NNFTGEFP 307



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++ + L ++  +G +P ELG L ++   ++++N   G IP +  +LK L  L + NN   
Sbjct: 436 LSQLILQNNRFSGKIPRELGRLTNIERIYLSNNNLSGEIPMEVGDLKELSSLHLENNSLT 495

Query: 669 GKFP 680
           G  P
Sbjct: 496 GFIP 499



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + + D+ ++ I+   P  +  L +L    + +N   G IP + KNL  L E DIS+N
Sbjct: 217 LNALDTFDIANNAISDDFPILISRLVNLTKIELFNNSLTGKIPPEIKNLTRLREFDISSN 276

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 277 QLSGVLP 283



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG F +   D   +  + S+ +  ++ +G  P  +G  + L    I+ N F G  P+ 
Sbjct: 301 NFTGEFPSGFGD---LSHLTSLSIYRNNFSGEFPVNIGRFSPLDTVDISENEFTGPFPRF 357

Query: 615 F-KNLKILFELDISNNRFAGKFP 680
             +N K+ F L +  N F+G+ P
Sbjct: 358 LCQNKKLQFLLAL-QNEFSGEIP 379



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/79 (25%), Positives = 39/79 (49%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           +TG F      N K++ + ++    ++ +G +P   G    L    IN+NR  G + + F
Sbjct: 350 FTGPFPRFLCQNKKLQFLLALQ---NEFSGEIPRSYGECKSLLRLRINNNRLSGQVVEGF 406

Query: 618 KNLKILFELDISNNRFAGK 674
            +L +   +D+S+N   G+
Sbjct: 407 WSLPLAKMIDLSDNELTGE 425



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +PE +G L  L    +  +   G IP    +L  L   DI+NN  +  FP
Sbjct: 184 GIIPESIGGLKKLTWLFLARSNLTGKIPNSIFDLNALDTFDIANNAISDDFP 235



>gb:AF177673_1774649 Arabidopsis thaliana cultivar Lansberg erecta
           receptor-like protein CLAVATA2 (CLV2) gene, complete
           cds.
          Length = 720

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 19/115 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPA-------------------PDNPKIRTVASIDL 506
           I D   + S W GS   N+TG+ C                      P   K+ ++ S+DL
Sbjct: 45  IHDLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLNLSGQIHPSLCKLSSLQSLDL 104

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +H++  G +P   G L +L   +++ NRF G+IP  F +LK L E+ +S NR  G
Sbjct: 105 SHNNFCGNIPSCFGSLRNLRTLNLSRNRFIGSIPPTFMSLKELGEVVLSENRNLG 159



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+H+ + G +P  +     L    I++N   G I  +   L  L  LDISNN  +G+ 
Sbjct: 368 IDLSHNSLTGSIPLNIVGCFQLLALMISNNNLSGEIQPELDALDSLKILDISNNHISGEI 427

Query: 678 P 680
           P
Sbjct: 428 P 428



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/66 (28%), Positives = 36/66 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++++ ++ L+H+ + G +P  +G L  L V  ++ N   G+IP        L  L ISN
Sbjct: 337 ELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNSLTGSIPLNIVGCFQLLALMISN 396

Query: 657 NRFAGK 674
           N  +G+
Sbjct: 397 NNLSGE 402



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 28/120 (23%), Positives = 57/120 (47%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+   + ++S+ RN       W G    N   V   FC+   + P+    ++++  +
Sbjct: 141 FMSLKELGEVVLSENRNLGGVVPHWFGDFSMNLERVDLSFCSFVGELPESLLYLKSLKYL 200

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SNRF GT+P  + +   L  L+++ N   G  P
Sbjct: 201 NLESNNMTGTLRD---FQQPLVVLNLASNRFSGTLPCFYASRPSLSVLNLAENSLVGGLP 257



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/67 (23%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++  +D++ ++++G L E +   ++L    +  N+F GT+P        +  +D S+N
Sbjct: 434 LKSLEIVDISSNNLSGNLNEAITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSN 493

Query: 660 RFAGKFP 680
           RF+   P
Sbjct: 494 RFSWFIP 500



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/65 (29%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ ++L  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 241 SLSVLNLAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLVFSEKLVMLDLSHNGF 300

Query: 666 AGKFP 680
           +G+ P
Sbjct: 301 SGRLP 305



>pir|T02361|T02361 hypothetical protein T8F5.16 - Arabidopsis
           thaliana>gb:AE005173_894191 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AY065442_1566548 Arabidopsis thaliana
           unknown protein (At1g65380) mRNA, complete
           cds.>gb:AY096537_1576079 Arabidopsis thaliana unknown
           protein (At1g65380) mRNA, complete cds.>gb:T8F5_1724151
           Arabidopsis thaliana chromosome 1 BAC T8F5 sequence,
           complete sequence.>gb:AF177672_1774648 Arabidopsis
           thaliana cultivar Columbia receptor-like protein
           CLAVATA2 (CLV2) gene, complete cds.
          Length = 720

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 19/115 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPA-------------------PDNPKIRTVASIDL 506
           I D   + S W GS   N+TG+ C                      P   K+ ++ S+DL
Sbjct: 45  IHDLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLNLSSQIHPSLCKLSSLQSLDL 104

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +H++ +G +P   G L +L   +++ NRF G+IP  F +LK L E+ +S NR  G
Sbjct: 105 SHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSLKELREVVLSENRDLG 159



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/66 (28%), Positives = 36/66 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++++ ++ L+H+ + G +P  +G L  L V  ++ N   G+IP        L  L ISN
Sbjct: 337 ELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQLLALMISN 396

Query: 657 NRFAGK 674
           N  +G+
Sbjct: 397 NNLSGE 402



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+H+ + G +P  +     L    I++N   G I  +   L  L  LDISNN  +G+ 
Sbjct: 368 IDLSHNALTGSIPLNIVGCFQLLALMISNNNLSGEIQPELDALDSLKILDISNNHISGEI 427

Query: 678 P 680
           P
Sbjct: 428 P 428



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/67 (23%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++  +D++ ++++G L E +   ++L    +  N+F GT+P        +  +D S+N
Sbjct: 434 LKSLEIVDISSNNLSGNLNEAITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSN 493

Query: 660 RFAGKFP 680
           RF+   P
Sbjct: 494 RFSWFIP 500



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 27/120 (22%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G+   N   V   FC+   + P+    ++++  +
Sbjct: 141 FVSLKELREVVLSENRDLGGVVPHWFGNFSMNLERVDFSFCSFVGELPESLLYLKSLKYL 200

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   G  P
Sbjct: 201 NLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLP 257



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 241 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 300

Query: 666 AGKFP 680
           +G+ P
Sbjct: 301 SGRLP 305



>gb:AC121364_1740170 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0052E20, complete
           sequence.>gb:AC135423_1742305 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0015C02, complete
           sequence.
          Length = 624

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 37/111 (33%), Positives = 62/111 (55%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           +AL  +K+ I +DP +   DW   +   C++ GV C+   D+ +   V +++L +  + G
Sbjct: 32  VALMRFKEMIDADPFDALLDWDEGNASPCSWFGVECS---DDGR---VVALNLPNLGLKG 85

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            LP+E+G LA +    +++N F G IP + K L  L  LD+  N F+G FP
Sbjct: 86  MLPQEIGTLAHMRSIILHNNSFYGIIPTEMKYLHELKVLDLGYNTFSGPFP 136



>gb:OSJN00195_1696530 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0015G09, complete sequence.
          Length = 210

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 39/127 (30%), Positives = 58/127 (45%), Gaps = 1/127 (0%)
 Frame = +3

Query: 303 TVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW-VGSDVCNYTGVFCAPAPDNPK 479
           T+ PS    ++R      AL  +KQ+I +DP    S W +    C + GV C        
Sbjct: 46  TITPSSAQPSNRSETDLQALLCFKQSITNDPTGAFSSWNISLHFCRWNGVTCG----RTS 101

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
              V SI+L    ++G LP  +G L  L    ++ N   GTIP+       L EL++S N
Sbjct: 102 PAHVVSINLTSMKLSGVLPACMGNLTSLQTLVLDRNNLEGTIPESLARSLSLIELNLSRN 161

Query: 660 RFAGKFP 680
             +G+ P
Sbjct: 162 FLSGQIP 168



>gb:BT003880_1637007 Arabidopsis thaliana clone RAFL15-22-I19
           (R20597) putative leucine-rich repeat transmembrane
           protein kinase (At5g46330) mRNA, complete cds.
          Length = 1173

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 21/129 (16%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDW--VGS-DVCNYTGVFCAP------------------APDN 473
           AL+++K  I +DP    SDW  +GS   CN+TG+ C                    +P  
Sbjct: 33  ALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAI 92

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
             +  +  +DL  +   G +P E+G L +L    +  N F G+IP     LK +F LD+ 
Sbjct: 93  ANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLR 152

Query: 654 NNRFAGKFP 680
           NN  +G  P
Sbjct: 153 NNLLSGDVP 161



 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 34/133 (25%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP----------KIRTVASIDLNHDDIAGYL 533
           IS  RN  +  +  D+ N + +      DN           K++ +  + ++++ + G +
Sbjct: 436 ISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPI 495

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNL------------------------KILFE 641
           P E+G L DL + +++SN F G IP++  NL                        K+L  
Sbjct: 496 PREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSV 555

Query: 642 LDISNNRFAGKFP 680
           LD+SNN+F+G+ P
Sbjct: 556 LDLSNNKFSGQIP 568



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 20/67 (29%), Positives = 42/67 (62%), Gaps = 1/67 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + V ++D + ++++G++P+E+    D+ +  +++ N F G IP+ F N+  L  LD+S+N
Sbjct: 673 KNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSN 732

Query: 660 RFAGKFP 680
              G+ P
Sbjct: 733 NLTGEIP 739



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG F     +   +R +  + +  ++I+G LP +LGLL +L     + N   G IP  
Sbjct: 347 NFTGEFPQSITN---LRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSS 403

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N   L  LD+S+N+  G+ P
Sbjct: 404 ISNCTGLKLLDLSHNQMTGEIP 425



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K  ++  I  +++++ G +PE LG L  L +F    N   G+IP     L  L +LD+S 
Sbjct: 166 KTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSG 225

Query: 657 NRFAGKFP 680
           N+  GK P
Sbjct: 226 NQLTGKIP 233



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDNP-KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P+    ++ ++ +DL+++  +G +P     L  L    +  N+F G+IP  
Sbjct: 535 YSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPAS 594

Query: 615 FKNLKILFELDISNNRFAGKFP 680
            K+L +L   DIS+N   G  P
Sbjct: 595 LKSLSLLNTFDISDNLLTGTIP 616



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  +  + L+ + + G + EE+G L  L V  ++SN F G  P+   NL+ L  L +  
Sbjct: 310 RLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGF 369

Query: 657 NRFAGKFP 680
           N  +G+ P
Sbjct: 370 NNISGELP 377



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++ +++ + G +P+ELG L  +    +++N F G+IP+  +  K +F LD S N  +G  
Sbjct: 630 LNFSNNLLTGTIPKELGKLEMVKEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHI 689

Query: 678 P 680
           P
Sbjct: 690 P 690



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  ++L  + + G +P ELG L  L    I  N+   +IP     L  L  L +S N  
Sbjct: 265 SLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHL 324

Query: 666 AG 671
            G
Sbjct: 325 VG 326



>gb:AB010698_1511224 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 1173

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 21/129 (16%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDW--VGS-DVCNYTGVFCAP------------------APDN 473
           AL+++K  I +DP    SDW  +GS   CN+TG+ C                    +P  
Sbjct: 33  ALKSFKNGISNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAI 92

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
             +  +  +DL  +   G +P E+G L +L    +  N F G+IP     LK +F LD+ 
Sbjct: 93  ANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLR 152

Query: 654 NNRFAGKFP 680
           NN  +G  P
Sbjct: 153 NNLLSGDVP 161



 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 34/133 (25%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP----------KIRTVASIDLNHDDIAGYL 533
           IS  RN  +  +  D+ N + +      DN           K++ +  + ++++ + G +
Sbjct: 436 ISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPI 495

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNL------------------------KILFE 641
           P E+G L DL + +++SN F G IP++  NL                        K+L  
Sbjct: 496 PREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSV 555

Query: 642 LDISNNRFAGKFP 680
           LD+SNN+F+G+ P
Sbjct: 556 LDLSNNKFSGQIP 568



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 20/67 (29%), Positives = 42/67 (62%), Gaps = 1/67 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + V ++D + ++++G++P+E+    D+ +  +++ N F G IP+ F N+  L  LD+S+N
Sbjct: 673 KNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSN 732

Query: 660 RFAGKFP 680
              G+ P
Sbjct: 733 NLTGEIP 739



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG F     +   +R +  + +  ++I+G LP +LGLL +L     + N   G IP  
Sbjct: 347 NFTGEFPQSITN---LRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSS 403

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N   L  LD+S+N+  G+ P
Sbjct: 404 ISNCTGLKLLDLSHNQMTGEIP 425



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/68 (33%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K  ++  I  +++++ G +PE LG L  L +F    N   G+IP     L  L +LD+S 
Sbjct: 166 KTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSG 225

Query: 657 NRFAGKFP 680
           N+  GK P
Sbjct: 226 NQLTGKIP 233



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDNP-KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P+    ++ ++ +DL+++  +G +P     L  L    +  N+F G+IP  
Sbjct: 535 YSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPAS 594

Query: 615 FKNLKILFELDISNNRFAGKFP 680
            K+L +L   DIS+N   G  P
Sbjct: 595 LKSLSLLNTFDISDNLLTGTIP 616



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  +  + L+ + + G + EE+G L  L V  ++SN F G  P+   NL+ L  L +  
Sbjct: 310 RLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGF 369

Query: 657 NRFAGKFP 680
           N  +G+ P
Sbjct: 370 NNISGELP 377



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++ +++ + G +P+ELG L  +    +++N F G+IP+  +  K +F LD S N  +G  
Sbjct: 630 LNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHI 689

Query: 678 P 680
           P
Sbjct: 690 P 690



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 18/62 (29%), Positives = 28/62 (45%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  ++L  + + G +P ELG L  L    I  N+   +IP     L  L  L +S N  
Sbjct: 265 SLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHL 324

Query: 666 AG 671
            G
Sbjct: 325 VG 326



>pir|B84431|B84431 probable receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC006532_1534365 Arabidopsis
           thaliana chromosome 2 clone F14H20 map CIC11A04,
           complete sequence.>gb:AY074313_1567471 Arabidopsis
           thaliana putative receptor protein kinase (At2g01950)
           mRNA, complete cds.
          Length = 1143

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 25/61 (40%), Positives = 39/61 (63%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+H+ ++G +P  +G L +LGVF  + NR  G IP+ F NL  L ++D+SNN   G  
Sbjct: 640 LELSHNQLSGEIPFTIGQLKNLGVFDASDNRLQGQIPESFSNLSFLVQIDLSNNELTGPI 699

Query: 678 P 680
           P
Sbjct: 700 P 700



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           +++ + S+DL+H+ + G++P E+G     L    ++ N F G IP+   +   L  LD+S
Sbjct: 250 ELKLLQSLDLSHNRLTGWIPPEIGDTCRSLQNLRLSYNNFTGVIPESLSSCSWLQSLDLS 309

Query: 654 NNRFAGKFP 680
           NN  +G FP
Sbjct: 310 NNNISGPFP 318



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D + + I+GY+ + L    +L   +++ N F G IPK F  LK+L  LD+S+NR  G  
Sbjct: 209 LDFSGNSISGYISDSLINCTNLKSLNLSYNNFDGQIPKSFGELKLLQSLDLSHNRLTGWI 268

Query: 678 P 680
           P
Sbjct: 269 P 269



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 34/126 (26%), Positives = 53/126 (42%)
 Frame = +3

Query: 303 TVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKI 482
           T+D SL + N  I      LQ  +Q I          W       Y  +     P+  K+
Sbjct: 403 TIDLSLNYLNGTIPPEIGNLQKLEQFIA---------W-------YNNIAGEIPPEIGKL 446

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           + +  + LN++ + G +P E    +++      SNR  G +PK F  L  L  L + NN 
Sbjct: 447 QNLKDLILNNNQLTGEIPPEFFNCSNIEWVSFTSNRLTGEVPKDFGILSRLAVLQLGNNN 506

Query: 663 FAGKFP 680
           F G+ P
Sbjct: 507 FTGEIP 512



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +    + + G +P++ G+L+ L V  + +N F G IP +      L  LD++ N   G+ 
Sbjct: 476 VSFTSNRLTGEVPKDFGILSRLAVLQLGNNNFTGEIPPELGKCTTLVWLDLNTNHLTGEI 535

Query: 678 P 680
           P
Sbjct: 536 P 536



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 2/84 (2%)
 Frame = +3

Query: 435 NYTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEE-LGLLADLGVFHINSNRFCGTIP 608
           N+TGV     P++      + S+DL++++I+G  P   L     L +  +++N   G  P
Sbjct: 288 NFTGVI----PESLSSCSWLQSLDLSNNNISGPFPNTILRSFGSLQILLLSNNLISGDFP 343

Query: 609 KKFKNLKILFELDISNNRFAGKFP 680
                 K L   D S+NRF+G  P
Sbjct: 344 TSISACKSLRIADFSSNRFSGVIP 367



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 34/149 (22%), Positives = 57/149 (38%), Gaps = 27/149 (18%)
 Frame = +3

Query: 315 SLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW-VGSDVCNYTGVFCAPAPDNPKIRTV 491
           S + +   ++   ++L ++K  I  DP N  S+W      C ++GV C           V
Sbjct: 28  SSSSDQSSLKTDSLSLLSFKTMIQDDPNNILSNWSPRKSPCQFSGVTCLGG-------RV 80

Query: 492 ASIDLNHDDIAG-----------------------YLPEELGLLADLGVFH--INSNRFC 596
             I+L+   ++G                        L     LL  L + H  ++S+   
Sbjct: 81  TEINLSGSGLSGIVSFNAFTSLDSLSVLKLSENFFVLNSTSLLLLPLTLTHLELSSSGLI 140

Query: 597 GTIPKK-FKNLKILFELDISNNRFAGKFP 680
           GT+P+  F     L  + +S N F GK P
Sbjct: 141 GTLPENFFSKYSNLISITLSYNNFTGKLP 169



>sp|Q8L899|BRI1_LYCPE Systemin receptor SR160 precursor (EC
           2.7.1.37) (Brassinosteroid LRR receptor
           kinase).>gb:AY112661_1578149 Lycopersicon peruvianum
           systemin receptor SR160 mRNA, complete cds.
          Length = 1207

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 24/61 (39%), Positives = 42/61 (68%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L H+D++G +P++LG L ++ +  ++ NRF GTIP    +L +L E+D+SNN  +G  
Sbjct: 692 LNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMI 751

Query: 678 P 680
           P
Sbjct: 752 P 752



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +3

Query: 432 CNYTGVFCA-PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           CN+T V+     P      ++  +DL+++ + G +P+ELG +  L + ++  N   G IP
Sbjct: 645 CNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIP 704

Query: 609 KKFKNLKILFELDISNNRFAGKFP 680
           ++   LK +  LD+S NRF G  P
Sbjct: 705 QQLGGLKNVAILDLSYNRFNGTIP 728



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 23/70 (32%), Positives = 40/70 (57%), Gaps = 4/70 (5%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP----KKFKNLKILFELDI 650
           +TV  +DL++++ +G +PE LG  + L +  I++N F G +P     K  N+K +    +
Sbjct: 328 KTVVELDLSYNNFSGMVPESLGECSSLELVDISNNNFSGKLPVDTLLKLSNIKTMV---L 384

Query: 651 SNNRFAGKFP 680
           S N+F G  P
Sbjct: 385 SFNKFVGGLP 394



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 447 VFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
           +F  P PD+      + S+DL+ + + G +P  LG L+ L    +  N+  G IP++   
Sbjct: 438 LFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMY 497

Query: 624 LKILFELDISNNRFAGKFP 680
           L+ L  L +  N   G  P
Sbjct: 498 LQALENLILDFNDLTGPIP 516



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + ++G +P+EL  L  L    ++ N   G IP    N   L  + +SNN+ +G+ P
Sbjct: 485 NQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIP 540



>sp|Q8GUQ5|BRI1_LYCES Brassinosteroid LRR receptor kinase precursor
           (EC 2.7.1.37) (tBRI1) (Altered brassinolide sensitivity
           1) (Systemin receptor SR160).>gb:AY179606_1587457
           Lycopersicon esculentum BRI1 protein (CURL3) gene,
           complete cds.
          Length = 1207

 Score = 59.7 bits (143), Expect = 5e-08
 Identities = 24/61 (39%), Positives = 42/61 (68%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L H+D++G +P++LG L ++ +  ++ NRF GTIP    +L +L E+D+SNN  +G  
Sbjct: 692 LNLGHNDLSGMIPQQLGGLKNVAILDLSYNRFNGTIPNSLTSLTLLGEIDLSNNNLSGMI 751

Query: 678 P 680
           P
Sbjct: 752 P 752



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 1/84 (1%)
 Frame = +3

Query: 432 CNYTGVFCA-PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           CN+T V+     P      ++  +DL+++ + G +P+ELG +  L + ++  N   G IP
Sbjct: 645 CNFTRVYRGITQPTFNHNGSMIFLDLSYNKLEGSIPKELGAMYYLSILNLGHNDLSGMIP 704

Query: 609 KKFKNLKILFELDISNNRFAGKFP 680
           ++   LK +  LD+S NRF G  P
Sbjct: 705 QQLGGLKNVAILDLSYNRFNGTIP 728



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 4/70 (5%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP----KKFKNLKILFELDI 650
           +TV  +DL++++ +G +PE LG  + L +  I+ N F G +P     K  N+K +    +
Sbjct: 328 KTVVELDLSYNNFSGMVPESLGECSSLELVDISYNNFSGKLPVDTLSKLSNIKTMV---L 384

Query: 651 SNNRFAGKFP 680
           S N+F G  P
Sbjct: 385 SFNKFVGGLP 394



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLP-EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D+++++ +G LP + L  L+++    ++ N+F G +P  F NL  L  LD+S+N   G 
Sbjct: 357 VDISYNNFSGKLPVDTLSKLSNIKTMVLSFNKFVGGLPDSFSNLLKLETLDMSSNNLTGV 416

Query: 675 FP 680
            P
Sbjct: 417 IP 418



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 447 VFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
           +F  P PD+      + S+DL+ + + G +P  LG L+ L    +  N+  G IP++   
Sbjct: 438 LFKGPIPDSLSNCSQLVSLDLSFNYLTGSIPSSLGSLSKLKDLILWLNQLSGEIPQELMY 497

Query: 624 LKILFELDISNNRFAGKFP 680
           L+ L  L +  N   G  P
Sbjct: 498 LQALENLILDFNDLTGPIP 516



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/56 (30%), Positives = 29/56 (51%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + ++G +P+EL  L  L    ++ N   G IP    N   L  + +SNN+ +G+ P
Sbjct: 485 NQLSGEIPQELMYLQALENLILDFNDLTGPIPASLSNCTKLNWISLSNNQLSGEIP 540



>gb:BT010407_1640353 Arabidopsis thaliana At3g43740 mRNA, complete
           cds.>gb:AK175133_1817121 Arabidopsis thaliana mRNA,
           complete cds, clone: RAFL21-55-C11.>gb:AK175524_1817512
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-94-I24.>gb:AK176628_1818616 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL25-16-M13.>gb:AK176756_1818744 Arabidopsis thaliana
           mRNA, complete cds, clone: RAFL25-29-M07.
          Length = 218

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ SDP N    W  + V  C +  V C       +   V  +DL + +++G+
Sbjct: 33  ALHALRRSL-SDPDNVVQSWDPTLVNPCTWFHVTCN------QHHQVTRLDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   GK P
Sbjct: 86  LVPELGKLEHLQYLELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIP 135



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+DL ++++ G +P  LG L  L    +N NR  G IP++   +  L  +D+S N
Sbjct: 117 LKSLISLDLYNNNLTGKIPSSLGKLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGN 176

Query: 660 RFAGKFP 680
              G  P
Sbjct: 177 DLCGTIP 183



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 15/44 (34%), Positives = 28/44 (63%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++++  + LN + + G +P EL +++ L V  ++ N  CGTIP
Sbjct: 140 KLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGNDLCGTIP 183



>gb:AY530952_1611931 Zea mays unknown (Z576C20.2), putative heme
           oxygenase 1 (Z576C20.3), anthocyanin biosynthesis
           regulatory protein Pl1_B73 (Z576C20.4), putative
           growth-regulating factor 1 (Z576C20.6), and putative
           aminoalcoholphosphotransferase (Z576C20.14) genes,
           complete cds; and putative receptor protein kinase
           (Z576C20.21) gene, partial cds.
          Length = 207

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/94 (34%), Positives = 46/94 (48%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHI 578
           N   DW G D C++ GV C    DN     VA++DL  + ++G +P+E+G  + L     
Sbjct: 107 NVLYDWAGDDYCSWRGVLC----DNVTF-AVAALDLKSNGLSGQIPDEIGDCSSLRTLDF 161

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + N   G IP     LK L  L + NN+  G  P
Sbjct: 162 SFNNLDGDIPFSISKLKHLENLILKNNQLIGAIP 195



>gb:AC073395_1541016 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543114 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.
          Length = 943

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 22/118 (18%)
 Frame = +3

Query: 393 PRNTTSDWVG-SDVCNYTGVFCAPAPDNP---------------------KIRTVASIDL 506
           P  TT  W   SD CN+ G+ C                            +++ +  +DL
Sbjct: 73  PHPTTESWRNNSDCCNWEGITCDTKSGEVIELDLSCSWLYGSFHSNSSLFRLQNLRVLDL 132

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             +D+ G +P  +G L+ L   H++ N+F G IP   +NL  L  L +S+N+F+G+ P
Sbjct: 133 TQNDLDGEIPSSIGNLSHLTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIP 190



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 22/64 (34%), Positives = 39/64 (60%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+ L+++   G +P  +  L+ L   H++SN+F G IP    NL  L  L++S+N+F+
Sbjct: 151 LTSLHLSYNQFLGLIPSSIENLSRLTSLHLSSNQFSGQIPSSIGNLSHLTSLELSSNQFS 210

Query: 669 GKFP 680
           G+ P
Sbjct: 211 GQIP 214



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++D + +   G +P+ +GLL +L V ++++N F G IP    NL  L  LD+S N+  G+
Sbjct: 758 ALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIPSSMGNLTALESLDVSQNKLTGE 817

Query: 675 FP 680
            P
Sbjct: 818 IP 819



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++++ L+H+   G +P  + LL++L  F  ++N F GT+P    N+  L  LD+S+N+  
Sbjct: 295 LSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTLPSSLFNIPPLIRLDLSDNQLN 354

Query: 669 G 671
           G
Sbjct: 355 G 355



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L++++  G +P   G L  L V  ++SN+  G +P    NL  L  L +S+N+F G  P
Sbjct: 252 LSYNNFVGEIPSSFGNLNQLIVLQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIP 310



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + ++ + ++G +P  L  L  L    ++ N+F GTIP     L  L + + SNN F G  
Sbjct: 274 LQVDSNKLSGNVPISLLNLTRLSALLLSHNQFTGTIPNNISLLSNLMDFEASNNAFTGTL 333

Query: 678 P 680
           P
Sbjct: 334 P 334



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+D+ H+ + G LP  L   ++L V ++ SNR   T P    +L  L  L + +N F
Sbjct: 617 SLRSLDVGHNLLVGKLPRSLIRFSNLEVLNVESNRINDTFPFWLSSLSKLQVLVLRSNAF 676

Query: 666 AG 671
            G
Sbjct: 677 HG 678



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/52 (36%), Positives = 25/52 (48%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G   E + +L        + N+F G IPK    LK L  L++SNN F G  P
Sbjct: 744 GLAMELVRILTIYTALDFSGNKFEGEIPKSIGLLKELLVLNLSNNAFGGHIP 795



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  +++ S+ L+   I  + PE L    +LG   +++N+  G +P     L  LF L++
Sbjct: 464 DPPSQSIQSLYLSGCGITDF-PEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNL 522

Query: 651 SNNRF 665
           SNN F
Sbjct: 523 SNNTF 527



>gb:CQ768541_1451788 Sequence 36 from Patent WO2004007712.
          Length = 213

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ SDP N    W  + V  C +  V C       +   V  +DL + +++G+
Sbjct: 33  ALHALRRSL-SDPDNVVQSWDPTLVNPCTWFHVTCN------QHHQVTRLDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   GK P
Sbjct: 86  LVPELGKLEHLQYLELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIP 135



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+DL ++++ G +P  LG L  L     N NR  G IP++   +  L  +D+S N
Sbjct: 117 LKSLISLDLYNNNLTGKIPSSLGKLKRL-----NENRLTGPIPRELTVISSLKVVDVSGN 171

Query: 660 RFAGKFP 680
              G  P
Sbjct: 172 DLCGTIP 178



>gb:AE016959_1020675 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078891_1541546
           Oryza sativa chromosome 10 clone OSJNBa0092N12, complete
           sequence.>gb:AC098694_1736838 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OJ1014H12, complete
           sequence.>gb:AE017050_1750494 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 4 of 77 of the
           complete sequence.
          Length = 1110

 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 26/61 (42%), Positives = 39/61 (63%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL  +++ G +P  LG L +LGVF ++ NR  G IP  F NL  L ++DIS+N  +G+ 
Sbjct: 621 LDLARNNLTGEIPASLGRLRNLGVFDVSRNRLQGGIPDSFSNLSFLVQIDISDNNLSGEI 680

Query: 678 P 680
           P
Sbjct: 681 P 681



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + I G +  E G L+ L V  + +N   G IP++  N   L  LD+++NR  G+ 
Sbjct: 457 VSLTSNQITGTIRPEFGRLSRLAVLQLANNSLAGEIPRELGNCSSLMWLDLNSNRLTGEI 516

Query: 678 P 680
           P
Sbjct: 517 P 517



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D  + R + ++ LN++ I G +P EL     L    + SN+  GTI  +F  L  L  L 
Sbjct: 423 DLGQCRNLRTLILNNNFIGGDIPVELFNCTGLEWVSLTSNQITGTIRPEFGRLSRLAVLQ 482

Query: 648 ISNNRFAGKFP 680
           ++NN  AG+ P
Sbjct: 483 LANNSLAGEIP 493



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 2/84 (2%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG--LLADLGVFHINSNRFCGTIP 608
           +Y G+  A       I  +  +D++ + + G +P  LG    A L V  ++SN   G+IP
Sbjct: 216 SYNGLAGAIPEGIGAIAGLEVLDVSWNHLTGAIPPGLGRNACASLRVLRVSSNNISGSIP 275

Query: 609 KKFKNLKILFELDISNNRFAGKFP 680
           +   +   L  LD++NN  +G  P
Sbjct: 276 ESLSSCHALRLLDVANNNVSGGIP 299



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 402 TTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHIN 581
           T  +WV       TG      P+  ++  +A + L ++ +AG +P ELG  + L    +N
Sbjct: 452 TGLEWVSLTSNQITGTI---RPEFGRLSRLAVLQLANNSLAGEIPRELGNCSSLMWLDLN 508

Query: 582 SNRFCGTIPKK 614
           SNR  G IP++
Sbjct: 509 SNRLTGEIPRR 519



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+A +DL+ +   G +P  L   A L   +++ N   G IP+    +  L  LD+S N  
Sbjct: 185 TLAVLDLSGNRFTGAIPPSLSGCAGLTTLNLSYNGLAGAIPEGIGAIAGLEVLDVSWNHL 244

Query: 666 AGKFP 680
            G  P
Sbjct: 245 TGAIP 249



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 34/119 (28%), Positives = 48/119 (40%), Gaps = 11/119 (9%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL  +K  +  DPR   S WV    C + GV C     N   R V  +DL    +AG   
Sbjct: 27  ALLRFKAFVHKDPRGVLSSWVDPGPCRWRGVTC-----NGDGR-VTELDLAAGGLAG--R 78

Query: 537 EELGLLADL-----------GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            EL  L+ L           G  H+++           K  + L +LD+S+   AG+ P
Sbjct: 79  AELAALSGLDTLCRLNLSGNGELHVDAGDL-------VKLPRALLQLDLSDGGLAGRLP 130



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 25/86 (29%), Positives = 42/86 (48%), Gaps = 1/86 (1%)
 Frame = +3

Query: 426 DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI 605
           DV N       PA     +  V S+ L+++ I+G LP+ +    +L V  ++SN+  G +
Sbjct: 288 DVANNNVSGGIPAAVLGNLTAVESLLLSNNFISGSLPDTIAHCKNLRVADLSSNKISGAL 347

Query: 606 PKKFKNL-KILFELDISNNRFAGKFP 680
           P +  +    L EL + +N  AG  P
Sbjct: 348 PAELCSPGAALEELRLPDNLVAGTIP 373



>gb:AX120067_1461713 Sequence 50 from Patent WO0129240.
          Length = 573

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 33/101 (32%), Positives = 52/101 (51%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           + DP    ++W     D C++  + C+P  DN     V  + L +++I+G +P ELG L 
Sbjct: 40  LHDPHGALNNWDEFSVDPCSWAMITCSP--DN----LVIGLSLQNNNISGKIPPELGFLP 93

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L    +++NRF G IP     L  L  L ++NN  +G FP
Sbjct: 94  KLQTLDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFP 134



>pir|T07079|T07079 leucine-rich repeat protein LRP -
           tomato>gb:LELRPGENE_1684365 L.esculentum LRP gene.
          Length = 221

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ SDP N    W  + V  C +  V C    DN     V  +DL +  ++G+
Sbjct: 36  ALYALRRSL-SDPGNVLQSWDPNLVNPCTWFHVTCNG--DNQ----VTRVDLGNSKLSGH 88

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIPK+  NLK L  LD+ NN  +G  P
Sbjct: 89  LVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIP 138



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+DL +++I+G +P  LG L +L    +N N+  G IP++  ++  L  +D+SNN
Sbjct: 120 LKSLISLDLYNNNISGTIPTSLGNLKNLVFLRLNDNKLTGPIPRELTSISSLKVVDVSNN 179

Query: 660 RFAGKFP 680
              G  P
Sbjct: 180 DLCGTIP 186



>pir|H84421|H84421 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006200_1533560 Arabidopsis
           thaliana chromosome 2 clone F10A8 map rga, complete
           sequence.
          Length = 716

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 2/107 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSD--VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL  +KQ++  DP  + ++W  SD   C++ GV C       K   V S+ +   ++ G 
Sbjct: 27  ALLTFKQSVHDDPTGSLNNWNSSDENACSWNGVTC-------KELRVVSLSIPRKNLYGS 79

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           LP  LG L+ L   ++ SNRF G++P +  +L+ L  L +  N F G
Sbjct: 80  LPSSLGFLSSLRHLNLRSNRFYGSLPIQLFHLQGLQSLVLYGNSFDG 126



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 3/77 (3%)
 Frame = +3

Query: 459 PAPDN--PKIRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLK 629
           P PD       ++  +DL  +   G +P ++G L++L G    + N F G+IP    +L 
Sbjct: 175 PLPDGFGSAFVSLEKLDLAFNQFNGSIPSDIGNLSNLQGTADFSHNHFTGSIPPALGDLP 234

Query: 630 ILFELDISNNRFAGKFP 680
               +D++ N  +G  P
Sbjct: 235 EKVYIDLTFNNLSGPIP 251



>gb:AP005846_1858989 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1307A11.
          Length = 1163

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 27/75 (36%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVF-HINSNRFCGTIPKKFKNLKIL 635
           P P + K  T+  ID+ H+ ++G +P E+ L++ L  F +  SN F G++P +  NLK +
Sbjct: 604 PLPSDLKNCTLEKIDIQHNMLSGPIPREVFLISTLSDFMYFQSNMFSGSLPLEISNLKNI 663

Query: 636 FELDISNNRFAGKFP 680
            ++D SNN+ +G+ P
Sbjct: 664 ADIDFSNNQISGEIP 678



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 3/113 (2%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRNTTSDWVGSD---VCNYTGVFCAPAPDNPKIRTVASIDLNHDDI 521
           ++AL A+K  I  DP +  + W G+    VC + GV C       + R VA +DL++ D+
Sbjct: 33  HLALMAFKSQITRDPSSAMASWGGNQSLHVCQWRGVTCG-IQGRCRGRVVA-LDLSNLDL 90

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +G +   +G L  L    +  N   GTIP +   L  L  +++S N   G  P
Sbjct: 91  SGTIDPSIGNLTYLRKLDLPVNHLTGTIPSELGRLLDLQHVNLSYNSLQGGIP 143



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +A ID +++ I+G +P  +G    L  F I  N   G IP     LK L  LD+S+N
Sbjct: 660 LKNIADIDFSNNQISGEIPPSIGDCQSLQYFKIQGNFLQGPIPASVSRLKGLQVLDLSHN 719

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 720 NFSGDIP 726



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ ++  ++L ++ +AG +P E+G L  L    ++ N   G++P    NL+ +  L +  
Sbjct: 196 KLGSLEVLNLYNNSLAGSIPSEIGNLTSLVSLILSYNHLTGSVPSSLGNLQRIKNLQLRG 255

Query: 657 NRFAGKFP 680
           N+ +G  P
Sbjct: 256 NQLSGPVP 263



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + I+G +PE +G L +L    +++N F G IP     L  L  LD+  N   G+ P
Sbjct: 524 LSENMISGKIPEGIGNLVNLLYLFMSNNSFEGNIPSSLGTLWKLSHLDLGFNNLLGQIP 582



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLA-DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D + +   G LP  +  L+ +L  F ++ N   G IP+   NL  L  L +SNN F G 
Sbjct: 497 LDFSSNKFRGTLPNAVANLSTNLKAFALSENMISGKIPEGIGNLVNLLYLFMSNNSFEGN 556

Query: 675 FP 680
            P
Sbjct: 557 IP 558



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 18/67 (26%), Positives = 30/67 (44%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  + L  + + G +PE L  L  L    +  N   G+IP    NL  L +L +  N
Sbjct: 316 LSSLVYLSLGGNRLTGGIPESLAKLEKLSGLVLAENNLTGSIPPSLGNLHSLTDLYLDRN 375

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 376 QLTGYIP 382



>gb:AP005846_1858988 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1307A11.
          Length = 1160

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWV--GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A+K+ +  DP      W    + +C + GV C  A    + R VA +DL    IAG 
Sbjct: 53  ALMAFKKLVSGDPSQALESWGDGSTPLCRWRGVSCGVAAGRRRGRVVA-LDLAGAGIAGE 111

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +   LG L  L   H+  NR  G +P +   L  L  L++S+N  AG+ P
Sbjct: 112 VSPALGNLTHLRRLHLPENRLHGALPWQLGRLGELRHLNLSHNSIAGRIP 161



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 23/62 (37%), Positives = 43/62 (69%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVF-HINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL++++++G +P+EL L++ +  F ++  N+  G +P +  NLK L ELD+S+N  +GK
Sbjct: 614 VDLSYNNLSGPIPKELFLISTISSFLYLAHNKLTGNLPSEVGNLKNLDELDLSDNTISGK 673

Query: 675 FP 680
            P
Sbjct: 674 IP 675



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + +++I G +PE +G L +L    + +N   G++P    NLK L  L +SNN F+G  P
Sbjct: 521 ITNNNITGTIPESIGNLVNLDELDMENNLLMGSLPASLGNLKKLNRLSLSNNNFSGSIP 579



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLA-DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ID++ + + G LP+ +G ++  L  F I +N   GTIP+   NL  L ELD+ NN   G 
Sbjct: 494 IDVSINKLQGVLPKAIGNMSTQLEYFGITNNNITGTIPESIGNLVNLDELDMENNLLMGS 553

Query: 675 FP 680
            P
Sbjct: 554 LP 555



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 22/67 (32%), Positives = 32/67 (47%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++ ++DL  +   G +PE LG L  L    +  N+    IP  F NL  L EL + NN
Sbjct: 312 LSSLTALDLQSNGFVGCIPESLGDLQFLEAISLADNKLRCRIPDSFGNLHELVELYLDNN 371

Query: 660 RFAGKFP 680
              G  P
Sbjct: 372 ELEGSLP 378



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  +DL+ + I+G +P  +G    L   +++ N    TIP   + L+ L  LD+S N
Sbjct: 657 LKNLDELDLSDNTISGKIPTTIGECQSLQYLNLSRNFIEDTIPPSLEQLRGLLVLDLSQN 716

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 717 NLSGTIP 723



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+ ++ + G LP  LG L  L    +++N F G+IP    NL  L  L +S N  +G  
Sbjct: 543 LDMENNLLMGSLPASLGNLKKLNRLSLSNNNFSGSIPVTLGNLTKLTILLLSTNALSGAI 602

Query: 678 P 680
           P
Sbjct: 603 P 603



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   ++R +  +DL+ ++++G +P  LG +  L   +++SN F G +PK    L      
Sbjct: 700 PSLEQLRGLLVLDLSQNNLSGTIPRFLGSMTGLSTLNLSSNDFEGEVPKYGIFLNATATS 759

Query: 645 DISNNRFAGKFP 680
            + NN   G  P
Sbjct: 760 VMGNNDLCGGAP 771



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 23/91 (25%), Positives = 36/91 (39%), Gaps = 23/91 (25%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELG-----------------------LLADLGVFHINSN 587
           K+  +  + L+ + ++G +PE +G                        L+ L    + SN
Sbjct: 240 KLGNLTMLSLSSNQLSGSIPESIGNLSALTAIAAFSNNLTGRIPPLERLSSLSYLGLASN 299

Query: 588 RFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              GTIP    NL  L  LD+ +N F G  P
Sbjct: 300 NLGGTIPSWLGNLSSLTALDLQSNGFVGCIP 330



>pir|B84852|B84852 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC005956_1533227 Arabidopsis
           thaliana chromosome 2 clone MHK10 map EG05C12, complete
           sequence.
          Length = 646

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           ++L A K A+ +DP    + W  SD   C+++G+ C     N ++ T+    L    ++G
Sbjct: 29  LSLLALKSAVDNDPTRVMTHWSESDPTPCHWSGIVCT----NGRVTTLV---LFGKSLSG 81

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           Y+P ELGLL  L    +  N F  TIP +      L  +D+S+N  +G  P
Sbjct: 82  YIPSELGLLNSLNRLDLAHNNFSKTIPVRLFEATKLRYIDLSHNSLSGPIP 132



>pir|T02154|T02154 protein kinase homolog T1F15.2 - Arabidopsis
           thaliana>gb:AE005173_894372 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC011020_1537196 Arabidopsis thaliana
           chromosome 1 BAC F12B7 genomic sequence, complete
           sequence.>gb:T1F15_1723568 Arabidopsis thaliana
           chromosome 1 BAC T1F15 sequence, complete sequence.
          Length = 719

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 2/129 (1%)
 Frame = +3

Query: 300 VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDN 473
           +   PSL+   D I     AL + K A+     +  SDW  +D   C+++G+ C    D+
Sbjct: 15  LNTSPSLSLSPDGI-----ALLSLKSAVDHSSSSAFSDWNDNDTDPCHWSGISCMNISDS 69

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
              R V  I L    + GY+P ELG L  L   ++++N   G+IP +  N   L  + + 
Sbjct: 70  STSRVVG-ISLAGKHLRGYIPSELGSLIYLRRLNLHNNELYGSIPTQLFNATSLHSIFLY 128

Query: 654 NNRFAGKFP 680
            N  +G  P
Sbjct: 129 GNNLSGTLP 137



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 23/70 (32%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDI 650
           P++  +A +DL+ ++ +G +P+++G L  L G  +++ N   G IP    NL +   LD+
Sbjct: 190 PELTNLAQLDLSANEFSGEIPKDIGELKSLSGTLNLSFNHLSGQIPNSLGNLPVTVSLDL 249

Query: 651 SNNRFAGKFP 680
            NN F+G+ P
Sbjct: 250 RNNDFSGEIP 259



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-FKNLKILFE 641
           P   K+  + ++DL+ + ++G L  +L     L    +++N F G IP   +  L  L +
Sbjct: 138 PSICKLPKLQNLDLSMNSLSGTLSPDLNKCKQLQRLILSANNFSGEIPGDIWPELTNLAQ 197

Query: 642 LDISNNRFAGKFP 680
           LD+S N F+G+ P
Sbjct: 198 LDLSANEFSGEIP 210



>gb:AC137619_1743655 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0095J22, complete sequence.
          Length = 952

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 44/156 (28%), Positives = 63/156 (40%), Gaps = 48/156 (30%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVC--NYTGVFCAPAPDN------------------- 473
           AL A K +++ DP N   +W   D C  N+TGVFC    D                    
Sbjct: 35  ALMAIKGSLV-DPMNNLKNWNRGDPCTKNWTGVFCHDLGDTYLHVTELQLFRRNLSGNLV 93

Query: 474 -----------------------PK----IRTVASIDLNHDDIAGYLPEELGLLADLGVF 572
                                  PK    I T+  I LN + ++G LP+E+G L  L   
Sbjct: 94  PEVSLLSQLKILDFMWNNLTGNIPKEIGNITTLKLILLNGNQLSGLLPDEIGNLQSLTRL 153

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            ++ N   G IPK F NL+ +  L ++NN  +G+ P
Sbjct: 154 QVDQNHLSGAIPKSFANLRSVKHLHMNNNSLSGQIP 189



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T   +D NH  ++G +P+    L  +   H+N+N   G IP +   L  L  L + NN  
Sbjct: 151 TRLQVDQNH--LSGAIPKSFANLRSVKHLHMNNNSLSGQIPSELSRLNTLLHLLVDNNNL 208

Query: 666 AGKFP 680
           +G  P
Sbjct: 209 SGPLP 213



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R+V  + +N++ ++G +P EL  L  L    +++N   G +P +    K L  L   NN
Sbjct: 171 LRSVKHLHMNNNSLSGQIPSELSRLNTLLHLLVDNNNLSGPLPPELAAAKSLKILQADNN 230

Query: 660 RFAG 671
            F+G
Sbjct: 231 NFSG 234



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT-IPKKFKNLKILFELDIS 653
           ++ T+  + +++++++G LP EL     L +   ++N F G+ IP  + N+  LF+L + 
Sbjct: 194 RLNTLLHLLVDNNNLSGPLPPELAAAKSLKILQADNNNFSGSSIPTLYYNMSGLFKLSLR 253

Query: 654 NNRFAGKFP 680
           N    G  P
Sbjct: 254 NCSLQGAIP 262



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD   I  +  +DL+ + + G +P    L +++    ++ N   GTIP  F  L  L  L
Sbjct: 262 PDLSAIPQLDYLDLSWNQLTGSIPTNK-LASNITTIDLSHNMLNGTIPSNFSGLPYLQLL 320

Query: 645 DISNNRFAGKFP 680
            + NN   G  P
Sbjct: 321 SLKNNLLDGSVP 332



>gb:BT010733_1640679 Arabidopsis thaliana At3g57830 gene, complete
           cds.>gb:AK118626_1816593 Arabidopsis thaliana At3g57830
           mRNA for putative receptor-like protein kinase, complete
           cds, clone: RAFL19-89-A18.
          Length = 662

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           ++L A K AI+ DP    + W  SD   C++ G+ C           V S+ L+   ++G
Sbjct: 30  LSLLALKSAILRDPTRVMTSWSESDPTPCHWPGIICTHG-------RVTSLVLSGRRLSG 82

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           Y+P +LGLL  L    +  N F   +P +  N   L  +D+S+N  +G  P
Sbjct: 83  YIPSKLGLLDSLIKLDLARNNFSKPVPTRLFNAVNLRYIDLSHNSISGPIP 133



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ +  ID + + + G LP+ L  L  L G  +++ N F G IP  +    +   LD+ +
Sbjct: 139 LKNLTHIDFSSNLLNGSLPQSLTQLGSLVGTLNLSYNSFSGEIPPSYGRFPVFVSLDLGH 198

Query: 657 NRFAGKFP 680
           N   GK P
Sbjct: 199 NNLTGKIP 206



>gb:ATF28A21_1550253 Arabidopsis thaliana DNA chromosome 4, BAC
           clone F28A21 (ESSA project).
          Length = 662

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 3/117 (2%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPRNTTSDWVGS---DVCNYTGVFCAPAPDNPKIRTVASIDLN 509
           + N+  AL  ++  + SDP  T ++W  S   D+C ++GV C           V  +DL+
Sbjct: 2   VLNSGSALLKFRARVNSDPHGTLANWNVSGINDLCYWSGVTCVDGK-------VQILDLS 54

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              + G L  EL  L+DL    ++ N F G IPK++ + + L  LD+  N  +G+ P
Sbjct: 55  GYSLEGTLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENLEVLDLRENDLSGQIP 111



>pir|T49292|T49292 hypothetical protein T16L24.60 - Arabidopsis
           thaliana>gb:ATT16L24_1554641 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T16L24.
          Length = 419

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 5/101 (4%)
 Frame = +3

Query: 393 PRNTTSDW-VGSDVCN----YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           P +  S W    D C     + GV C+   +N   R +  IDL+ D   G+L +E+G L 
Sbjct: 61  PSSYLSTWDFSEDPCEGSGTFLGVMCSFPLENTTSRVI-EIDLDDDGYDGFLSDEVGNLT 119

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L V  +N NRF G +P+    L+ L +L ++ N F G  P
Sbjct: 120 ELTVLSLNKNRFRGPVPESVFQLRKLTKLSLAENFFTGDIP 160



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + +IDL+ + IAG +P  +  L  L    +++N   G IP     L  L  L++ N
Sbjct: 165 RLKELKTIDLSKNSIAGEIPPRISALRSLTHLVLSNNHLDGRIP-ALNGLWKLQVLELGN 223

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 224 NHLYGMLP 231



>pir|T46005|T46005 receptor-like protein kinase - Arabidopsis
           thaliana>gb:ATT10K17_1554250 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T10K17.
          Length = 662

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           ++L A K AI+ DP    + W  SD   C++ G+ C           V S+ L+   ++G
Sbjct: 30  LSLLALKSAILRDPTRVMTSWSESDPTPCHWPGIICTHG-------RVTSLVLSGRRLSG 82

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           Y+P +LGLL  L    +  N F   +P +  N   L  +D+S+N  +G  P
Sbjct: 83  YIPSKLGLLDSLIKLDLARNNFSKPVPTRLFNAVNLRYIDLSHNSISGPIP 133



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ +  ID + + + G LP+ L  L  L G  +++ N F G IP  +    +   LD+ +
Sbjct: 139 LKNLTHIDFSSNLLNGSLPQSLTQLGSLVGTLNLSYNSFSGEIPPSYGRFPVFVSLDLGH 198

Query: 657 NRFAGKFP 680
           N   GK P
Sbjct: 199 NNLTGKIP 206



>pir|T04856|T04856 hypothetical protein F28A21.50 - Arabidopsis
           thaliana  (fragment)
          Length = 662

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 3/117 (2%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPRNTTSDWVGS---DVCNYTGVFCAPAPDNPKIRTVASIDLN 509
           + N+  AL  ++  + SDP  T ++W  S   D+C ++GV C           V  +DL+
Sbjct: 2   VLNSGSALLKFRARVNSDPHGTLANWNVSGINDLCYWSGVTCVDGK-------VQILDLS 54

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              + G L  EL  L+DL    ++ N F G IPK++ + + L  LD+  N  +G+ P
Sbjct: 55  GYSLEGTLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENLEVLDLRENDLSGQIP 111



>pir|C86203|C86203 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889691 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011001_1537177 Arabidopsis thaliana
           chromosome I BAC F4H5 genomic sequence, complete
           sequence.
          Length = 860

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 26/141 (18%)
 Frame = +3

Query: 336 RIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCN--YTGVFCAPA--------------- 464
           ++R    AL+  K+++ +DP +   +W   D CN  +TGV C  +               
Sbjct: 34  KLRKCLRALRVIKESL-NDPVHRLRNWKHGDPCNSNWTGVVCFNSTLDDGYLHVSELQLF 92

Query: 465 ---------PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
                    P+  ++  +  + LN + + G LPEELG L +L    I+ NR  G +PK F
Sbjct: 93  SMNLSGNLSPELGRLSRLTILLLNGNLLNGNLPEELGFLPNLDRIQIDENRISGPLPKSF 152

Query: 618 KNLKILFELDISNNRFAGKFP 680
            NL       ++NN  +G+ P
Sbjct: 153 ANLNKTKHFHMNNNSISGQIP 173



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 21/73 (28%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG-TIPKKFKNLKILFE 641
           P+   + ++  I L++++++GYLP EL  +  L +  +++N F G TIP+ + N+  L +
Sbjct: 174 PELGSLPSIVHILLDNNNLSGYLPPELSNMPRLLILQLDNNHFDGTTIPQSYGNMSKLLK 233

Query: 642 LDISNNRFAGKFP 680
           + + N    G  P
Sbjct: 234 MSLRNCSLQGPVP 246



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +N++ I+G +P ELG L  +    +++N   G +P +  N+  L  L + NN F G
Sbjct: 163 MNNNSISGQIPPELGSLPSIVHILLDNNNLSGYLPPELSNMPRLLILQLDNNHFDG 218



>gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1049

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 11/109 (10%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP-----------KIRTVASIDLNHDDIAG 527
           ++    N  S  +  ++ N T + C   P+N            K+  +A++DL  ++ +G
Sbjct: 232 VLKAGHNNLSGTIPDEIFNATSLECLSFPNNDFQGTLEWANVVKLSKLATLDLGENNFSG 291

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            + E +G L  L   H+N+N+  G+IP    N   L  +D++NN F+G+
Sbjct: 292 NISESIGQLNRLEELHLNNNKMFGSIPSNLSNCTSLKIIDLNNNNFSGE 340



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 30/100 (30%), Positives = 46/100 (46%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           I+S   N T+  +G +  N       P         +  + L+   ++G +P  L  L+ 
Sbjct: 419 ILSSSSNLTTLLIGHNFMNER----MPDGSIDGFENLQVLSLSECSLSGKIPRWLSKLSR 474

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L V  +++NR  G IP    +L  LF LDISNN   G+ P
Sbjct: 475 LEVLELDNNRLTGPIPDWISSLNFLFYLDISNNSLTGEIP 514



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++  G +P E+GLL  L   +++ N+  G IP+   NL  L  LD+S+N   G  
Sbjct: 560 LNLGKNEFTGLIPPEIGLLKVLLSLNLSFNKLYGDIPQSICNLTDLLVLDLSSNNLTGTI 619

Query: 678 P 680
           P
Sbjct: 620 P 620



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 23/84 (27%), Positives = 39/84 (46%)
 Frame = +3

Query: 420 GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           G+D C + G+ C+      +  TV  + L    + G +   LG L  L   +++ N   G
Sbjct: 65  GTDCCKWDGITCS------QDSTVTDVSLASRSLQGRISPSLGNLPGLLRLNLSHNLLSG 118

Query: 600 TIPKKFKNLKILFELDISNNRFAG 671
            +PK+  +   L  +D+S NR  G
Sbjct: 119 ALPKELLSSSSLITIDVSFNRLDG 142



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/62 (29%), Positives = 34/62 (54%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P ++T   +DL  ++ +G +PE +   ++L    ++SN+  G + K   NLK L  L ++
Sbjct: 350 PNLKT---LDLMRNNFSGEIPESIYTCSNLTALRVSSNKLHGQLSKGLGNLKSLSFLSLA 406

Query: 654 NN 659
            N
Sbjct: 407 GN 408



>gb:AP005896_1859828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBb0032C09.>gb:AP007224_1863301 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0463E12.
          Length = 1049

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP-----------KIRTVASIDLNHDDIAG 527
           ++    N  S  +  ++ N T + C   P+N            K+  +A++DL  ++ +G
Sbjct: 232 VLKAGHNNLSGTLPDEIFNATSLECLSFPNNNLQGTLEGANVVKLGKLATLDLGENNFSG 291

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            +PE +G L  L   H+N+N+  G+IP    N   L  +D+++N F+G+
Sbjct: 292 NIPESIGQLNRLEELHLNNNKMFGSIPSTLSNCTSLKTIDLNSNNFSGE 340



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L +++  G +P+E+G L  L + +++ N+  G IP+   NL+ L  LD+S+N   G  
Sbjct: 561 LNLGNNEFTGLIPQEIGQLKALLLLNLSFNKLYGDIPQSICNLRDLLMLDLSSNNLTGTI 620

Query: 678 P 680
           P
Sbjct: 621 P 621



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 3/75 (4%)
 Frame = +3

Query: 465 PDNPKI---RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL 635
           PD+ +I     +  +DL+    +G +P+ L  L+ L +  +++N+  G IP    +L  L
Sbjct: 441 PDDDRIDGFENLQVLDLSGCSFSGKIPQWLSKLSRLEMLVLDNNQLTGPIPDWISSLNFL 500

Query: 636 FELDISNNRFAGKFP 680
           F LD+SNN   G+ P
Sbjct: 501 FYLDVSNNNLTGEIP 515



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 24/84 (28%), Positives = 37/84 (44%)
 Frame = +3

Query: 420 GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           G D C + G+ C         RTV  + L    + GY+   LG L  L   +++ N    
Sbjct: 65  GVDCCEWEGITCRTD------RTVTDVSLPSRSLEGYISPSLGNLTGLLRLNLSYNLLSS 118

Query: 600 TIPKKFKNLKILFELDISNNRFAG 671
            +P++  +   L  +DIS NR  G
Sbjct: 119 VLPQELLSSSKLIVIDISFNRLNG 142



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 22/74 (29%), Positives = 35/74 (47%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
           FC  +P      ++A ++L+++  +G +P ELG  + L V     N   GT+P +  N  
Sbjct: 199 FCTNSP------SLAVLELSYNQFSGSIPPELGSCSRLRVLKAGHNNLSGTLPDEIFNAT 252

Query: 630 ILFELDISNNRFAG 671
            L  L   NN   G
Sbjct: 253 SLECLSFPNNNLQG 266



>gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat
           receptor-like kinase genes, complete cds.
          Length = 1049

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 11/109 (10%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP-----------KIRTVASIDLNHDDIAG 527
           ++    N  S  +  ++ N T + C   P+N            K+  +A++DL  ++ +G
Sbjct: 232 VLKAGHNNLSGTIPDEIFNATSLECLSFPNNDFQGTLEWANVVKLSKLATLDLGENNFSG 291

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            + E +G L  L   H+N+N+  G+IP    N   L  +D++NN F+G+
Sbjct: 292 NISESIGQLNRLEELHLNNNKMFGSIPSNLSNCTSLKIIDLNNNNFSGE 340



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 30/100 (30%), Positives = 46/100 (46%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           I+S   N T+  +G +  N       P         +  + L+   ++G +P  L  L+ 
Sbjct: 419 ILSSSSNLTTLLIGHNFMNER----MPDGSIDGFENLQVLSLSECSLSGKIPRWLSKLSR 474

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L V  +++NR  G IP    +L  LF LDISNN   G+ P
Sbjct: 475 LEVLELDNNRLTGPIPDWISSLNFLFYLDISNNSLTGEIP 514



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++  G +P E+GLL  L   +++ N+  G IP+   NL  L  LD+S+N   G  
Sbjct: 560 LNLGKNEFTGLIPPEIGLLKVLLSLNLSFNKLYGDIPQSICNLTDLLVLDLSSNNLTGTI 619

Query: 678 P 680
           P
Sbjct: 620 P 620



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 23/84 (27%), Positives = 39/84 (46%)
 Frame = +3

Query: 420 GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           G+D C + G+ C+      +  TV  + L    + G +   LG L  L   +++ N   G
Sbjct: 65  GTDCCKWDGITCS------QDSTVTDVSLASRSLQGRISPSLGNLPGLLRLNLSHNLLSG 118

Query: 600 TIPKKFKNLKILFELDISNNRFAG 671
            +PK+  +   L  +D+S NR  G
Sbjct: 119 ALPKELLSSSSLITIDVSFNRLDG 142



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/62 (29%), Positives = 34/62 (54%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P ++T   +DL  ++ +G +PE +   ++L    ++SN+  G + K   NLK L  L ++
Sbjct: 350 PNLKT---LDLMRNNFSGEIPESIYTCSNLTALRVSSNKLHGQLSKGLGNLKSLSFLSLA 406

Query: 654 NN 659
            N
Sbjct: 407 GN 408



>gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat
           receptor-like kinase genes, complete cds.
          Length = 1049

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/109 (26%), Positives = 55/109 (50%), Gaps = 11/109 (10%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP-----------KIRTVASIDLNHDDIAG 527
           ++    N  S  +  ++ N T + C   P+N            K+  +A++DL  ++ +G
Sbjct: 232 VLKAGHNNLSGTLPDEIFNATSLECLSFPNNNLQGTLEGANVVKLGKLATLDLGENNFSG 291

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            +PE +G L  L   H+N+N+  G+IP    N   L  +D+++N F+G+
Sbjct: 292 NIPESIGQLNRLEELHLNNNKMFGSIPSTLSNCTSLKTIDLNSNNFSGE 340



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 20/61 (32%), Positives = 37/61 (60%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L +++  G +P+E+G L  L + +++ N+  G IP+   NL+ L  LD+S+N   G  
Sbjct: 561 LNLGNNEFTGLIPQEIGQLKALLLLNLSFNKLYGDIPQSICNLRDLLMLDLSSNNLTGTI 620

Query: 678 P 680
           P
Sbjct: 621 P 621



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 3/75 (4%)
 Frame = +3

Query: 465 PDNPKI---RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL 635
           PD+ +I     +  +DL+    +G +P+ L  L+ L +  +++N+  G IP    +L  L
Sbjct: 441 PDDDRIDGFENLQVLDLSGCSFSGKIPQWLSKLSRLEMLVLDNNQLTGPIPDWISSLNFL 500

Query: 636 FELDISNNRFAGKFP 680
           F LD+SNN   G+ P
Sbjct: 501 FYLDVSNNNLTGEIP 515



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 24/84 (28%), Positives = 37/84 (44%)
 Frame = +3

Query: 420 GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           G D C + G+ C         RTV  + L    + GY+   LG L  L   +++ N    
Sbjct: 65  GVDCCEWEGITCRTD------RTVTDVSLPSRSLEGYISPSLGNLTGLLRLNLSYNLLSS 118

Query: 600 TIPKKFKNLKILFELDISNNRFAG 671
            +P++  +   L  +DIS NR  G
Sbjct: 119 VLPQELLSSSKLIVIDISFNRLNG 142



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 22/74 (29%), Positives = 35/74 (47%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
           FC  +P      ++A ++L+++  +G +P ELG  + L V     N   GT+P +  N  
Sbjct: 199 FCTNSP------SLAVLELSYNQFSGSIPPELGSCSRLRVLKAGHNNLSGTLPDEIFNAT 252

Query: 630 ILFELDISNNRFAG 671
            L  L   NN   G
Sbjct: 253 SLECLSFPNNNLQG 266



>gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRNA,
           complete cds.>gb:BT002217_1635820 Arabidopsis thaliana
           At1g71830/F14O23_24 mRNA, complete cds.
          Length = 625

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P N   +  + S+DL  +  +G +PE LG L+ L    +N+N   G+IP  
Sbjct: 101 YSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMS 160

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 161 LTNITTLQVLDLSNNRLSGSVP 182



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/99 (34%), Positives = 47/99 (47%), Gaps = 2/99 (2%)
 Frame = +3

Query: 390 DPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL 563
           DP N    W    V  C +  V C    +N  IR    +DL + +++G+L  ELG+L +L
Sbjct: 42  DPNNVLQSWDPRLVNPCTWFHVTCNN--ENSVIR----VDLGNAELSGHLVPELGVLKNL 95

Query: 564 GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
               + SN   G IP    NL  L  LD+  N F+G  P
Sbjct: 96  QYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIP 134



>gb:AB026644_1517155 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MFJ20.>gb:AK117357_1815396 Arabidopsis
           thaliana At3g28450 mRNA for putative receptor kinase,
           complete cds, clone: RAFL16-92-N06.
          Length = 605

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 6/108 (5%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSD-----VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPE 539
           +A ++DP+N    W   +     +CN+ GV C    +N     V +++L    ++G +P+
Sbjct: 41  KASLTDPQNALKSWNFDNTTLGFLCNFVGVSCWNNQEN----RVINLELRDMGLSGKIPD 96

Query: 540 ELGLLADLGVFHINSNRFCGTIPKKFKN-LKILFELDISNNRFAGKFP 680
            L   A L    ++SNR  G IP +  N L  L  LD+SNN   G+ P
Sbjct: 97  SLQYCASLQKLDLSSNRLSGNIPTELCNWLPFLVSLDLSNNELNGEIP 144



>gb:A67827_1450282 Sequence 32 from Patent
           WO9743427.>gb:CQ768543_1451789 Sequence 38 from Patent
           WO2004007712.>gb:AX120037_1461704 Sequence 20 from
           Patent WO0129240.>gb:AX138071_1462207 Sequence 17 from
           Patent EP1094113.
          Length = 625

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P N   +  + S+DL  +  +G +PE LG L+ L    +N+N   G+IP  
Sbjct: 101 YSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMS 160

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 161 LTNITTLQVLDLSNNRLSGSVP 182



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +3

Query: 390 DPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL 563
           DP N    W  + V  C +  V C    +N  IR    +DL + +++G+L  ELG+L +L
Sbjct: 42  DPNNVLQSWDPTLVNPCTWFHVTCNN--ENSVIR----VDLGNAELSGHLVPELGVLKNL 95

Query: 564 GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
               + SN   G IP    NL  L  LD+  N F+G  P
Sbjct: 96  QYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIP 134



>pir|C96519|C96519 probable disease resistance protein, 3954-7013
            [imported] - Arabidopsis thaliana>gb:AE005173_892748
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC079679_1732712 Arabidopsis thaliana
            chromosome 1 BAC T6B12 genomic sequence, complete
            sequence.
          Length = 1019

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = +3

Query: 495  SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            +IDL+ + + G +P+ +GLL +L + +++SN F G IP    NLK L  LDIS N  +G+
Sbjct: 835  AIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGE 894

Query: 675  FP 680
             P
Sbjct: 895  IP 896



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL+++++ G LP  L  L++ L    + +N   G++P+ F N   L  LD+S+NR  GK
Sbjct: 640 LDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGK 699

Query: 675 FP 680
            P
Sbjct: 700 LP 701



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 14/44 (31%), Positives = 31/44 (70%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
            ++ + S+D++ ++I+G +P ELG L+ L   +++ N+  G+IP+
Sbjct: 878  LKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQ 921



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 6/98 (6%)
 Frame = +3

Query: 405 TSDWVG-SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-----LADLG 566
           +  WV  SD C++ G+ C     + K   V  +DL+   + G L     L     L DL 
Sbjct: 94  SKSWVNKSDCCSWDGITC-----DAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLN 148

Query: 567 VFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + + N N     IP +F  L  L  LD+S +  +G+ P
Sbjct: 149 LANNNFNN--SPIPAEFDKLTGLERLDLSQSSLSGQIP 184



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           S+D++H+ + G LP  L   + L V ++ SNR     P +  +L+ L  L + +N+F G
Sbjct: 688 SLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHG 746



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 24/91 (26%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLA-----DLG----------VFHINSN--------- 587
           IR++ S++LN  ++ G  P  + L+      DLG          VFH N++         
Sbjct: 250 IRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYT 309

Query: 588 RFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            F G IP    +LK L  L +S + F+GK P
Sbjct: 310 SFSGAIPDSISSLKNLTSLTLSVSYFSGKIP 340



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%)
 Frame = +3

Query: 489 VASIDLNHDDIAG--YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           + S+DL+ +   G  +LP +      L  F  ++N F G IP+    L  L  LD+SNN 
Sbjct: 592 LTSVDLSSNAFQGPLFLPSK-----SLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNN 646

Query: 663 FAGKFP 680
             G  P
Sbjct: 647 LNGSLP 652



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +DL ++ ++G LPE       L    ++ NR  G +P        L  L++ +NR 
Sbjct: 661 SLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRI 720

Query: 666 AGKFP 680
              FP
Sbjct: 721 NDMFP 725



>sp|O22476|BRI1_ARATH BRASSINOSTEROID INSENSITIVE 1 precursor (EC
           2.7.1.37) (AtBRI1) (Brassinosteroid LRR receptor
           kinase).>pir|T09356|T09356 brassinosteroid-insensitive
           protein BRI1 - Arabidopsis thaliana>gb:ATCHRIV91_1547924
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 91.>gb:ATF23K16_1549765 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA
           project).>gb:AF017056_1761527 Arabidopsis thaliana
           brassinosteroid insensitive 1 (BRI1) gene, complete cds.
          Length = 1196

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 24/61 (39%), Positives = 40/61 (65%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L H+DI+G +P+E+G L  L +  ++SN+  G IP+    L +L E+D+SNN  +G  
Sbjct: 683 LNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPI 742

Query: 678 P 680
           P
Sbjct: 743 P 743



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/87 (29%), Positives = 51/87 (58%), Gaps = 4/87 (4%)
 Frame = +3

Query: 432 CNYT----GVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           CN T    G   +P  DN    ++  +D++++ ++GY+P+E+G +  L + ++  N   G
Sbjct: 635 CNITSRVYGGHTSPTFDNNG--SMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISG 692

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
           +IP +  +L+ L  LD+S+N+  G+ P
Sbjct: 693 SIPDEVGDLRGLNILDLSSNKLDGRIP 719



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++T+ ++ L+ +D+ G +P  L    +L    +++NR  G IPK    L+ L  L +SNN
Sbjct: 487 VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN 546

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 547 SFSGNIP 553



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 29/71 (40%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEEL-GLLADLGVFHINSNRFCGTI-PKKFKNLK-ILFELD 647
           K+R +  +DL+ ++ +G LPE L  L A L    ++SN F G I P   +N K  L EL 
Sbjct: 363 KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELY 422

Query: 648 ISNNRFAGKFP 680
           + NN F GK P
Sbjct: 423 LQNNGFTGKIP 433



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD-LGVFHINSNRFCGTIPKKFKNL 626
           F  P P  P ++++  + L  +   G +P+ L    D L    ++ N F G +P  F + 
Sbjct: 281 FVGPIPPLP-LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSC 339

Query: 627 KILFELDISNNRFAGKFP 680
            +L  L +S+N F+G+ P
Sbjct: 340 SLLESLALSSNNFSGELP 357



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P+EL  +  L    ++ N   G IP    N   L  + +SNNR  G+ P
Sbjct: 476 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP 529



>gb:ATCHRIV49_1545665 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 49.
          Length = 685

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 3/111 (2%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGS---DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           AL  ++  + SDP  T ++W  S   D+C ++GV C           V  +DL+   + G
Sbjct: 31  ALLKFRARVNSDPHGTLANWNVSGINDLCYWSGVTCVDGK-------VQILDLSGYSLEG 83

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L  EL  L+DL    ++ N F G IPK++ + + L  LD+  N  +G+ P
Sbjct: 84  TLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENLEVLDLRENDLSGQIP 134



>pir|A86383|A86383 76.4K protein kinase homolog F4F7.29 -
           Arabidopsis thaliana>gb:AE005172_891453 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AY056441_1563749 Arabidopsis thaliana
           At1g25320/F4F7_17 mRNA, complete
           cds.>gb:BT010471_1640417 Arabidopsis thaliana
           At1g25320/F4F7_17 gene, complete
           cds.>gb:AC079374_1732565 Arabidopsis thaliana chromosome
           1 BAC F4F7 genomic sequence, complete sequence.
          Length = 702

 Score = 55.5 bits (132), Expect = 9e-07
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 2/120 (1%)
 Frame = +3

Query: 327 ENDRIRNAYIALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASI 500
           E + + +   AL   KQ+I  DP  + S+W     + C++ GV C    D+ K+  V S+
Sbjct: 19  ELNALNDEGFALLTLKQSISKDPDGSLSNWNSENQNPCSWNGVTC----DDNKV--VVSL 72

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +    + GYLP  LGLL++L   ++ SN   G +P +    + L  L +  N  +G  P
Sbjct: 73  SIPKKKLLGYLPSSLGLLSNLRHLNLRSNELSGNLPVELFKAQGLQSLVLYGNFLSGSIP 132



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPK 611
           N TG    P+     + ++  +DL+ +++ G +P++LG L  L G   ++ N F G+IP 
Sbjct: 174 NLTG--SVPSGFGQSLASLQKLDLSSNNLIGLVPDDLGNLTRLQGTLDLSHNSFSGSIPA 231

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
              NL     ++++ N  +G  P
Sbjct: 232 SLGNLPEKVYVNLAYNNLSGPIP 254



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF-KNLKILFELDISNNRFAGK 674
           +DL+ + + G +PE +     L  F ++ N   G++P  F ++L  L +LD+S+N   G 
Sbjct: 144 LDLSRNSLNGSIPESVLKCNRLRSFDLSQNNLTGSVPSGFGQSLASLQKLDLSSNNLIGL 203

Query: 675 FP 680
            P
Sbjct: 204 VP 205



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K + + S+ L  + ++G +P E+G L  L +  ++ N   G+IP+       L   D+S 
Sbjct: 113 KAQGLQSLVLYGNFLSGSIPNEIGDLKFLQILDLSRNSLNGSIPESVLKCNRLRSFDLSQ 172

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 173 NNLTGSVP 180



>gb:AK117178_1815224 Arabidopsis thaliana At1g73080 mRNA for unknown
           protein, complete cds, clone: RAFL16-72-A13.
          Length = 1123

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = +3

Query: 393 PRNTTSDWV----GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           P   TS W      +  CN+ G+ C  +      + VAS++     ++G L  E+G L  
Sbjct: 47  PPQVTSTWKINASEATPCNWFGITCDDS------KNVASLNFTRSRVSGQLGPEIGELKS 100

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +  +++N F GTIP    N   L  LD+S N F+ K P
Sbjct: 101 LQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIP 140



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 20/67 (29%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L+ + ++G +P ELG  + L +  +N N+  G IP     L+ L  L++  N
Sbjct: 314 LKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFEN 373

Query: 660 RFAGKFP 680
           RF+G+ P
Sbjct: 374 RFSGEIP 380



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  + + ++DL++++  G +P  LG  + L    I S    GTIP     LK L  L++
Sbjct: 263 SPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNL 322

Query: 651 SNNRFAGKFP 680
           S NR +G  P
Sbjct: 323 SENRLSGSIP 332



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  +  +++ +D N ++  G +P  LG   +L   +++ NRF G IP +  NL+ L  +
Sbjct: 500 PEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYM 559

Query: 645 DISNNRFAGKFP 680
           ++S N   G  P
Sbjct: 560 NLSRNLLEGSLP 571



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    ++ +  ++L+ + + G LP +L     L  F +  N   G++P  F N K L  L
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTL 607

Query: 645 DISNNRFAGKFP 680
            +S NRF+G  P
Sbjct: 608 VLSENRFSGGIP 619



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  +DL+ + + G +P +LG L  L   +I++N   G++    K L  L  +D+SNN+F 
Sbjct: 653 IYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFT 711

Query: 669 GKFP 680
           G  P
Sbjct: 712 GPIP 715



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P +   +S+D   +   +++G +P  LG+L +L + +++ NR  G+IP +  N   L  L
Sbjct: 285 PALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLL 344

Query: 645 DISNNRFAGKFP 680
            +++N+  G  P
Sbjct: 345 KLNDNQLVGGIP 356



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G LPE L LL +L    + +N   G +     N K L  LD+S N F G  P
Sbjct: 226 LHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVP 284



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G LPE L  +  L V +++ N   G IP+   + K L EL +  N+F+G  P
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIP 212



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           D+  + + G +P        L    ++ NRF G IP+    LK L  L I+ N F G+ P
Sbjct: 584 DVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIP 643



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+++++ G +P+ +G   +L    + +N+F G IP+   N   L  L +  N+  G  P
Sbjct: 178 LDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLP 236



>gb:AY226583_1591035 X Citrofortunella mitis leucine-rich repeat
           protein mRNA, complete cds.
          Length = 228

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ SDP      W  + V  C +  + C    DN     V  +DL + +++G+
Sbjct: 43  ALYALRRSL-SDPDYVLQSWDPTLVNPCTWFHITCNQ--DN----RVTRLDLGNSNLSGH 95

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN  +GK P
Sbjct: 96  LVPELGKLEHLQYLELYKNNIQGTIPVELGNLKSLISLDLYNNNISGKIP 145



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+DL +++I+G +P  L  L  L    +N NR  G IP++   +  L  +D+S+N
Sbjct: 127 LKSLISLDLYNNNISGKIPPSLAKLKSLVFLRLNDNRLTGQIPRELVGISSLKVVDVSSN 186

Query: 660 RFAGKFP 680
              G  P
Sbjct: 187 DLCGTIP 193



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 11/118 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +        P+  K+  +  ++L
Sbjct: 58  LQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGHL------VPELGKLEHLQYLEL 111

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             ++I G +P ELG L  L    + +N   G IP     LK L  L +++NR  G+ P
Sbjct: 112 YKNNIQGTIPVELGNLKSLISLDLYNNNISGKIPPSLAKLKSLVFLRLNDNRLTGQIP 169



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           P   K++++  + LN + + G +P EL  ++ L V  ++SN  CGTIP
Sbjct: 146 PSLAKLKSLVFLRLNDNRLTGQIPRELVGISSLKVVDVSSNDLCGTIP 193



>gb:AY139779_1582396 Arabidopsis thaliana At1g73080/F3N23_28 mRNA,
           complete cds.
          Length = 1123

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = +3

Query: 393 PRNTTSDWV----GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           P   TS W      +  CN+ G+ C  +      + VAS++     ++G L  E+G L  
Sbjct: 47  PPQVTSTWKINASEATPCNWFGITCDDS------KNVASLNFTRSRVSGQLGPEIGELKS 100

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +  +++N F GTIP    N   L  LD+S N F+ K P
Sbjct: 101 LQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIP 140



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 20/67 (29%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L+ + ++G +P ELG  + L +  +N N+  G IP     L+ L  L++  N
Sbjct: 314 LKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFEN 373

Query: 660 RFAGKFP 680
           RF+G+ P
Sbjct: 374 RFSGEIP 380



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  +  +++ +D N ++  G +P  LG   +L   +++ NRF G IP +  NL+ L  +
Sbjct: 500 PEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYM 559

Query: 645 DISNNRFAGKFP 680
           ++S N   G  P
Sbjct: 560 NLSRNLLEGSLP 571



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 22/70 (31%), Positives = 36/70 (51%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  + + ++DL++++  G +P  L   + L    I S    GTIP     LK L  L++
Sbjct: 263 SPNCKNLLTLDLSYNEFEGGVPPALENCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNL 322

Query: 651 SNNRFAGKFP 680
           S NR +G  P
Sbjct: 323 SENRLSGSIP 332



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    ++ +  ++L+ + + G LP +L     L  F +  N   G++P  F N K L  L
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTL 607

Query: 645 DISNNRFAGKFP 680
            +S NRF+G  P
Sbjct: 608 VLSENRFSGGIP 619



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P +   +S+D   +   +++G +P  LG+L +L + +++ NR  G+IP +  N   L  L
Sbjct: 285 PALENCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLL 344

Query: 645 DISNNRFAGKFP 680
            +++N+  G  P
Sbjct: 345 KLNDNQLVGGIP 356



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  +DL+ + + G +P +LG L  L   +I++N   G++    K L  L  +D+SNN+F 
Sbjct: 653 IYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFT 711

Query: 669 GKFP 680
           G  P
Sbjct: 712 GPIP 715



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G LPE L LL +L    + +N   G +     N K L  LD+S N F G  P
Sbjct: 226 LHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVP 284



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G LPE L  +  L V +++ N   G IP+   + K L EL +  N+F+G  P
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIP 212



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           D+  + + G +P        L    ++ NRF G IP+    LK L  L I+ N F G+ P
Sbjct: 584 DVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIP 643



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+++++ G +P+ +G   +L    + +N+F G IP+   N   L  L +  N+  G  P
Sbjct: 178 LDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLP 236



>gb:AY128385_1580684 Arabidopsis thaliana putative disease
           resistance protein (At2g15080) mRNA, complete cds.
          Length = 983

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P++R + ++DL+++D  G +P  L  L++L    ++ N F G IP    NL  L  +D S
Sbjct: 109 PQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFS 168

Query: 654 NNRFAGKFP 680
           +N F+G+ P
Sbjct: 169 HNNFSGQIP 177



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++    ID + +   G +P+ +GLL +L V ++++N   G I     NL  L  LD+S N
Sbjct: 793 LKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQN 852

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 853 KLSGEIP 859



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 21/64 (32%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + ++ L+ +   G LP  LG L  L    +++N F G IP    NL  L  +D+  N F 
Sbjct: 210 LTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFV 269

Query: 669 GKFP 680
           G+ P
Sbjct: 270 GEIP 273



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/62 (30%), Positives = 35/62 (56%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+D+ H+ + G LP  L  ++ LG+ ++ SN+   T P    +L+ L  L + +N F
Sbjct: 652 SLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAF 711

Query: 666 AG 671
            G
Sbjct: 712 YG 713



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S  L+ ++I G +P   G L  L + ++ SN+  G+ P    NL+ L  L + NNR  
Sbjct: 282 LTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLT 341

Query: 669 G 671
           G
Sbjct: 342 G 342



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S +L++++ +G +P  +G L+ L    ++ N F G +P    +L  L +L +  N F 
Sbjct: 186 LTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFV 245

Query: 669 GKFP 680
           GK P
Sbjct: 246 GKIP 249



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 16/64 (25%), Positives = 33/64 (51%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R ++++ L ++ + G L   +  L++L +F    N F G +P    N+  L  + + NN
Sbjct: 327 LRKLSTLSLFNNRLTGTLTSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENN 386

Query: 660 RFAG 671
           +  G
Sbjct: 387 QLNG 390



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 1/93 (1%)
 Frame = +3

Query: 405 TSDWVG-SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHIN 581
           T  W   SD C + G+ C     + K   V  +DL+   + G L               N
Sbjct: 61  TESWTNNSDCCYWDGIKC-----DAKFGDVIELDLSFSCLRGQL---------------N 100

Query: 582 SNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           SN     +P+    L+ L  LD+SNN F G+ P
Sbjct: 101 SNSSLFRLPQ----LRFLTTLDLSNNDFIGQIP 129



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 15/34 (44%), Positives = 18/34 (52%)
 Frame = +3

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           ++N F G IP     L  L  LD SNN+F G  P
Sbjct: 587 SNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIP 620



>pir|G84524|G84524 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005957_1533258 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.
          Length = 983

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P++R + ++DL+++D  G +P  L  L++L    ++ N F G IP    NL  L  +D S
Sbjct: 109 PQLRFLTTLDLSNNDFIGQIPSSLETLSNLTTLDLSRNHFSGRIPSSIGNLSHLIFVDFS 168

Query: 654 NNRFAGKFP 680
           +N F+G+ P
Sbjct: 169 HNNFSGQIP 177



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++    ID + +   G +P+ +GLL +L V ++++N   G I     NL  L  LD+S N
Sbjct: 793 LKVFTVIDFSGNKFEGEIPKSIGLLKELHVLNLSNNALSGHIASSMGNLMALESLDVSQN 852

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 853 KLSGEIP 859



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/64 (32%), Positives = 33/64 (51%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S  L+ ++I G +P   G L  L + ++ SN+  G+ P    NL+ L  L + NNR  
Sbjct: 282 LTSFILSDNNIVGEIPSSFGNLNQLDILNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLT 341

Query: 669 GKFP 680
           G  P
Sbjct: 342 GTLP 345



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 21/64 (32%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + ++ L+ +   G LP  LG L  L    +++N F G IP    NL  L  +D+  N F 
Sbjct: 210 LTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFVGKIPSSLGNLSHLTSIDLHKNNFV 269

Query: 669 GKFP 680
           G+ P
Sbjct: 270 GEIP 273



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/62 (30%), Positives = 35/62 (56%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+D+ H+ + G LP  L  ++ LG+ ++ SN+   T P    +L+ L  L + +N F
Sbjct: 652 SLISLDVGHNQLVGKLPRSLSHISSLGLLNVESNKISDTFPLWLSSLQELQVLVLRSNAF 711

Query: 666 AG 671
            G
Sbjct: 712 YG 713



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S +L++++ +G +P  +G L+ L    ++ N F G +P    +L  L +L +  N F 
Sbjct: 186 LTSFNLSYNNFSGRVPSSIGNLSYLTTLRLSRNSFFGELPSSLGSLFHLTDLILDTNHFV 245

Query: 669 GKFP 680
           GK P
Sbjct: 246 GKIP 249



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 17/64 (26%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R ++++ L ++ + G LP  +  L++L +F    N F G +P    N+  L  + + NN
Sbjct: 327 LRKLSTLSLFNNRLTGTLPSNMSSLSNLKLFDATENHFTGPLPSSLFNIPSLKTITLENN 386

Query: 660 RFAG 671
           +  G
Sbjct: 387 QLNG 390



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +++  + ++G  P  L  L  L    + +NR  GT+P    +L  L   D + N F G  
Sbjct: 309 LNVKSNKLSGSFPIALLNLRKLSTLSLFNNRLTGTLPSNMSSLSNLKLFDATENHFTGPL 368

Query: 678 P 680
           P
Sbjct: 369 P 369



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 1/93 (1%)
 Frame = +3

Query: 405 TSDWVG-SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHIN 581
           T  W   SD C + G+ C     + K   V  +DL+   + G L               N
Sbjct: 61  TESWTNNSDCCYWDGIKC-----DAKFGDVIELDLSFSCLRGQL---------------N 100

Query: 582 SNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           SN     +P+    L+ L  LD+SNN F G+ P
Sbjct: 101 SNSSLFRLPQ----LRFLTTLDLSNNDFIGQIP 129



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 15/34 (44%), Positives = 18/34 (52%)
 Frame = +3

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           ++N F G IP     L  L  LD SNN+F G  P
Sbjct: 587 SNNNFTGNIPSFICELPYLSTLDFSNNKFNGSIP 620



>pir|C96756|C96756 receptor-like protein kinase homolog [imported] -
           Arabidopsis thaliana>gb:AE005173_894853 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536451 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AK117384_1815422 Arabidopsis thaliana
           At1g73070 mRNA for unknown protein, complete cds, clone:
           RAFL16-96-P09.
          Length = 598

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 31/100 (31%), Positives = 47/100 (47%), Gaps = 4/100 (4%)
 Frame = +3

Query: 393 PRNTTSDWVGS----DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           P   TS W  +      CN+ G+ C  +      + V S++     ++G L  E+G L  
Sbjct: 45  PPELTSTWKTNASEATPCNWFGIICDDS------KKVTSLNFTGSGVSGQLGPEIGQLKS 98

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +  ++SN F G IP    N   L  +D+S N F+GK P
Sbjct: 99  LEILDMSSNNFSGIIPSSLGNCSSLVYIDLSENSFSGKVP 138



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 25/66 (37%), Positives = 38/66 (57%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R + +I+L+ + +   +P EL  L +L   ++ SN   GT+P KF N K L  L +S NR
Sbjct: 528 RNLTTINLSRNKLTRNIPRELENLQNLSHLNLGSNLLNGTVPSKFSNWKELTTLVLSGNR 587

Query: 663 FAGKFP 680
           F+G  P
Sbjct: 588 FSGFVP 593



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 25/68 (36%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K R + ++DL++++  G +P ELG  + L    I S    GTIP     LK L  L++S 
Sbjct: 263 KCRNLVTLDLSYNEFEGGVPPELGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSE 322

Query: 657 NRFAGKFP 680
           NR +G  P
Sbjct: 323 NRLSGSIP 330



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 20/67 (29%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L+ + ++G +P ELG  + L +  +N N+  G IP     L+ L  L++  N
Sbjct: 312 LKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFEN 371

Query: 660 RFAGKFP 680
           RF+G+ P
Sbjct: 372 RFSGEIP 378



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ +  + L ++   G +P  LGL ++L +     N F G IP+   + K+L   ++ +
Sbjct: 407 KLKNLKIVTLFNNSFYGVIPPNLGLNSNLEIIDFIGNNFTGEIPRNLCHGKMLTVFNLGS 466

Query: 657 NRFAGKFP 680
           NR  GK P
Sbjct: 467 NRLHGKIP 474



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/72 (27%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P++   +S+D   +   +++G +P  LG+L +L + +++ NR  G+IP +  N   L  L
Sbjct: 283 PELGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLL 342

Query: 645 DISNNRFAGKFP 680
            +++N+  G  P
Sbjct: 343 KLNDNQLVGGIP 354



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/72 (27%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K + ++ +DLN +   G +P  LG   +L   +++ N+    IP++ +NL+ L  L
Sbjct: 498 PKFSKNQDLSFLDLNSNSFEGPIPRSLGSCRNLTTINLSRNKLTRNIPRELENLQNLSHL 557

Query: 645 DISNNRFAGKFP 680
           ++ +N   G  P
Sbjct: 558 NLGSNLLNGTVP 569



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+ +  +G +P+ LG L  L   ++ SN   G +PK    + +L  L + +N   G  
Sbjct: 126 IDLSENSFSGKVPDTLGSLKSLADLYLYSNSLTGELPKSLFRIPVLNYLHVEHNNLTGLI 185

Query: 678 P 680
           P
Sbjct: 186 P 186



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F    PD    ++++A + L  + + G LP+ L  +  L   H+  N   G IP+     
Sbjct: 133 FSGKVPDTLGSLKSLADLYLYSNSLTGELPKSLFRIPVLNYLHVEHNNLTGLIPQNVGEA 192

Query: 627 KILFELDISNNRFAGKFP 680
           K L  L + +N+F G  P
Sbjct: 193 KELLHLRLFDNQFTGTIP 210



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 20/61 (32%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + LN + + G +P  LG L  L    +  NRF G IP +   ++ L +L +  N   GK 
Sbjct: 342 LKLNDNQLVGGIPSALGKLRKLESLELFENRFSGEIPIEIWKIQSLTQLLVYRNNLTGKL 401

Query: 678 P 680
           P
Sbjct: 402 P 402



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 18/68 (26%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +I  +  + + H+++ G +P+ +G   +L    +  N+F GTIP+   N   L  L +  
Sbjct: 167 RIPVLNYLHVEHNNLTGLIPQNVGEAKELLHLRLFDNQFTGTIPESIGNCSKLEILYLHK 226

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 227 NKLVGSLP 234



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 19/59 (32%), Positives = 27/59 (45%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G LP  L LL  L    + +N   GT+       + L  LD+S N F G  P
Sbjct: 224 LHKNKLVGSLPASLNLLESLTDLFVANNSLRGTVQFGSTKCRNLVTLDLSYNEFEGGVP 282



>pir|D96756|D96756 receptor-like protein kinase homolog [imported] -
           Arabidopsis thaliana>gb:AE005173_894854 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536452 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 1123

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = +3

Query: 393 PRNTTSDWV----GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           P   TS W      +  CN+ G+ C  +      + VAS++     ++G L  E+G L  
Sbjct: 47  PPQVTSTWKINASEATPCNWFGITCDDS------KNVASLNFTRSRVSGQLGPEIGELKS 100

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +  +++N F GTIP    N   L  LD+S N F+ K P
Sbjct: 101 LQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIP 140



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 20/67 (29%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L+ + ++G +P ELG  + L +  +N N+  G IP     L+ L  L++  N
Sbjct: 314 LKNLTILNLSENRLSGSIPAELGNCSSLNLLKLNDNQLVGGIPSALGKLRKLESLELFEN 373

Query: 660 RFAGKFP 680
           RF+G+ P
Sbjct: 374 RFSGEIP 380



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/70 (32%), Positives = 37/70 (52%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  + + ++DL++++  G +P  LG  + L    I S    GTIP     LK L  L++
Sbjct: 263 SPNCKNLLTLDLSYNEFEGGVPPALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNL 322

Query: 651 SNNRFAGKFP 680
           S NR +G  P
Sbjct: 323 SENRLSGSIP 332



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  +  +++ +D N ++  G +P  LG   +L   +++ NRF G IP +  NL+ L  +
Sbjct: 500 PEFSQDHSLSFLDFNSNNFEGPIPGSLGSCKNLSSINLSRNRFTGQIPPQLGNLQNLGYM 559

Query: 645 DISNNRFAGKFP 680
           ++S N   G  P
Sbjct: 560 NLSRNLLEGSLP 571



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    ++ +  ++L+ + + G LP +L     L  F +  N   G++P  F N K L  L
Sbjct: 548 PQLGNLQNLGYMNLSRNLLEGSLPAQLSNCVSLERFDVGFNSLNGSVPSNFSNWKGLTTL 607

Query: 645 DISNNRFAGKFP 680
            +S NRF+G  P
Sbjct: 608 VLSENRFSGGIP 619



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  +DL+ + + G +P +LG L  L   +I++N   G++    K L  L  +D+SNN+F 
Sbjct: 653 IYDLDLSGNGLTGEIPAKLGDLIKLTRLNISNNNLTGSL-SVLKGLTSLLHVDVSNNQFT 711

Query: 669 GKFP 680
           G  P
Sbjct: 712 GPIP 715



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P +   +S+D   +   +++G +P  LG+L +L + +++ NR  G+IP +  N   L  L
Sbjct: 285 PALGNCSSLDALVIVSGNLSGTIPSSLGMLKNLTILNLSENRLSGSIPAELGNCSSLNLL 344

Query: 645 DISNNRFAGKFP 680
            +++N+  G  P
Sbjct: 345 KLNDNQLVGGIP 356



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G LPE L LL +L    + +N   G +     N K L  LD+S N F G  P
Sbjct: 226 LHRNKLVGSLPESLNLLGNLTTLFVGNNSLQGPVRFGSPNCKNLLTLDLSYNEFEGGVP 284



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G LPE L  +  L V +++ N   G IP+   + K L EL +  N+F+G  P
Sbjct: 159 LTGELPESLFRIPKLQVLYLDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIP 212



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/60 (31%), Positives = 28/60 (46%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           D+  + + G +P        L    ++ NRF G IP+    LK L  L I+ N F G+ P
Sbjct: 584 DVGFNSLNGSVPSNFSNWKGLTTLVLSENRFSGGIPQFLPELKKLSTLQIARNAFGGEIP 643



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/59 (27%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+++++ G +P+ +G   +L    + +N+F G IP+   N   L  L +  N+  G  P
Sbjct: 178 LDYNNLTGPIPQSIGDAKELVELSMYANQFSGNIPESIGNSSSLQILYLHRNKLVGSLP 236



>gb:OSJN00271_1697720 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0002J11, complete
           sequence.>gb:OSJN00283_1697938 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0116K07, complete
           sequence.
          Length = 1104

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 12/98 (12%)
 Frame = +3

Query: 423 SDVCNYTGV---------FCAPAPDNPKI---RTVASIDLNHDDIAGYLPEELGLLADLG 566
           +D+CN   +         F  P P  P+I   +++  +DL ++     LP+E+G L+ L 
Sbjct: 477 TDLCNLVNLTTIELGRNKFNGPIP--PQIGNCKSLQRLDLTNNYFTSELPQEIGNLSKLV 534

Query: 567 VFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           VF+I+SNR  G+IP +  N  +L  LD+S N F G  P
Sbjct: 535 VFNISSNRLGGSIPLEIFNCTMLQRLDLSQNSFEGSLP 572



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 23/62 (37%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L++++++G +P ELG LA L    +N+N+  G IP  F NL  L E ++S N   G 
Sbjct: 632 AMNLSYNNLSGNIPSELGNLALLENLFLNNNKLTGEIPDTFANLSSLLEFNVSYNNLTGA 691

Query: 675 FP 680
            P
Sbjct: 692 LP 693



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDIS 653
           K+  + ++ +  +  +G +P+ELGLL+ L +  +++ N   G IP +  NL +L  L ++
Sbjct: 601 KLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIPSELGNLALLENLFLN 660

Query: 654 NNRFAGKFP 680
           NN+  G+ P
Sbjct: 661 NNKLTGEIP 669



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 22/121 (18%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDV--CNYTGVFCA----PA----------------PDNPKIRTVAS 497
           I D  +   DW   D   C + GV C+    PA                P    +  + +
Sbjct: 44  IVDTFHHLDDWNPEDPSPCGWKGVNCSSGSTPAVVSLNLSNMNLSGTVDPSIGGLAELTN 103

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +  +G +P E+G  + L   ++N+N+F GTIP +   L ++   ++ NN+  G  
Sbjct: 104 LDLSFNGFSGTIPAEIGNCSKLTGLNLNNNQFQGTIPAELGKLAMMITFNLCNNKLFGAI 163

Query: 678 P 680
           P
Sbjct: 164 P 164



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/66 (30%), Positives = 34/66 (51%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  + L  + + G  P +L  L +L    +  N+F G IP +  N K L  LD++NN 
Sbjct: 459 KSLVQLRLADNSLTGSFPTDLCNLVNLTTIELGRNKFNGPIPPQIGNCKSLQRLDLTNNY 518

Query: 663 FAGKFP 680
           F  + P
Sbjct: 519 FTSELP 524



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 22/61 (36%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +   G LP E+G L  L +     NR  G IP     L  L  L I  N+F+G  
Sbjct: 560 LDLSQNSFEGSLPNEVGSLPQLELLSFADNRLSGEIPPILGKLSHLTALQIGGNQFSGGI 619

Query: 678 P 680
           P
Sbjct: 620 P 620



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 22/67 (32%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +RT+A  D N   + G +P  +G + +L   ++  N   GTIP +  NL +  E+D S N
Sbjct: 269 LRTIALYDNN---LVGPIPATIGNIQNLQRLYLYRNLLNGTIPLEIGNLSLAEEIDFSEN 325

Query: 660 RFAGKFP 680
              G  P
Sbjct: 326 VLTGGVP 332



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID + + + G +P+E G +  L + ++  N+  G IP +   L+ L +LD+S N  +G  
Sbjct: 320 IDFSENVLTGGVPKEFGKIPRLYLLYLFQNQLTGPIPTELCVLRNLSKLDLSINTLSGPI 379

Query: 678 P 680
           P
Sbjct: 380 P 380



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 17/68 (25%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + ++ L  + I+G +P E+G   +L VF +  N+  G +PK+   L  + +L +  
Sbjct: 193 RLKNLKTVRLGQNAISGNIPVEIGECLNLVVFGLAQNKLGGPLPKEIGKLTNMTDLILWG 252

Query: 657 NRFAGKFP 680
           N+ +   P
Sbjct: 253 NQLSSVIP 260



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  + + +L ++ + G +P+E+G +A L      SN   G+IP     LK L  + +  
Sbjct: 145 KLAMMITFNLCNNKLFGAIPDEIGNMASLEDLVGYSNNLSGSIPHTIGRLKNLKTVRLGQ 204

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 205 NAISGNIP 212



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL-FELDISNNRFAGKFP 680
           ++G +P  LG L+ L    I  N+F G IPK+   L  L   +++S N  +G  P
Sbjct: 591 LSGEIPPILGKLSHLTALQIGGNQFSGGIPKELGLLSSLQIAMNLSYNNLSGNIP 645



>gb:ATAC011620_1543300 Arabidopsis thaliana chromosome III BAC F18C1
           genomic sequence, complete sequence.
          Length = 868

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 23/67 (34%), Positives = 41/67 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++   ++D + + + G +P  +GLL +L V +++SN F G IP    NL+ L  LD+S N
Sbjct: 675 LKIYTALDFSENKLEGEIPRSIGLLKELHVLNLSSNAFTGHIPSSMGNLRELESLDVSQN 734

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 735 KLSGEIP 741



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R + ++DL+++  +G +P  +   + L    ++ N F G IP    NL  L  LD+S N
Sbjct: 118 LRFLTTLDLSYNYFSGQIPSCIENFSHLTTLDLSKNYFSGGIPSSIGNLSQLTFLDLSGN 177

Query: 660 RFAGKFP 680
            F G+ P
Sbjct: 178 EFVGEMP 184



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 20/63 (31%), Positives = 34/63 (53%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++ S+D+ H+ + G LP     L+ L V ++ +NR   T P    +LK L  L + +N 
Sbjct: 537 KSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRINDTFPFWLSSLKKLQVLVLRSNA 596

Query: 663 FAG 671
           F G
Sbjct: 597 FHG 599



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 16/64 (25%), Positives = 32/64 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ ++ + L+ +   G LP  +  L++L  F    N F GT+P     +  L  +++ NN
Sbjct: 213 LKHLSDLSLSRNQFTGTLPSNMSSLSNLEYFEAWGNAFTGTLPSSLFTIASLTSINLRNN 272

Query: 660 RFAG 671
           +  G
Sbjct: 273 QLNG 276



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T++ ++L  + + G LP  +     L    +  N+  G +P+ F  L  L  L++ NNR 
Sbjct: 516 TLSFLNLRQNRLGGGLPRSI--FKSLRSLDVGHNQLVGKLPRSFIRLSALEVLNVENNRI 573

Query: 666 AGKFP 680
              FP
Sbjct: 574 NDTFP 578



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/77 (24%), Positives = 33/77 (42%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
           F    P    +  + ++ ++ +D+ G  P  L  L  L    ++ N+F GT+P    +L 
Sbjct: 179 FVGEMPFFGNMNQLTNLYVDSNDLTGIFPLSLLNLKHLSDLSLSRNQFTGTLPSNMSSLS 238

Query: 630 ILFELDISNNRFAGKFP 680
            L   +   N F G  P
Sbjct: 239 NLEYFEAWGNAFTGTLP 255



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 28/94 (29%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 402 TTSDWVG-SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHI 578
           TT  W   SD C + G+ C     N K   V  +DL+   +                FH 
Sbjct: 67  TTESWANNSDCCYWDGITC-----NDKSGEVLELDLSRSCLQSR-------------FHS 108

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           NS+ F         NL+ L  LD+S N F+G+ P
Sbjct: 109 NSSLFT------VLNLRFLTTLDLSYNYFSGQIP 136



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           +R + S+D++ + ++G +P+ELG L+ L   + + N+  G +P
Sbjct: 723 LRELESLDVSQNKLSGEIPQELGNLSYLAYMNFSHNQLGGLVP 765



>gb:AP004769_1844738 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0017C12.
          Length = 1131

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 23/122 (18%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFC---------------------APAPDNPKIRTVA 494
           ISDP  + S W     + CN+ GV C                     +  P    + ++A
Sbjct: 46  ISDPNGSLSSWSNTSQNFCNWQGVSCNNTQTQLRVMVLNVSSKGLSGSIPPCIGNLSSIA 105

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+DL+ +   G +P ELG L  +   +++ N   G IP +  +   L  L +SNN F G+
Sbjct: 106 SLDLSRNAFLGKIPSELGRLGQISYLNLSINSLEGRIPDELSSCSNLQVLGLSNNSFEGE 165

Query: 675 FP 680
            P
Sbjct: 166 IP 167



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +3

Query: 447 VFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
           +F  P P +   +  + SI ++++ + G +P  LG    L   H+  N   G+IP+ F N
Sbjct: 622 LFTGPIPLEIGNLINLGSISISNNRLTGEIPSTLGKCVLLEYLHMEGNLLTGSIPRSFMN 681

Query: 624 LKILFELDISNNRFAGKFP 680
           LK + ELD+S N  +GK P
Sbjct: 682 LKSIKELDLSCNSLSGKVP 700



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  ++++G +P+ +G LA L  FH++ N F G+IP      + L +LD S+N F G  
Sbjct: 543 LSLAQNNLSGLIPDSIGNLAQLTEFHLDGNNFNGSIPSNLGQWRQLEKLDFSHNSFGGSL 602

Query: 678 P 680
           P
Sbjct: 603 P 603



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  + ++G +P E+G L  L V +++ N F G+IP    NL  L  L ++ N  +G  P
Sbjct: 497 LRQNKLSGTIPSEIGNLKSLSVLYLDENMFSGSIPPTIGNLSNLLVLSLAQNNLSGLIP 555



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLL-ADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G LP  +G L + L    +  N+  GTIP +  NLK L  L +  N F+G  P
Sbjct: 472 LDANFLQGTLPSSVGNLPSQLNWLWLRQNKLSGTIPSEIGNLKSLSVLYLDENMFSGSIP 531



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 17/61 (27%), Positives = 25/61 (40%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL  + + G +PE L   + L V  +  N   G IP    N   L  + +  N   G  
Sbjct: 227 VDLGGNQLTGGIPEFLVNSSSLQVLRLTQNSLTGEIPPALFNSSTLTTIYLDRNNLVGSI 286

Query: 678 P 680
           P
Sbjct: 287 P 287



>gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0708B04.
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/147 (27%), Positives = 65/147 (44%), Gaps = 20/147 (13%)
 Frame = +3

Query: 300 VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAP---- 461
           V+  P L F ++ +     AL A +Q ++ DP    ++W    V  C++  V C+     
Sbjct: 14  VSYAPFLAFSSEPLNPEVEALIAIRQGLV-DPHGVLNNWDEDSVDPCSWAMVTCSAHNLV 72

Query: 462 ----APDN----------PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
               AP              +  +  + L +++I G LP ELG L  L    +++NRF G
Sbjct: 73  IGLGAPSQGLSGTLSGRIANLTNLEQVLLQNNNITGRLPPELGALPRLQTLDLSNNRFSG 132

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
            +P     L  L  L ++NN  +G FP
Sbjct: 133 RVPDTLGRLSTLRYLRLNNNSLSGAFP 159



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P+++T   +DL+++  +G +P+ LG L+ L    +N+N   G  P     +  L  LD+S
Sbjct: 118 PRLQT---LDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLS 174

Query: 654 NNRFAGKFP 680
            N   G  P
Sbjct: 175 YNNLTGPVP 183



>gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0708B04.
          Length = 493

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/147 (27%), Positives = 65/147 (44%), Gaps = 20/147 (13%)
 Frame = +3

Query: 300 VTVDPSLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAP---- 461
           V+  P L F ++ +     AL A +Q ++ DP    ++W    V  C++  V C+     
Sbjct: 14  VSYAPFLAFSSEPLNPEVEALIAIRQGLV-DPHGVLNNWDEDSVDPCSWAMVTCSAHNLV 72

Query: 462 ----APDN----------PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
               AP              +  +  + L +++I G LP ELG L  L    +++NRF G
Sbjct: 73  IGLGAPSQGLSGTLSGRIANLTNLEQVLLQNNNITGRLPPELGALPRLQTLDLSNNRFSG 132

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
            +P     L  L  L ++NN  +G FP
Sbjct: 133 RVPDTLGRLSTLRYLRLNNNSLSGAFP 159



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P+++T   +DL+++  +G +P+ LG L+ L    +N+N   G  P     +  L  LD+S
Sbjct: 118 PRLQT---LDLSNNRFSGRVPDTLGRLSTLRYLRLNNNSLSGAFPSSLAKIPQLSFLDLS 174

Query: 654 NNRFAGKFP 680
            N   G  P
Sbjct: 175 YNNLTGPVP 183



>gb:AP002862_1823249 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0036E02.
          Length = 212

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++A+ +DPR     W  + V  C +  V C  A        V  +DL + +++G+
Sbjct: 28  ALYALRRAL-ADPRGVLQSWDPTLVNPCTWFHVTCDRAG------RVTRLDLGNSNLSGH 80

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  +LK L  LD+ NN   G  P
Sbjct: 81  LAPELGHLEHLQYLELYKNNIQGTIPAELGSLKNLISLDLYNNNITGTIP 130



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL +++I G +P+ELG L+ L    +N N   G IP+    +  L  +D+SNN
Sbjct: 112 LKNLISLDLYNNNITGTIPKELGKLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNN 171

Query: 660 RFAGKFP 680
              G  P
Sbjct: 172 DLCGTIP 178



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K+ ++  + LN + + G +P +L  ++ L V  +++N  CGTIP
Sbjct: 135 KLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNNDLCGTIP 178



>gb:AP001551_1821338 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0451C06.>gb:AP003052_1824479 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0016I09.
          Length = 683

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 19/123 (15%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAP-----------------APDNP 476
           +AL   ++ + +DP     DW  +D   C ++GV C                   AP+  
Sbjct: 47  MALLELRERVEADPHGALRDWDPADATPCRWSGVHCFDGKVEILNLTGRELVGTLAPEIG 106

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + S+ L +++  G +P+E G L  L V  ++SN   GTIP++   + +L +L + +
Sbjct: 107 RLQLLKSLILRNNNFRGKIPKEFGGLTALEVLDLSSNNLDGTIPEELMAMPLLKQLSLHD 166

Query: 657 NRF 665
           N+F
Sbjct: 167 NQF 169



>gb:AP000815_1820620 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0003H10.
          Length = 214

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++A+ +DPR     W  + V  C +  V C  A        V  +DL + +++G+
Sbjct: 30  ALYALRRAL-ADPRGVLQSWDPTLVNPCTWFHVTCDRAG------RVTRLDLGNSNLSGH 82

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  +LK L  LD+ NN   G  P
Sbjct: 83  LAPELGHLEHLQYLELYKNNIQGTIPAELGSLKNLISLDLYNNNITGTIP 132



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL +++I G +P+ELG L+ L    +N N   G IP+    +  L  +D+SNN
Sbjct: 114 LKNLISLDLYNNNITGTIPKELGKLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNN 173

Query: 660 RFAGKFP 680
              G  P
Sbjct: 174 DLCGTIP 180



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 14/44 (31%), Positives = 27/44 (61%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K+ ++  + LN + + G +P +L  ++ L V  +++N  CGTIP
Sbjct: 137 KLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNNDLCGTIP 180



>gb:AK176791_1818779 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-33-L05.
          Length = 218

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTS--DWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ SDP N     D    + C +  V C       +   V  +DL + +++G+
Sbjct: 33  ALHALRRSL-SDPDNVVQSRDPTLVNPCTWFHVTCN------QHHQVTRLDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   GK P
Sbjct: 86  LVPELGKLEHLQYLELYKNEIQGTIPSELGNLKSLISLDLYNNNLTGKIP 135



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+DL ++++ G +P  LG L  L    +N NR  G IP++   +  L  +D+S N
Sbjct: 117 LKSLISLDLYNNNLTGKIPSSLGKLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGN 176

Query: 660 RFAGKFP 680
              G  P
Sbjct: 177 DLCGTIP 183



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 15/44 (34%), Positives = 28/44 (63%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++++  + LN + + G +P EL +++ L V  ++ N  CGTIP
Sbjct: 140 KLKSLVFLRLNENRLTGPIPRELTVISSLKVVDVSGNDLCGTIP 183



>gb:AF466199_1802194 Sorghum bicolor putative receptor protein
           kinase, aminoalcoholphosphotransferase, putative
           growth-regulating factor 1, putative GAG-POL precursor,
           putative GAG-POL precursor, putative RIRE2 orf3,
           putative anthocyanin regulatory C1, putative protein
           T30F21.6, putative copia polyprotein, putative copia
           polyprotein, putative protein NP_196765.1, and gb
           protein genes, complete cds; and putative zinc finger
           protein gene, partial cds.
          Length = 921

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 31/113 (27%), Positives = 48/113 (42%), Gaps = 19/113 (16%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAP-------------------APDNPKIRTVASIDLNHDDI 521
           N   DW G D C++ GV C                     +P    ++++ SIDL  + +
Sbjct: 38  NVLYDWAGDDYCSWRGVLCDNVTFAVAALNLSGLNLEGEISPAVGSLKSLVSIDLKSNGL 97

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +G +P+E+G  + L     + N   G IP     LK L  L + NN+  G  P
Sbjct: 98  SGQIPDEIGDCSSLRTLDFSFNNLDGDIPFSISKLKHLENLILKNNQLIGAIP 150



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +I  + ++DL+ + + G +P  +G L  L   +++ N   G IP +F NL+ + E+D+S 
Sbjct: 394 RINNLDTLDLSCNMMTGPIPSSIGSLEHLLRLNLSKNGLVGFIPAEFGNLRSVMEIDLSY 453

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 454 NHLGGLIP 461



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 19/67 (28%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +A +DL+++ ++G +P  LG L      +I  N+  G+IP +  N+  L  L++++N
Sbjct: 251 MQALAVLDLSYNQLSGPIPSILGNLTYTEKLYIQGNKLTGSIPPELGNMSTLHYLELNDN 310

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 311 QLTGSIP 317



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/77 (31%), Positives = 35/77 (45%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
           F  P P N     VA++ L  +   G +P  +GL+  L V  ++ N+  G IP    NL 
Sbjct: 217 FTGPIPFNIGFLQVATLSLQGNKFTGPIPSVIGLMQALAVLDLSYNQLSGPIPSILGNLT 276

Query: 630 ILFELDISNNRFAGKFP 680
              +L I  N+  G  P
Sbjct: 277 YTEKLYIQGNKLTGSIP 293



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P ELG ++ L    +N N+  G+IP +   L  LF+L+++NN   G  P
Sbjct: 288 LTGSIPPELGNMSTLHYLELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIP 341



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 18/68 (26%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ + ++ L ++ + G +P  L  L +L +  +  N+  G IP+     ++L  LD+ N
Sbjct: 131 KLKHLENLILKNNQLIGAIPSTLSQLPNLKILDLAQNKLTGEIPRLIYWNEVLQYLDVKN 190

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 191 NSLTGVIP 198



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 14/43 (32%), Positives = 29/43 (67%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           +R+V  IDL+++ + G +P+EL +L +L + +++ N   G +P
Sbjct: 443 LRSVMEIDLSYNHLGGLIPQELEMLQNLMLLNVSYNNLAGVVP 485



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ + + G++P E G L  +    ++ N   G IP++ + L+ L  L++S N  AG  
Sbjct: 425 LNLSKNGLVGFIPAEFGNLRSVMEIDLSYNHLGGLIPQELEMLQNLMLLNVSYNNLAGVV 484

Query: 678 P 680
           P
Sbjct: 485 P 485



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 23/96 (23%), Positives = 42/96 (43%), Gaps = 24/96 (25%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLL------------------------ADLGVF 572
           P+   + T+  ++LN + + G +P ELG L                         +L  F
Sbjct: 294 PELGNMSTLHYLELNDNQLTGSIPPELGRLTGLFDLNLANNHLEGPIPDNLSSCVNLNSF 353

Query: 573 HINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +   N+  GTIP+  + L+ +  L++S+N  +G  P
Sbjct: 354 NAYGNKLNGTIPRSLRKLESMTYLNLSSNFISGSIP 389



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 1/75 (1%)
 Frame = +3

Query: 459 PAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL 635
           P PDN      + S +   + + G +P  L  L  +   +++SN   G+IP +   +  L
Sbjct: 339 PIPDNLSSCVNLNSFNAYGNKLNGTIPRSLRKLESMTYLNLSSNFISGSIPIELSRINNL 398

Query: 636 FELDISNNRFAGKFP 680
             LD+S N   G  P
Sbjct: 399 DTLDLSCNMMTGPIP 413



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 18/61 (29%), Positives = 26/61 (42%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL  + + G +P  +     L    + +N   G IP    N      LD+S NRF G  
Sbjct: 162 LDLAQNKLTGEIPRLIYWNEVLQYLDVKNNSLTGVIPDTIGNCTSFQVLDLSYNRFTGPI 221

Query: 678 P 680
           P
Sbjct: 222 P 222



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + S+DL  ++  G++PE LG L  L    +N+N   G+IPK   N+  L  LD+SNN
Sbjct: 121 LTNLVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNN 180

Query: 660 RFAGKFP 680
             +G+ P
Sbjct: 181 NLSGEVP 187



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++  D  N    W  + V  C +  V C P  DN  IR    +DL +  ++G 
Sbjct: 37  ALYSLRQSL-KDANNVLQSWDPTLVNPCTWFHVTCNP--DNSVIR----VDLGNAQLSGA 89

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L +L    + SN   GTIP +  NL  L  LD+  N F G  P
Sbjct: 90  LVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIP 139



>gb:LHJ002235_1684902 Lycopersicon hirsutum Cf-4 resistance gene
           cluster.
          Length = 862

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 4/111 (3%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDVC-NYTGVFCAPAPDNPKIRTVAS---IDLNHDDIAG 527
           LQA K+    D    T +++ SD+C NY         D   +R V S   I+L+ +   G
Sbjct: 626 LQAMKKI---DESTRTPEYI-SDICYNYLTTITTKGQDYDSVRIVDSNMIINLSKNRFEG 681

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +P  +G L  L   +++ N   G IP  F+NL +L  LD+S+N+ +G+ P
Sbjct: 682 RIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIP 732



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D + + + G +P  +  L +L   +++SN   G+IP    +L  L ELD+ NN F+GK
Sbjct: 367 LDFSSNSLTGPIPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLRNNTFSGK 425



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 18/62 (29%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+H+ + G++P     L+ L    ++SN+  G IP++  +L  L  L++S+N   G 
Sbjct: 695 TLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEFLNLSHNHLVGC 754

Query: 675 FP 680
            P
Sbjct: 755 IP 756



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/105 (21%), Positives = 42/105 (40%), Gaps = 11/105 (10%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVA-----------SIDLNHDDIAGYLPEEL 545
           N  S  + S +CN   +       N    T+            S+DL+++ ++G +    
Sbjct: 465 NNISGRISSSICNLKMLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSLSGTINTTF 524

Query: 546 GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +        ++ N+  G +P+   N K L  LD+ NN+    FP
Sbjct: 525 SIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFP 569



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K +T++ + L  + + G +P  L L   L    ++ N   G I     NLK+L  LD+ +
Sbjct: 430 KSKTLSVVSLQKNQLEGPIPNSL-LNQSLFYLLLSHNNISGRISSSICNLKMLISLDLGS 488

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 489 NNLEGTIP 496



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK-IL 635
           P P++   +++  + L+H++I+G +   +  L  L    + SN   GTIP+    +K  L
Sbjct: 447 PIPNSLLNQSLFYLLLSHNNISGRISSSICNLKMLISLDLGSNNLEGTIPQCVGEMKENL 506

Query: 636 FELDISNNRFAG 671
           + LD+SNN  +G
Sbjct: 507 WSLDLSNNSLSG 518



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-----FKNLKILFELDISNNR 662
           +DL ++ +    P  LG L+ L +  + SN+  G I        F  L+I   LD+S+N 
Sbjct: 557 LDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFTRLQI---LDLSSNG 613

Query: 663 FAGKFP 680
           F+G  P
Sbjct: 614 FSGNLP 619



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+DL+ + I+G +P++L  L  L   +++ N   G IPK
Sbjct: 714 LSVLESLDLSSNKISGEIPQQLASLTFLEFLNLSHNHLVGCIPK 757



>gb:BT002951_1636538 Arabidopsis thaliana clone RAFL15-05-K09
           (R20323) putative leucine-rich repeat transmembrane
           protein kinase (At1g12460) mRNA, complete cds.
          Length = 882

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 20/140 (14%)
 Frame = +3

Query: 321 TFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGS-DVCN-YTGVFCAP----------- 461
           T  +D I    I LQ +K +I  DP N+ + WV   D+CN + G+ C P           
Sbjct: 18  TSRSDSISERDILLQ-FKGSISDDPYNSLASWVSDGDLCNSFNGITCNPQGFVDKIVLWN 76

Query: 462 -------APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
                  AP    ++ +  ++L  +   G LP +   L  L   +++SN   G IP+   
Sbjct: 77  TSLAGALAPGLSNLKFIRVLNLFGNRFTGNLPLDYFKLQTLWTINVSSNALSGPIPEFIS 136

Query: 621 NLKILFELDISNNRFAGKFP 680
            L  L  LD+S N F G+ P
Sbjct: 137 ELSSLRFLDLSKNGFTGEIP 156



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/71 (28%), Positives = 39/71 (54%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D    R +  +D++ +D+ G + ++L  L ++ +  ++ NR  G+IP +  NL  +  LD
Sbjct: 375 DISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSIPPELGNLSKVQFLD 434

Query: 648 ISNNRFAGKFP 680
           +S N  +G  P
Sbjct: 435 LSQNSLSGPIP 445



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 18/67 (26%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  +  +DL+ + + G +P ELG L+ +    ++ N   G IP    +L  L   ++S N
Sbjct: 403 LTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYN 462

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 463 NLSGVIP 469



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/66 (25%), Positives = 34/66 (51%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  +DL  + + G +P  +G +  L V  + +N   G IP+   +L+ L  L++ N  
Sbjct: 308 KSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLN 367

Query: 663 FAGKFP 680
             G+ P
Sbjct: 368 LIGEVP 373



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 24/92 (26%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ +++ I L ++ I G +P ++G L  L V ++++    G +P+   N ++L ELD+S 
Sbjct: 330 KMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSG 389

Query: 657 N------------------------RFAGKFP 680
           N                        R  G  P
Sbjct: 390 NDLEGKISKKLLNLTNIKILDLHRNRLNGSIP 421



>gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putative
           leucine-rich repeat receptor-like kinase genes, complete
           cds.
          Length = 1049

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 11/109 (10%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP-----------KIRTVASIDLNHDDIAG 527
           ++    N  S  +   + N T + C   P+N            K+  +A++DL  ++ +G
Sbjct: 232 VLKAGHNNLSGTLPDGIFNATSLECLSFPNNDFQGTLEWANVVKLSKLATLDLGENNFSG 291

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            + E +G L  L   H+N+N+  G+IP    N   L  +D++NN F+G+
Sbjct: 292 NISESIGQLNRLEELHLNNNKMFGSIPSNLSNCTSLKIIDLNNNNFSGE 340



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 30/100 (30%), Positives = 46/100 (46%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLAD 560
           I+S   N T+  +G +  N       P         +  + L+   ++G +P  L  L+ 
Sbjct: 419 ILSSSSNLTTLLIGHNFMNER----MPDGSIDSFENLQVLSLSECSLSGKIPRWLSKLSR 474

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L V  +++NR  G IP    +L  LF LDISNN   G+ P
Sbjct: 475 LEVLELDNNRLTGPIPDWISSLNFLFYLDISNNSLTGEIP 514



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/61 (34%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++  G +P E+GLL  L   +++ N+  G IP+   NL  L  LD+S+N   G  
Sbjct: 560 LNLGKNEFTGLIPPEIGLLKVLLSLNLSFNKLYGDIPQSICNLTDLLVLDLSSNNLTGTI 619

Query: 678 P 680
           P
Sbjct: 620 P 620



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 23/84 (27%), Positives = 40/84 (47%)
 Frame = +3

Query: 420 GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           G+D C + G+ C+      +  TV  + L    + G++   LG L  L   +++ N   G
Sbjct: 65  GTDCCKWDGITCS------QDSTVTDVSLASRSLQGHISPSLGNLPGLLRLNLSHNLLSG 118

Query: 600 TIPKKFKNLKILFELDISNNRFAG 671
            +PK+  +   L  +D+S NR  G
Sbjct: 119 ALPKELLSSSSLIAIDVSFNRLDG 142



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/62 (29%), Positives = 34/62 (54%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P ++T   +DL  ++ +G +PE +   ++L    ++SN+  G + K   NLK L  L ++
Sbjct: 350 PNLKT---LDLMRNNFSGEIPESIYTCSNLTALRVSSNKLHGQLSKGLGNLKSLSFLSLA 406

Query: 654 NN 659
            N
Sbjct: 407 GN 408



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
           embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 25/67 (37%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + S+DL  ++  G++PE LG L  L    +N+N   G+IPK   N+  L  LD+SNN
Sbjct: 121 LTNLVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQVLDLSNN 180

Query: 660 RFAGKFP 680
             +G+ P
Sbjct: 181 NLSGEVP 187



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++  D  N    W  + V  C +  V C P  DN  IR    +DL +  ++G 
Sbjct: 37  ALYSLRQSL-KDANNVLQSWDPTLVNPCTWFHVTCNP--DNSVIR----VDLGNAQLSGA 89

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L +L    + SN   GTIP +  NL  L  LD+  N F G  P
Sbjct: 90  LVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIP 139



>gb:AY332472_1600054 Oryza sativa (japonica cultivar-group)
           transmembrane kinase (PK1) mRNA, complete cds.
          Length = 677

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 19/123 (15%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAP-----------------APDNP 476
           +AL   ++ + +DP     DW  +D   C ++GV C                   AP+  
Sbjct: 47  MALLELRERVEADPHGALRDWDPADATPCRWSGVHCFDGKVEILNLTGRELVGTLAPEIG 106

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + S+ L +++  G +P+E G L  L V  ++SN   GTIP++   + +L +L + +
Sbjct: 107 RLQLLKSLILRNNNFRGKIPKEFGGLTALEVLDLSSNNLDGTIPEELMAMPLLKQLSLHD 166

Query: 657 NRF 665
           N+F
Sbjct: 167 NQF 169



>gb:AB162660_1528632 Ipomoea batatas CLAVATA-1 gene for protein
           kinase, exon 1, partial cds, Rtsp-1 target site.
          Length = 851

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +3

Query: 429 VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           VC     F +  P     + +  +DL+++ I G +P   G L +L    ++SNRF G IP
Sbjct: 442 VCLQNNYFSSELPTKMLAKNLTDLDLHNNRINGQIPPAFGNLENLWKLSLHSNRFSGKIP 501

Query: 609 KKFKNLKILFELDISNNRFAGKFP 680
            +  +LK +  +D+S+N   G+ P
Sbjct: 502 NQISHLKKMVTMDLSSNSLTGEVP 525



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+ +++ +G LP E+  L  L + ++  N F G IP+ + N+  L  L++  N   G  
Sbjct: 152 LDVYNNNFSGRLPHEVVKLKKLKILNLGGNYFTGEIPEIYSNISSLQTLNLQTNSLTGNI 211

Query: 678 P 680
           P
Sbjct: 212 P 212



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/69 (27%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           K+ ++ +I+++++ ++G+ P E+ + + +L V  + +N F G +P +   LK L  L++ 
Sbjct: 120 KLTSIKAINMSNNLLSGHFPGEILVGMTELQVLDVYNNNFSGRLPHEVVKLKKLKILNLG 179

Query: 654 NNRFAGKFP 680
            N F G+ P
Sbjct: 180 GNYFTGEIP 188



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  +DL+ +++ G +P+ L  L  L + ++  N F GTIP    +L  L  L + NN
Sbjct: 291 LESLVHLDLSENNMMGEIPQSLAELKSLVLINLFRNTFQGTIPAFIGDLPKLEVLQLWNN 350

Query: 660 RFAGKFP 680
            F  + P
Sbjct: 351 NFTSELP 357



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V S+ ++   + G LP E+GLL  L    + S    G +P +   L  +  +++SNN  +
Sbjct: 76  VISLAISAVPLFGSLPPEIGLLDRLLNLTLTSVNLSGALPSEMAKLTSIKAINMSNNLLS 135

Query: 669 GKFP 680
           G FP
Sbjct: 136 GHFP 139



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++++  I+L  +   G +P  +G L  L V  + +N F   +P      + L  LD+S+
Sbjct: 314 ELKSLVLINLFRNTFQGTIPAFIGDLPKLEVLQLWNNNFTSELPVNLGRNRRLRFLDVSS 373

Query: 657 NRFAGKFP 680
           N+ +G+ P
Sbjct: 374 NQISGRVP 381



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/50 (34%), Positives = 23/50 (46%)
 Frame = +3

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +P ELG +  L +  +      G IPK   NLK L+ L +  N   G  P
Sbjct: 236 IPPELGSITTLQMLDLRECNLSGEIPKSLGNLKQLYFLYLYGNSLTGHIP 285



>gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBM17.
          Length = 1102

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 23/120 (19%)
 Frame = +3

Query: 390 DPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTV---------------------ASI 500
           D +    +W  +D   C +TGV C+    +P++ ++                       +
Sbjct: 43  DAKQNLRNWNSNDSVPCGWTGVMCSNYSSDPEVLSLNLSSMVLSGKLSPSIGGLVHLKQL 102

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL+++ ++G +P+E+G  + L +  +N+N+F G IP +   L  L  L I NNR +G  P
Sbjct: 103 DLSYNGLSGKIPKEIGNCSSLEILKLNNNQFDGEIPVEIGKLVSLENLIIYNNRISGSLP 162



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  +   G LP E+G+L+ LG  +I+SN+  G +P +  N K+L  LD+  N F+G  
Sbjct: 510 LQLADNGFTGELPREIGMLSQLGTLNISSNKLTGEVPSEIFNCKMLQRLDMCCNNFSGTL 569

Query: 678 P 680
           P
Sbjct: 570 P 570



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID + + + G +P ELG +  L + ++  N+  GTIP +   LK L +LD+S N   G  
Sbjct: 318 IDFSENALTGEIPLELGNIEGLELLYLFENQLTGTIPVELSTLKNLSKLDLSINALTGPI 377

Query: 678 P 680
           P
Sbjct: 378 P 378



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++ L  + + G +P+ELG L  L   ++  N   GTIP++  NL    E+D S N  
Sbjct: 266 SLETLALYKNQLVGPIPKELGDLQSLEFLYLYRNGLNGTIPREIGNLSYAIEIDFSENAL 325

Query: 666 AGKFP 680
            G+ P
Sbjct: 326 TGEIP 330



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+  ++ +G LP E+G L  L +  +++N   GTIP    NL  L EL +  N F G  
Sbjct: 558 LDMCCNNFSGTLPSEVGSLYQLELLKLSNNNLSGTIPVALGNLSRLTELQMGGNLFNGSI 617

Query: 678 P 680
           P
Sbjct: 618 P 618



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 18/66 (27%), Positives = 34/66 (51%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +T+  + L  +++ G  P  L    ++    +  NRF G+IP++  N   L  L +++N 
Sbjct: 457 KTLVQLRLARNNLVGRFPSNLCKQVNVTAIELGQNRFRGSIPREVGNCSALQRLQLADNG 516

Query: 663 FAGKFP 680
           F G+ P
Sbjct: 517 FTGELP 522



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 19/65 (29%), Positives = 33/65 (50%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  + L  + ++G LP+E+G+L  L    +  N F G IP++  N   L  L +  N+ 
Sbjct: 218 SLVMLGLAQNQLSGELPKEIGMLKKLSQVILWENEFSGFIPREISNCTSLETLALYKNQL 277

Query: 666 AGKFP 680
            G  P
Sbjct: 278 VGPIP 282



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ ++ +DL+ + + G +P     L  L +  +  N   GTIP K      L+ LD+S+N
Sbjct: 360 LKNLSKLDLSINALTGPIPLGFQYLRGLFMLQLFQNSLSGTIPPKLGWYSDLWVLDMSDN 419

Query: 660 RFAGKFP 680
             +G+ P
Sbjct: 420 HLSGRIP 426



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ ++ ++ + ++ I+G LP E+G L  L      SN   G +P+   NLK L       
Sbjct: 143 KLVSLENLIIYNNRISGSLPVEIGNLLSLSQLVTYSNNISGQLPRSIGNLKRLTSFRAGQ 202

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 203 NMISGSLP 210



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S     + I+G LP E+G    L +  +  N+  G +PK+   LK L ++ +  N
Sbjct: 192 LKRLTSFRAGQNMISGSLPSEIGGCESLVMLGLAQNQLSGELPKEIGMLKKLSQVILWEN 251

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 252 EFSGFIP 258



>gb:AE016959_1023555 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091680_1734896
           Oryza sativa chromosome 10 BAC OSJNBa0034L04 genomic
           sequence, complete sequence.>gb:AE017114_1753374 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           68 of 77 of the complete sequence.
          Length = 737

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/128 (28%), Positives = 55/128 (42%), Gaps = 20/128 (15%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNPKIR---------------- 485
           AL AWK ++  D   + SDW   + VC + GV C  A     +R                
Sbjct: 40  ALLAWKASL--DDAASLSDWTRAAPVCTWRGVACDAAGSVASLRLRSLRLRGGIHALDFA 97

Query: 486 ---TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
               +  +DLN + + G +P  +  L  L    + SN F G+IP +F +L  L +L + N
Sbjct: 98  ALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGLVDLRLYN 157

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 158 NNLVGAIP 165



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKI-RTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPK 611
           +TGVF    P + ++ + + ++D+ ++   G +P  +G  L  L    + SN F G IP 
Sbjct: 572 FTGVF----PSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPS 627

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +  NL  L  LDISNN   G  P
Sbjct: 628 ELSNLSQLQLLDISNNGLTGLIP 650



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 29/113 (25%), Positives = 46/113 (40%), Gaps = 11/113 (9%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP----------KIRTVASIDLNHDDIA 524
           Q +     N+++   GSD C    +      +N            ++ +  IDL+++  +
Sbjct: 489 QGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFS 548

Query: 525 GYLPE-ELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +P  +      L   H+  N F G  P   +  K L  LDI NNRF G  P
Sbjct: 549 GEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIP 601



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-FKNLKILFE 641
           P+   ++ +  ++L+ + ++G LP E   +  + VF I++N   G IP   F +   L  
Sbjct: 335 PELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELIS 394

Query: 642 LDISNNRFAGKFP 680
             + NN F GK P
Sbjct: 395 FQVQNNLFTGKIP 407



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 21/62 (33%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S  + ++   G +P ELG    L V  +  NR  G+IP    +L  L +LD+S+N   G 
Sbjct: 394 SFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGG 453

Query: 675 FP 680
            P
Sbjct: 454 IP 455



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL  + + G +P  LG L  L    I +     T+P +  NLK L  +++S N+ +G  
Sbjct: 298 LDLGFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGL 357

Query: 678 P 680
           P
Sbjct: 358 P 358



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 25/95 (26%), Positives = 39/95 (41%), Gaps = 28/95 (29%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN------------ 623
           + ++  +DL+ +D+ G +P ELG L+ L    ++ N   G IP    N            
Sbjct: 437 LTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSG 496

Query: 624 ----------------LKILFELDISNNRFAGKFP 680
                           LKIL+   +SNN+  GK P
Sbjct: 497 NSSNSRSGSDFCQLLSLKILY---LSNNKLTGKLP 528



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           + L  ++  G +P EL  L+ L +  I++N   G IPK F NL
Sbjct: 614 LSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNL 656



>gb:AE005172_891598 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC000348_1530077 Genomic sequence
           for Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.>gb:BT015801_1642419 Arabidopsis
           thaliana At1g27190 gene, complete cds.
          Length = 601

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 6/115 (5%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDWV-----GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD 518
           + LQ  K ++I DP +  S W       S +C  TGV C     N K   + S+ L    
Sbjct: 29  LCLQGLKNSLI-DPSSRLSSWSFPNSSASSICKLTGVSCW----NEKENRIISLQLQSMQ 83

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN-LKILFELDISNNRFAGKFP 680
           +AG +PE L L   L    ++ N   G+IP +  + L  L  LD+S N+  G  P
Sbjct: 84  LAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIP 138



>gb:AJ585978_1811746 Arabidopsis thaliana rpp27 gene, exons
            1-6.>gb:AJ585979_1811747 Arabidopsis thaliana mRNA for
            RPP27 protein.
          Length = 1044

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 45/81 (55%)
 Frame = +3

Query: 438  YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
            Y   F A   +N  +  +  +DL+ ++++G +P ELG L+ L V +++ N    +IP  F
Sbjct: 840  YDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSF 899

Query: 618  KNLKILFELDISNNRFAGKFP 680
             NLK +  LD+S+N   G  P
Sbjct: 900  SNLKDIESLDLSHNMLQGSIP 920



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D + +DI+G LP+ +G  L +L   + + N F G +P     +  +  LD+S N F+GK
Sbjct: 506 LDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGK 565

Query: 675 FP 680
            P
Sbjct: 566 LP 567



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T++ +D++++ + G +P  +  L+ L +  I++N   GTIP     +  L  +D+S N  
Sbjct: 625 TLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLL 684

Query: 666 AGKFP 680
           +G  P
Sbjct: 685 SGSLP 689



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 15/44 (34%), Positives = 29/44 (65%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
            ++ + S+DL+H+ + G +P++L  L+ L VF ++ N   G IP+
Sbjct: 902  LKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQ 945



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKF-KNLKILFELDISNNRFAGKF 677
           G+LP  +G + ++    ++ N F G +P++F      L  L +S+N F+G F
Sbjct: 540 GHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHF 591



>gb:OSJN00299_1698204 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: B1358B12, complete sequence.
          Length = 669

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 19/121 (15%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSD-VCNYTGVFCA------------------PAPDNPKIRTVAS 497
           QA I+   + T  W  S   C++TGV C+                  P      +  +A 
Sbjct: 33  QAFIAPFGSATVSWNTSQPTCSWTGVVCSGGRVVEVHLPGVGLRGNVPVGALGGLDKLAV 92

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L ++ ++G LP +L   A+L V ++ SN F G +P +   L  L +L+++ NRF+G+ 
Sbjct: 93  LSLRYNALSGPLPSDLAKCAELRVINLQSNHFSGELPPEILALPALTQLNLAENRFSGRI 152

Query: 678 P 680
           P
Sbjct: 153 P 153



>gb:AY237117_1592110 Capsicum annuum leucine-rich repeat protein
           (LRR1) mRNA, complete cds.
          Length = 197

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A+K  ++ DP N    W  + V  C +  V C          +V  +DL   +++G 
Sbjct: 26  ALNAFKMNML-DPNNALQSWDPTLVNPCTWLHVTCNIQ------NSVTRVDLGGANLSGI 78

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG+L +L    + +N   G IP++ +NL  L  L + NN+ +G  P
Sbjct: 79  LTPQLGVLYNLQYLQVENNSISGAIPRELRNLTNLLSLGLENNKLSGTIP 128



>pir|F96586|F96586 hypothetical protein F20D21.29 [imported] -
           Arabidopsis thaliana>gb:AE005173_893346 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005287_1532402 Arabidopsis thaliana
           chromosome I BAC F20D21 genomic sequence, complete
           sequence.
          Length = 818

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 27/81 (33%), Positives = 45/81 (55%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           Y   F A   +N  +  +  +DL+ ++++G +P ELG L+ L V +++ N    +IP  F
Sbjct: 614 YDSYFGATEFNNDVLDYMYGMDLSSNELSGVIPAELGSLSKLRVMNLSCNFLSSSIPSSF 673

Query: 618 KNLKILFELDISNNRFAGKFP 680
            NLK +  LD+S+N   G  P
Sbjct: 674 SNLKDIESLDLSHNMLQGSIP 694



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D + +DI+G LP+ +G  L +L   + + N F G +P     +  +  LD+S N F+GK
Sbjct: 280 LDFSVNDISGLLPDNIGYALPNLLRMNGSRNGFQGHLPSSMGEMVNITSLDLSYNNFSGK 339

Query: 675 FP 680
            P
Sbjct: 340 LP 341



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T++ +D++++ + G +P  +  L+ L +  I++N   GTIP     +  L  +D+S N  
Sbjct: 399 TLSVLDMSNNFLTGDIPSWMSNLSGLTILSISNNFLEGTIPPSLLAIGFLSLIDLSGNLL 458

Query: 666 AGKFP 680
           +G  P
Sbjct: 459 SGSLP 463



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 15/44 (34%), Positives = 29/44 (65%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           ++ + S+DL+H+ + G +P++L  L+ L VF ++ N   G IP+
Sbjct: 676 LKDIESLDLSHNMLQGSIPQQLTNLSSLVVFDVSYNNLSGIIPQ 719



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKF-KNLKILFELDISNNRFAGKF 677
           G+LP  +G + ++    ++ N F G +P++F      L  L +S+N F+G F
Sbjct: 314 GHLPSSMGEMVNITSLDLSYNNFSGKLPRRFVTGCFSLKHLKLSHNNFSGHF 365



>gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 978

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 19/113 (16%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAP-------------------APDNPKIRTVASIDLNHDDI 521
           N   DW G D C++ GV C                     +P   +++ + SIDL  + +
Sbjct: 42  NVLYDWAGGDYCSWRGVLCDNVTFAVAALNLSGLNLGGEISPAVGRLKGIVSIDLKSNGL 101

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +G +P+E+G  + L    ++ N   G IP     LK +  L + NN+  G  P
Sbjct: 102 SGQIPDEIGDCSSLKTLDLSFNSLDGDIPFSVSKLKHIESLILKNNQLIGVIP 154



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P ELG ++ L    +N N+  G IP +F  L  LF+L+++NN F G  P
Sbjct: 316 LTGPIPPELGNMSTLHYLELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIP 369



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 22/68 (32%), Positives = 39/68 (57%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +I  + ++DL+ + I G +P  +G L  L   ++++N   G IP +  NL+ + E+D+SN
Sbjct: 422 RINNLDTLDLSCNMITGPIPSTIGSLEHLLRLNLSNNGLVGFIPAEIGNLRSIMEIDMSN 481

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 482 NHLGGLIP 489



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/67 (29%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  ID++++ + G +P+ELG+L +L + ++ +N   G +     N   L  L++S N
Sbjct: 471 LRSIMEIDMSNNHLGGLIPQELGMLQNLMLLNLKNNNITGDV-SSLMNCFSLNILNVSYN 529

Query: 660 RFAGKFP 680
             AG  P
Sbjct: 530 NLAGVVP 536



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   + T+  ++LN + ++G++P E G L  L   ++ +N F G IP    +   L   
Sbjct: 322 PELGNMSTLHYLELNDNQLSGFIPPEFGKLTGLFDLNLANNNFEGPIPDNISSCVNLNSF 381

Query: 645 DISNNRFAGKFP 680
           +   NR  G  P
Sbjct: 382 NAYGNRLNGTIP 393



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 16/58 (27%), Positives = 34/58 (58%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           ++L+++ + G++P E+G L  +    +++N   G IP++   L+ L  L++ NN   G
Sbjct: 453 LNLSNNGLVGFIPAEIGNLRSIMEIDMSNNHLGGLIPQELGMLQNLMLLNLKNNNITG 510



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/94 (22%), Positives = 38/94 (40%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHI 578
           N     +  D+C  TG++                D+ ++ + G +PE +G      V  +
Sbjct: 195 NNLEGSISPDICQLTGLWY--------------FDVKNNSLTGPIPETIGNCTSFQVLDL 240

Query: 579 NSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + N+  G+IP     L++   L +  N F G  P
Sbjct: 241 SYNKLSGSIPFNIGFLQVA-TLSLQGNMFTGPIP 273



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P PDN      + S +   + + G +P  L  L  +   +++SN   G+IP +   +
Sbjct: 364 FEGPIPDNISSCVNLNSFNAYGNRLNGTIPPSLHKLESMTYLNLSSNFLSGSIPIELSRI 423

Query: 627 KILFELDISNNRFAGKFP 680
             L  LD+S N   G  P
Sbjct: 424 NNLDTLDLSCNMITGPIP 441



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 16/61 (26%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  +++ G +  ++  L  L  F + +N   G IP+   N      LD+S N+ +G  
Sbjct: 190 LGLRGNNLEGSISPDICQLTGLWYFDVKNNSLTGPIPETIGNCTSFQVLDLSYNKLSGSI 249

Query: 678 P 680
           P
Sbjct: 250 P 250



>gb:AF528600_1808627 Arabidopsis thaliana ecotype Chi-1
           receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528601_1808628 Arabidopsis thaliana ecotype
           Ws-0 receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.
          Length = 310

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 26/69 (37%), Positives = 44/69 (63%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L + +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPATFVSLKELREV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRDLG 84



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 19/55 (34%), Positives = 30/55 (54%)
 Frame = +3

Query: 516 DIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +++G +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G  P
Sbjct: 9   NLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIP 63



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G    N   V   FC+   + P+    ++++  +
Sbjct: 66  FVSLKELREVVLSENRDLGGVIPHWFGDFSMNLERVDISFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   G  P
Sbjct: 126 NLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLP 182



>gb:AF528597_1808624 Arabidopsis thaliana ecotype An-2 receptor-like
           protein CLAVATA2 (CLV2) gene, partial cds.
          Length = 310

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 26/69 (37%), Positives = 44/69 (63%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L + +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPTTFVSLKELREV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRDLG 84



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++G +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 28/124 (22%), Positives = 59/124 (47%), Gaps = 10/124 (8%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRT 488
           I   +++L+  ++ ++S+ R+       W G    N   V   FC+   + P+    +++
Sbjct: 62  IPTTFVSLKELREVVLSENRDLGGVIPHWFGDFSMNLERVDISFCSFVGELPESLLYLKS 121

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  ++L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   
Sbjct: 122 LKYLNLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLV 178

Query: 669 GKFP 680
           G  P
Sbjct: 179 GGLP 182



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



>gb:AF528594_1808621 Arabidopsis thaliana ecotype Cvi-0
           receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528595_1808622 Arabidopsis thaliana ecotype
           Bs-1 receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528596_1808623 Arabidopsis thaliana ecotype
           Lisse-2 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528598_1808625 Arabidopsis thaliana
           ecotype Sf-1 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528599_1808626 Arabidopsis thaliana
           ecotype Bla-1 receptor-like protein CLAVATA2 (CLV2)
           gene, partial cds.
          Length = 310

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 26/69 (37%), Positives = 44/69 (63%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L + +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGSIPATFVSLKELREV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRDLG 84



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++G +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRILNLSRNRFVGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 27/120 (22%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G    N   V   FC+   + P+    ++++  +
Sbjct: 66  FVSLKELREVVLSENRDLGGVIPHWFGDFSMNLERVDISFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   G  P
Sbjct: 126 NLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLP 182



>gb:AF528565_1808577 Zea mays cultivar BSSS53 chromosome 4 clone BAC
           072, complete sequence.
          Length = 665

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 38/120 (31%), Positives = 54/120 (45%), Gaps = 13/120 (10%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDV------------CNYTGVFCAPAPDNPKIRTVASID 503
           L+AW  A    P +  S W G                N +G F   A    K+  + S++
Sbjct: 57  LEAWSAASPFAPCDAASPWPGVQCYKGSLVGIRLTHMNLSGTFDFGAV--AKLPRLHSVN 114

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-FKNLKILFELDISNNRFAGKFP 680
           L H+  +G LP  LG L  L   +++SN F G IP   F N++ L +L + NNR  G  P
Sbjct: 115 LKHNAFSGPLPPSLGTLRGLRALYLSSNNFSGPIPAAVFANMRWLKKLYLDNNRITGPLP 174



>gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1
           (ERL1) mRNA, ERL1-erl1 allele, complete cds.
          Length = 966

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 22/116 (18%)
 Frame = +3

Query: 399 NTTSDWV---GSDVCNYTGVFCAP-------------------APDNPKIRTVASIDLNH 512
           N   DW     SD+C++ GVFC                     +P    +R + SIDL  
Sbjct: 45  NMLLDWDDVHNSDLCSWRGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQG 104

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + +AG +P+E+G  A L    ++ N   G IP     LK L  L++ NN+  G  P
Sbjct: 105 NKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVP 160



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 22/59 (37%), Positives = 36/59 (61%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G +P ELG ++ L    +N N+  GTIP +   L+ LFEL+++N+R  G  P
Sbjct: 317 LHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNLANSRLVGPIP 375



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/72 (31%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  K+  +  ++L +  + G +P  +   A L  F+++ N   G+IP  F+NL  L  L
Sbjct: 352 PELGKLEQLFELNLANSRLVGPIPSNISSCAALNQFNVHGNLLSGSIPLAFRNLGSLTYL 411

Query: 645 DISNNRFAGKFP 680
           ++S+N F GK P
Sbjct: 412 NLSSNNFKGKIP 423



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  ID++ + ++G +P ELG L +L    +N+N+  G IP +  N   L  L++S N
Sbjct: 477 LRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKIPDQLTNCFTLVNLNVSFN 536

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 537 NLSGIVP 543



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ ++  G +P ELG + +L    ++ N F G+IP    +L+ L  L++S N  +G+ 
Sbjct: 411 LNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQL 470

Query: 678 P 680
           P
Sbjct: 471 P 471



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ ++ +G +P  LG L  L + +++ N   G +P +F NL+ +  +D+S N  +G  
Sbjct: 435 LDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVI 494

Query: 678 P 680
           P
Sbjct: 495 P 495



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ + ++G LP E G L  + +  ++ N   G IP +   L+ L  L ++NN+  GK 
Sbjct: 459 LNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKI 518

Query: 678 P 680
           P
Sbjct: 519 P 519



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 22/72 (30%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P N     VA++ L  + + G +PE +GL+  L V  ++ N   G IP    NL    +L
Sbjct: 256 PYNIGFLQVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKL 315

Query: 645 DISNNRFAGKFP 680
            +  N   G  P
Sbjct: 316 YLHGNMLTGPIP 327



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + + G L  ++  L  L  F +  N   GTIP+   N      LDIS N+  G+ 
Sbjct: 196 LGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEI 255

Query: 678 P 680
           P
Sbjct: 256 P 256



>gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMI9.
          Length = 938

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 22/116 (18%)
 Frame = +3

Query: 399 NTTSDWV---GSDVCNYTGVFCAP-------------------APDNPKIRTVASIDLNH 512
           N   DW     SD+C++ GVFC                     +P    +R + SIDL  
Sbjct: 45  NMLLDWDDVHNSDLCSWRGVFCDNVSYSVVSLNLSSLNLGGEISPAIGDLRNLQSIDLQG 104

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + +AG +P+E+G  A L    ++ N   G IP     LK L  L++ NN+  G  P
Sbjct: 105 NKLAGQIPDEIGNCASLVYLDLSENLLYGDIPFSISKLKQLETLNLKNNQLTGPVP 160



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 24/61 (39%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + LN + + G +P ELG L  L   +++ N   G+IP  F+NL  L  L++S+N F GK 
Sbjct: 339 LQLNDNKLVGTIPPELGKLEQLFELNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKI 398

Query: 678 P 680
           P
Sbjct: 399 P 399



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G +P ELG ++ L    +N N+  GTIP +   L+ LFEL++  N  +G  P
Sbjct: 317 LHGNMLTGPIPSELGNMSRLSYLQLNDNKLVGTIPPELGKLEQLFELNVHGNLLSGSIP 375



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  ID++ + ++G +P ELG L +L    +N+N+  G IP +  N   L  L++S N
Sbjct: 453 LRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKIPDQLTNCFTLVNLNVSFN 512

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 513 NLSGIVP 519



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ ++  G +P ELG + +L    ++ N F G+IP    +L+ L  L++S N  +G+ 
Sbjct: 387 LNLSSNNFKGKIPVELGHIINLDKLDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQL 446

Query: 678 P 680
           P
Sbjct: 447 P 447



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ ++ +G +P  LG L  L + +++ N   G +P +F NL+ +  +D+S N  +G  
Sbjct: 411 LDLSGNNFSGSIPLTLGDLEHLLILNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVI 470

Query: 678 P 680
           P
Sbjct: 471 P 471



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ + ++G LP E G L  + +  ++ N   G IP +   L+ L  L ++NN+  GK 
Sbjct: 435 LNLSRNHLSGQLPAEFGNLRSIQMIDVSFNLLSGVIPTELGQLQNLNSLILNNNKLHGKI 494

Query: 678 P 680
           P
Sbjct: 495 P 495



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 22/72 (30%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P N     VA++ L  + + G +PE +GL+  L V  ++ N   G IP    NL    +L
Sbjct: 256 PYNIGFLQVATLSLQGNRLTGRIPEVIGLMQALAVLDLSDNELVGPIPPILGNLSFTGKL 315

Query: 645 DISNNRFAGKFP 680
            +  N   G  P
Sbjct: 316 YLHGNMLTGPIP 327



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 20/72 (27%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  K+  +  ++++ + ++G +P     L  L   +++SN F G IP +  ++  L +L
Sbjct: 352 PELGKLEQLFELNVHGNLLSGSIPLAFRNLGSLTYLNLSSNNFKGKIPVELGHIINLDKL 411

Query: 645 DISNNRFAGKFP 680
           D+S N F+G  P
Sbjct: 412 DLSGNNFSGSIP 423



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + + G L  ++  L  L  F +  N   GTIP+   N      LDIS N+  G+ 
Sbjct: 196 LGLRGNMLTGTLSSDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFQILDISYNQITGEI 255

Query: 678 P 680
           P
Sbjct: 256 P 256



>pir|E86308|E86308 hypothetical protein F20D23.7 - Arabidopsis
           thaliana>gb:AE005172_890698 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007651_1536007 Arabidopsis thaliana
           chromosome I BAC F20D23 genomic sequence, complete
           sequence.
          Length = 1133

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG 548
           +A ++D     + W  + S+ CN+TG+ C        +RTV S+DLN  +++G L   + 
Sbjct: 35  KAFLNDSNGYLASWNQLDSNPCNWTGIACT------HLRTVTSVDLNGMNLSGTLSPLIC 88

Query: 549 LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L  L   ++++N   G IP+     + L  LD+  NRF G  P
Sbjct: 89  KLHGLRKLNVSTNFISGPIPQDLSLCRSLEVLDLCTNRFHGVIP 132



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/62 (35%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S++++H++++G +P+ LG L  L + ++N N+  G IP    NL  L   +ISNN   G 
Sbjct: 624 SLNISHNNLSGTIPDSLGNLQMLEILYLNDNKLSGEIPASIGNLMSLLICNISNNNLVGT 683

Query: 675 FP 680
            P
Sbjct: 684 VP 685



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           A ID + + + G++P+E G + +L + H+  N   G IP++   L +L +LD+S NR  G
Sbjct: 310 AEIDFSENQLTGFIPKEFGHILNLKLLHLFENILLGPIPRELGELTLLEKLDLSINRLNG 369

Query: 672 KFP 680
             P
Sbjct: 370 TIP 372



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 22/65 (33%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+  +DL+ +  +GY+ +ELG L  L +  ++ NR  G IP  F +L  L EL +  N  
Sbjct: 548 TIQRLDLSGNKFSGYIAQELGQLVYLEILRLSDNRLTGEIPHSFGDLTRLMELQLGGNLL 607

Query: 666 AGKFP 680
           +   P
Sbjct: 608 SENIP 612



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 22/68 (32%), Positives = 41/68 (60%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D  K++ +  + L +++  G +P E+G L  +  F+I+SN+  G IPK+  +   +  LD
Sbjct: 494 DLGKLKNLERLRLANNNFTGEIPPEIGNLTKIVGFNISSNQLTGHIPKELGSCVTIQRLD 553

Query: 648 ISNNRFAG 671
           +S N+F+G
Sbjct: 554 LSGNKFSG 561



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 21/82 (25%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG      P+   +  +   +++ + + G++P+ELG    +    ++ N+F G I ++
Sbjct: 510 NFTGEI---PPEIGNLTKIVGFNISSNQLTGHIPKELGSCVTIQRLDLSGNKFSGYIAQE 566

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  L  L +S+NR  G+ P
Sbjct: 567 LGQLVYLEILRLSDNRLTGEIP 588



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 24/82 (29%), Positives = 40/82 (48%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TGV     P   K+R +  I    +  +G +P E+     L V  +  N   G++PK+
Sbjct: 174 NLTGVI---PPSMAKLRQLRIIRAGRNGFSGVIPSEISGCESLKVLGLAENLLEGSLPKQ 230

Query: 615 FKNLKILFELDISNNRFAGKFP 680
            + L+ L +L +  NR +G+ P
Sbjct: 231 LEKLQNLTDLILWQNRLSGEIP 252



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 18/67 (26%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + +++L+ + ++G +  +LG L +L    + +N F G IP +  NL  +   +IS+N
Sbjct: 474 LQNLTALELHQNWLSGNISADLGKLKNLERLRLANNNFTGEIPPEIGNLTKIVGFNISSN 533

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 534 QLTGHIP 540



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P ELG L  L    ++ NR  GTIP++ + L  L +L + +N+  GK P
Sbjct: 343 LLGPIPRELGELTLLEKLDLSINRLNGTIPQELQFLPYLVDLQLFDNQLEGKIP 396



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    I  +  + L+ +   G +P E+G L  +   ++ +N+  G IP++  NL    E+
Sbjct: 253 PSVGNISRLEVLALHENYFTGSIPREIGKLTKMKRLYLYTNQLTGEIPREIGNLIDAAEI 312

Query: 645 DISNNRFAGKFP 680
           D S N+  G  P
Sbjct: 313 DFSENQLTGFIP 324



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  + L  + + G LP EL  L +L    ++ N   G I      LK L  L ++NN 
Sbjct: 451 KSLTKLMLGDNQLTGSLPIELFNLQNLTALELHQNWLSGNISADLGKLKNLERLRLANNN 510

Query: 663 FAGKFP 680
           F G+ P
Sbjct: 511 FTGEIP 516



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D++ + ++G +P        L +  + SN+  G IP+  K  K L +L + +N+  G  
Sbjct: 408 LDMSANSLSGPIPAHFCRFQTLILLSLGSNKLSGNIPRDLKTCKSLTKLMLGDNQLTGSL 467

Query: 678 P 680
           P
Sbjct: 468 P 468



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 19/68 (27%), Positives = 32/68 (47%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  +  + L  + + G +P E+G L D      + N+  G IPK+F ++  L  L +  
Sbjct: 281 KLTKMKRLYLYTNQLTGEIPREIGNLIDAAEIDFSENQLTGFIPKEFGHILNLKLLHLFE 340

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 341 NILLGPIP 348



>gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0692F07.
          Length = 967

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 24/64 (37%), Positives = 39/64 (60%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++++ ++++   G LP ELG L  L V   + N F GT+P    +L +LF LD+SNN  +
Sbjct: 444 LSNLIIDNNRFTGVLPAELGNLTQLVVLSASDNSFTGTVPPSLASLSVLFLLDLSNNSLS 503

Query: 669 GKFP 680
           G+ P
Sbjct: 504 GEIP 507



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/104 (30%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR--TVASIDLNHDDIAGYLPEELG 548
           +A ++DP    S W G D+C +  V C  A  N  +    VA + L    +AG  P  L 
Sbjct: 42  RAALTDPTAALSAWRGDDLCRWPHVACDAAAGNAAVSDGVVAGLYLGGLYLAGGFPVALC 101

Query: 549 LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L  L    ++SN   G +P     L+ L  L++++N F+G+ P
Sbjct: 102 SLRSLRHLDMSSNDLTGPLPACLAGLQALETLNLASNNFSGELP 145



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 19/72 (26%), Positives = 42/72 (58%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  +  +DL+++ ++G +P  +G L +L + +++ N   G+IP++   +  +  L
Sbjct: 484 PSLASLSVLFLLDLSNNSLSGEIPRSIGELKNLTLLNLSDNHLSGSIPEELGGMDKMSTL 543

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G+ P
Sbjct: 544 DLSNNELSGQVP 555



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 18/68 (26%), Positives = 42/68 (61%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  ++L+ + ++G +PEELG +  +    +++N   G +P + ++LK+L  L++S 
Sbjct: 512 ELKNLTLLNLSDNHLSGSIPEELGGMDKMSTLDLSNNELSGQVPAQLQDLKLLGVLNLSY 571

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 572 NKLTGHLP 579



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  +  +G +   +G  A+L    I++NRF G +P +  NL  L  L  S+N F G  
Sbjct: 423 LELRGNAFSGNVGAAIGRAANLSNLIIDNNRFTGVLPAELGNLTQLVVLSASDNSFTGTV 482

Query: 678 P 680
           P
Sbjct: 483 P 483



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/65 (30%), Positives = 34/65 (52%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+ +  +++ G LP  L   A L    I +N+  G  P +F     L  LD+S+NR 
Sbjct: 299 SLESVHMYQNNLTGRLPATLAAAARLTELMIFANQIEGPFPPEFGKNCPLQSLDVSDNRM 358

Query: 666 AGKFP 680
           +G+ P
Sbjct: 359 SGRIP 363



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/50 (38%), Positives = 27/50 (54%)
 Frame = +3

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LP+ LG LA L V  + +    G+IP     L  L +LD+S+N   G+ P
Sbjct: 194 LPDNLGDLAALRVLFLANCSLTGSIPPSVGKLTNLVDLDLSSNNLTGEIP 243



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 18/61 (29%), Positives = 36/61 (59%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++++DL++++++G +P +L  L  LGV +++ N+  G +P       ILF+ D     F 
Sbjct: 540 MSTLDLSNNELSGQVPAQLQDLKLLGVLNLSYNKLTGHLP-------ILFDTDQFRPCFL 592

Query: 669 G 671
           G
Sbjct: 593 G 593



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = +3

Query: 447 VFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
           +F    PD   K R++  + L  + ++G +P E   L  + +  +  N F G +      
Sbjct: 381 MFDGAIPDELGKCRSLMRVRLPCNRLSGPVPPEFWGLPHVYLLELRGNAFSGNVGAAIGR 440

Query: 624 LKILFELDISNNRFAGKFP 680
              L  L I NNRF G  P
Sbjct: 441 AANLSNLIIDNNRFTGVLP 459



>gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0501G04.
          Length = 1040

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 35/113 (30%), Positives = 57/113 (50%)
 Frame = +3

Query: 342 RNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDI 521
           R+A +AL+A     +S   + T     S  C +TGV C  A        V  ++L+  ++
Sbjct: 31  RSALLALKAGFVDTVSALADWTDGGKASPHCKWTGVGCNAAG------LVDRLELSGKNL 84

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +G + +++  L  L V +I++N F  T+PK   +L  L   D+S N F G FP
Sbjct: 85  SGKVADDVFRLPALAVLNISNNAFATTLPKSLPSLPSLKVFDVSQNSFEGGFP 137



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +  +DL   ++ G +P ELG L  L   ++  N   G IP +  N+  L  L
Sbjct: 234 PELGNLANLQYLDLAVGNLDGPIPPELGKLPALTSLYLYKNNLEGKIPPELGNISTLVFL 293

Query: 645 DISNNRFAGKFP 680
           D+S+N F G  P
Sbjct: 294 DLSDNAFTGAIP 305



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A++DL+++ +AG +P  L     L   ++  N+  G IP+   N+  L  LD+S+N   
Sbjct: 506 LAALDLSNNRLAGAIPSSLASCQRLVKLNLRRNKLAGEIPRSLANMPALAILDLSSNVLT 565

Query: 669 GKFP 680
           G  P
Sbjct: 566 GGIP 569



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/65 (30%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ ID++ + +   +P  L  +  L  F  + N   G +P +F++   L  LD+SNNR 
Sbjct: 457 SLSFIDVSRNHLQYSIPSSLFTIPTLQSFLASDNMISGELPDQFQDCPALAALDLSNNRL 516

Query: 666 AGKFP 680
           AG  P
Sbjct: 517 AGAIP 521



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   I T+  +DL+ +   G +P+E+  L+ L + ++  N   G +P    ++  L  L
Sbjct: 282 PELGNISTLVFLDLSDNAFTGAIPDEVAQLSHLRLLNLMCNHLDGVVPAAIGDMPKLEVL 341

Query: 645 DISNNRFAGKFP 680
           ++ NN   G  P
Sbjct: 342 ELWNNSLTGSLP 353



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/69 (27%), Positives = 32/69 (46%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P + ++   D++ +   G  P  LG  ADL   + + N F G +P+   N   L  +D+ 
Sbjct: 117 PSLPSLKVFDVSQNSFEGGFPAGLGGCADLVAVNASGNNFAGPLPEDLANATSLETIDMR 176

Query: 654 NNRFAGKFP 680
            + F G  P
Sbjct: 177 GSFFGGAIP 185



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I T+ S   + + I+G LP++      L    +++NR  G IP    + + L +L++  N
Sbjct: 479 IPTLQSFLASDNMISGELPDQFQDCPALAALDLSNNRLAGAIPSSLASCQRLVKLNLRRN 538

Query: 660 RFAGKFP 680
           + AG+ P
Sbjct: 539 KLAGEIP 545



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 17/64 (26%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  ++L  + +AG +P  L  +  L +  ++SN   G IP+ F +   L  L+++ N   
Sbjct: 530 LVKLNLRRNKLAGEIPRSLANMPALAILDLSSNVLTGGIPENFGSSPALETLNLAYNNLT 589

Query: 669 GKFP 680
           G  P
Sbjct: 590 GPVP 593



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L+ ++I G +P E+G +  L    I  N   G IP +  NL  L  LD++     G  
Sbjct: 197 LGLSGNNITGKIPPEIGEMESLESLIIGYNELEGGIPPELGNLANLQYLDLAVGNLDGPI 256

Query: 678 P 680
           P
Sbjct: 257 P 257



>gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0018C10.>gb:AP003261_1826594 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0471B04.
          Length = 964

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 23/72 (31%), Positives = 41/72 (56%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  ++  D++ + ++G LP+E+  L  L +FHI  N F G +P+   +L+ L   
Sbjct: 254 PELAHLTLLSEFDVSQNQLSGILPKEIANLKKLKIFHIYRNNFSGVLPEGLGDLEFLESF 313

Query: 645 DISNNRFAGKFP 680
               N+F+GKFP
Sbjct: 314 STYENQFSGKFP 325



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/67 (34%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R +  I+L  +++ G +P EL  L  L  F ++ N+  G +PK+  NLK L    I  N
Sbjct: 235 LRNLWKIELYQNNLTGEIPPELAHLTLLSEFDVSQNQLSGILPKEIANLKKLKIFHIYRN 294

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 295 NFSGVLP 301



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID+ ++   G +  ++G+ A L   ++++N F G +P +   L +L +L   NNRF+G+ 
Sbjct: 409 IDVANNKFVGGISSDIGISASLNQLYVHNNVFSGELPMELGKLSLLQKLVAFNNRFSGQI 468

Query: 678 P 680
           P
Sbjct: 469 P 469



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 22/121 (18%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGS-DVCNYTGVFCAPAPDN-------------------PKIRTVASID 503
           + DP+N   +W  S   C + GV C                           +  + +++
Sbjct: 39  LEDPQNYLGNWDESHSPCQFYGVTCDQTSGGVIGISLSNASLSGTISSSFSLLSQLRTLE 98

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP--KKFKNLKILFELDISNNRFAGKF 677
           L  + I+G +P  L    +L V ++++N   G +P    F NL++L   D+S N F+G F
Sbjct: 99  LGANSISGTIPAALANCTNLQVLNLSTNSLTGQLPDLSTFINLQVL---DLSTNNFSGPF 155

Query: 678 P 680
           P
Sbjct: 156 P 156



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 HDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           H+++ +G LP ELG L+ L      +NRF G IP +  +LK L  L +  N   G  P
Sbjct: 436 HNNVFSGELPMELGKLSLLQKLVAFNNRFSGQIPAQIGSLKQLSFLHLEQNALEGSIP 493



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 21/78 (26%), Positives = 35/78 (44%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           ++G F      N K++ + ++D N    +G  P        L  F I+ N+F G I    
Sbjct: 344 FSGEFPRFLCQNNKLQFLLALDNN---FSGEFPSSYSSCKTLQRFRISQNQFTGRIHSGI 400

Query: 618 KNLKILFELDISNNRFAG 671
             L     +D++NN+F G
Sbjct: 401 WGLPNAVIIDVANNKFVG 418



>gb:AP000412_1820059 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone: K3G3.
          Length = 890

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 26/63 (41%), Positives = 40/63 (63%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           A+IDL+ + + G +PE LGLL  L   ++++N F G IP    NLK +  LD+S+N+ +G
Sbjct: 703 ATIDLSGNRLEGEIPESLGLLKALIALNLSNNAFTGHIPLSLANLKKIESLDLSSNQLSG 762

Query: 672 KFP 680
             P
Sbjct: 763 TIP 765



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +IDL +    G   E+  +L       ++ NR  G IP+    LK L  L++SNN F G 
Sbjct: 683 TIDLRYK---GLSMEQENVLTSSATIDLSGNRLEGEIPESLGLLKALIALNLSNNAFTGH 739

Query: 675 FP 680
            P
Sbjct: 740 IP 741



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = +3

Query: 495 SIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           S+ L H++  +  +  + G+L +L V  ++S+ F   +P  F NL +L  LD+S N   G
Sbjct: 102 SLLLPHNNFTSSSISSKFGMLNNLEVLSLSSSGFLAQVPFSFSNLSMLSALDLSKNELTG 161



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 22/65 (33%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +V  + L+ + + G LP    L   +  F    NRF G IP    N   L  LD+S N F
Sbjct: 463 SVQILSLDTNSLEGALPH---LPLSINYFSAIDNRFGGDIPLSICNRSSLDVLDLSYNNF 519

Query: 666 AGKFP 680
           +G+ P
Sbjct: 520 SGQIP 524



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 13/44 (29%), Positives = 28/44 (63%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           ++ + S+DL+ + ++G +P  LG L+ L   +++ N+  G IP+
Sbjct: 747 LKKIESLDLSSNQLSGTIPNGLGTLSFLAYMNVSHNQLNGEIPQ 790



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 18/61 (29%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL++++ +G +P     L++L    +  N   G+IP K+     L   D+  NR  GK 
Sbjct: 512 LDLSYNNFSGQIPP---CLSNLLYLKLRKNNLEGSIPDKYYVDTPLRSFDVGYNRLTGKL 568

Query: 678 P 680
           P
Sbjct: 569 P 569



>gb:OSJN00297_1698139 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: B1292H11, complete sequence.
          Length = 977

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 32/92 (34%), Positives = 52/92 (56%), Gaps = 1/92 (1%)
 Frame = +3

Query: 408 SDW-VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINS 584
           S W  GS VC++ GV C     N + R V+ +D+ + ++AG +  ++G L+ L   ++  
Sbjct: 5   SSWNQGSSVCSWAGVRC-----NRQGR-VSMLDVQNLNLAGQISPDIGNLSALQSIYLQK 58

Query: 585 NRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           NRF G IP +   L +L  L+ S+N F+G  P
Sbjct: 59  NRFIGNIPDQLGRLSLLETLNGSSNHFSGSIP 90



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 22/68 (32%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  + SIDL+++ + G +P  +G    +    +  N   G IP++ +NLK L  LD+SN
Sbjct: 460 RLGNIVSIDLSYNLLDGSIPTSVGKCQSVQSLSVCGNAISGVIPREIENLKGLQILDLSN 519

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 520 NQLVGGIP 527



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  + ++D + + IAG +PEELG L  L  F ++ N   GT+P++  N+  L   
Sbjct: 139 PSLGNMSLLTTLDASTNTIAGEIPEELGHLRHLQYFDLSINNLTGTVPRQLYNISNLAFF 198

Query: 645 DISNNRFAGKFP 680
            ++ N+  G+ P
Sbjct: 199 AVAMNKLHGEIP 210



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/68 (29%), Positives = 39/68 (57%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K ++V S+ +  + I+G +P E+  L  L +  +++N+  G IP+  + L+ L +L++S 
Sbjct: 484 KCQSVQSLSVCGNAISGVIPREIENLKGLQILDLSNNQLVGGIPEGLEKLQALQKLNLSF 543

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 544 NNLKGLVP 551



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 17/67 (25%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L  + + G +P  LG ++ L     ++N   G IP++  +L+ L   D+S N
Sbjct: 120 LQNLKILKLGQNQLTGAIPPSLGNMSLLTTLDASTNTIAGEIPEELGHLRHLQYFDLSIN 179

Query: 660 RFAGKFP 680
              G  P
Sbjct: 180 NLTGTVP 186



>gb:LES303345_1684557 Lycopersicon esculentum lateral suppressor
           gene, ORF1 and ORF2.
          Length = 1192

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 25/61 (40%), Positives = 39/61 (63%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+++ ++G +P+ LG L+ L V ++  N F GTIP  F  LKI+  LD+S+N   G  
Sbjct: 673 LDLSYNSLSGTIPDNLGSLSFLQVLNLGHNNFTGTIPFNFGGLKIVGVLDLSHNSLQGFI 732

Query: 678 P 680
           P
Sbjct: 733 P 733



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 18/68 (26%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K   +  + L+ + ++G +P+ +G LA+L +  + +N   G IP+   + + L  LD+++
Sbjct: 526 KCTNLVWVSLSSNRLSGEIPQGIGNLANLAILQLGNNSLTGPIPRGLGSCRNLIWLDLNS 585

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 586 NALTGSIP 593



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/59 (35%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LN++ I+G LP+ +    +L    ++SNR  G IP+   NL  L  L + NN   G  P
Sbjct: 511 LNNNFISGTLPQSISKCTNLVWVSLSSNRLSGEIPQGIGNLANLAILQLGNNSLTGPIP 569



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 15/43 (34%), Positives = 27/43 (62%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           ++ V  +DL+H+ + G++P  LG L+ L    +++N   GTIP
Sbjct: 715 LKIVGVLDLSHNSLQGFIPPSLGGLSFLSDLDVSNNNLSGTIP 757



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 495 SIDLNHDDIAG-YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           S++L +++++G +L   +  L +L   ++  N   G +PK   N   L  LD+S+N F G
Sbjct: 359 SLNLGNNELSGDFLNTVISSLTNLRYLYLPFNNITGYVPKSLVNCTKLQVLDLSSNAFIG 418

Query: 672 KFP 680
             P
Sbjct: 419 NVP 421



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 23/82 (28%), Positives = 38/82 (46%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N    FC  A   P    + ++ L  + + G +P++LG   +L    ++ N   G+IP +
Sbjct: 419 NVPSEFCFAASGFP----LETMLLASNYLTGTVPKQLGHCRNLRKIDLSFNNLVGSIPLE 474

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             NL  L EL +  N   G+ P
Sbjct: 475 IWNLPNLSELVMWANNLTGEIP 496



>gb:BT010940_1640886 Arabidopsis thaliana At3g24954 gene, complete
           cds.>gb:BT011648_1641170 Arabidopsis thaliana At3g24954
           mRNA, complete cds.
          Length = 225

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 25/63 (39%), Positives = 40/63 (63%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           A+ID + + + G +PE +GLL  L   ++++N F G IP  F NLK +  LD+S+N+ +G
Sbjct: 46  ATIDFSGNRLEGEIPESIGLLKALIALNLSNNAFTGHIPLSFANLKKMESLDLSSNQLSG 105

Query: 672 KFP 680
             P
Sbjct: 106 TIP 108



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +IDL +    G   E+  +L        + NR  G IP+    LK L  L++SNN F G 
Sbjct: 26  TIDLRYK---GLSMEQRNVLTSSATIDFSGNRLEGEIPESIGLLKALIALNLSNNAFTGH 82

Query: 675 FP 680
            P
Sbjct: 83  IP 84



>gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinase
           homolog (At4g30520) mRNA, complete
           cds.>gb:AY096538_1576080 Arabidopsis thaliana putative
           receptor kinase-like protein (At4g30520) mRNA, complete
           cds.
          Length = 648

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 20/119 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFCAP--------APDNP----------KIRTVASID 503
           + DP    ++W     D C++  + C+P        AP              +  +  + 
Sbjct: 48  LHDPHGALNNWDEFSVDPCSWAMITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVS 107

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +++I+G +P ELG L  L    +++NRF G IP     L  L  L ++NN  +G FP
Sbjct: 108 LQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFP 166



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           PK++T   +DL+++  +G +P  +  L+ L    +N+N   G  P     +  L  LD+S
Sbjct: 125 PKLQT---LDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLS 181

Query: 654 NNRFAGKFP 680
            N  +G  P
Sbjct: 182 YNNLSGPVP 190



>gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.
          Length = 649

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 20/119 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFCAP--------APDNP----------KIRTVASID 503
           + DP    ++W     D C++  + C+P        AP              +  +  + 
Sbjct: 48  LHDPHGALNNWDEFSVDPCSWAMITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVS 107

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +++I+G +P ELG L  L    +++NRF G IP     L  L  L ++NN  +G FP
Sbjct: 108 LQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFP 166



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 20/69 (28%), Positives = 35/69 (50%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           PK++T   +DL+++  +G +P  +  L+ L    +N+N   G  P     +  L  LD+S
Sbjct: 125 PKLQT---LDLSNNRFSGDIPVSIDQLSSLQYLRLNNNSLSGPFPASLSQIPHLSFLDLS 181

Query: 654 NNRFAGKFP 680
            N  +G  P
Sbjct: 182 YNNLSGPVP 190



>gb:AE016959_1021016 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091724_1734925
           Oryza sativa chromosome 10 clone OSJNBa0004E08, complete
           sequence.>gb:AE017058_1750835 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 12 of 77 of the
           complete sequence.
          Length = 1130

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 25/64 (39%), Positives = 38/64 (59%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  +DL+ +  +G +P ELG L++LG   ++SNR  G IP +  N K L  LD+ NN  +
Sbjct: 565 LTKLDLSSNSFSGPIPRELGNLSNLGTLRMSSNRLTGPIPHELGNCKKLALLDLGNNFLS 624

Query: 669 GKFP 680
           G  P
Sbjct: 625 GSIP 628



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID++ + + G +P  LG  ++L    ++SN F G IP++  NL  L  L +S+NR  G  
Sbjct: 544 IDMSSNLLEGIIPSALGSWSNLTKLDLSSNSFSGPIPRELGNLSNLGTLRMSSNRLTGPI 603

Query: 678 P 680
           P
Sbjct: 604 P 604



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/68 (32%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K +++  ++LN++ I G LP + G    L    ++SN   G IP    +   L +LD+S+
Sbjct: 513 KCQSLYRVNLNNNQINGSLPADFGTNWGLSYIDMSSNLLEGIIPSALGSWSNLTKLDLSS 572

Query: 657 NRFAGKFP 680
           N F+G  P
Sbjct: 573 NSFSGPIP 580



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           + +A +DL ++ ++G +P E+  L  L    +  N   GTIP  F   + L EL + +N 
Sbjct: 611 KKLALLDLGNNFLSGSIPAEITTLGSLQNLLLAGNNLTGTIPDSFTATQALLELQLGDNS 670

Query: 663 FAGKFP 680
             G  P
Sbjct: 671 LEGAIP 676



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           ++ +   G +PE +G    L + ++N NRF G+IPK   +L  L    I++N   G+ P
Sbjct: 304 VSENAFTGTIPEAIGRCRSLTMLYLNGNRFTGSIPKFIGDLTRLQLFSIADNGITGEIP 362



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLG-VFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + +  + L  + + G +P  LG L  +    +I++N+  G IP    NL+ L  LD+SNN
Sbjct: 659 QALLELQLGDNSLEGAIPHSLGSLQYISKALNISNNQLSGQIPSSLGNLQDLEVLDLSNN 718

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 719 SLSGIIP 725



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 30/131 (22%), Positives = 50/131 (38%), Gaps = 15/131 (11%)
 Frame = +3

Query: 333 DRIRNAYIALQAWK---QAIISDPRNTTSDWVGSDVCN---------YTGVFCAPAPDNP 476
           D I    + L  W+    A++    N+ S  + SD+           Y   F    P   
Sbjct: 402 DNILRGPVPLALWRLSNMAVLQLNNNSFSGEIHSDITQMRNLTNITLYNNNFTGELPQEL 461

Query: 477 KIRTVAS---IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
            + T      IDL  +   G +P  L     L V  +  N+F G  P +    + L+ ++
Sbjct: 462 GLNTTPGLLHIDLTRNHFRGAIPPGLCTGGQLAVLDLGYNQFDGGFPSEIAKCQSLYRVN 521

Query: 648 ISNNRFAGKFP 680
           ++NN+  G  P
Sbjct: 522 LNNNQINGSLP 532



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD  ++  +  + L  + + G +P  L  L+++ V  +N+N F G I      ++ L  +
Sbjct: 387 PDIAELNQLQKLSLFDNILRGPVPLALWRLSNMAVLQLNNNSFSGEIHSDITQMRNLTNI 446

Query: 645 DISNNRFAGKFP 680
            + NN F G+ P
Sbjct: 447 TLYNNNFTGELP 458



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/59 (33%), Positives = 30/59 (50%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ +   G LP  +G L +L    ++ N F GTIP+     + L  L ++ NRF G  P
Sbjct: 280 LDDNAFVGELPASIGELVNLEELVVSENAFTGTIPEAIGRCRSLTMLYLNGNRFTGSIP 338



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/74 (28%), Positives = 37/74 (50%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           P P+ P    +  + L  + +AG LP  L    +L V +++ N+  G +P  F ++  L 
Sbjct: 217 PMPEFPPRCGLVYLSLYSNQLAGELPRSLTNCGNLTVLYLSYNKIGGEVPDFFASMANLQ 276

Query: 639 ELDISNNRFAGKFP 680
            L + +N F G+ P
Sbjct: 277 TLYLDDNAFVGELP 290



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +   +  + ++ ++ + + G +P ELG    L +  + +N   G+IP +   L
Sbjct: 575 FSGPIPRELGNLSNLGTLRMSSNRLTGPIPHELGNCKKLALLDLGNNFLSGSIPAEITTL 634

Query: 627 KILFELDISNNRFAGKFP 680
             L  L ++ N   G  P
Sbjct: 635 GSLQNLLLAGNNLTGTIP 652



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 18/70 (25%), Positives = 34/70 (48%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  K R +  I L ++ ++G +P ++  L  L    +  N   G +P     L  +  L
Sbjct: 363 PEIGKCRGLVEIALQNNSLSGMIPPDIAELNQLQKLSLFDNILRGPVPLALWRLSNMAVL 422

Query: 645 DISNNRFAGK 674
            ++NN F+G+
Sbjct: 423 QLNNNSFSGE 432



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A +DL ++   G  P E+     L   ++N+N+  G++P  F     L  +D+S+N   
Sbjct: 493 LAVLDLGYNQFDGGFPSEIAKCQSLYRVNLNNNQINGSLPADFGTNWGLSYIDMSSNLLE 552

Query: 669 GKFP 680
           G  P
Sbjct: 553 GIIP 556



>pir|H96510|H96510 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AE005173_892670 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC083835_1733184 Arabidopsis thaliana
           chromosome 1 BAC F2G19 genomic sequence, complete
           sequence.
          Length = 994

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 26/61 (42%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID   + I G +PE +G+L +L V +++SN F G IP    NL  L  LDIS N+  G+ 
Sbjct: 809 IDFAGNKIQGKIPESVGILKELHVLNLSSNAFTGHIPSSLANLTNLESLDISQNKIGGEI 868

Query: 678 P 680
           P
Sbjct: 869 P 869



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEEL-GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL+++++ G +P  L   ++ L V ++ +N   G++P  F N K+L  LD+S+N   GK
Sbjct: 620 LDLSNNNLHGLIPRCLEAQMSSLSVLNLRNNSLDGSLPNIFMNAKVLSSLDVSHNTLEGK 679

Query: 675 FP 680
            P
Sbjct: 680 LP 681



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y   F    P++   ++ + S+ L     +G +P  L  L+ L    ++ N F G IP  
Sbjct: 286 YNTSFSGTIPNSISNLKHLTSLKLQQSAFSGRIPSSLRSLSHLSNLVLSENNFVGEIPSS 345

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             NLK L   D+S+N   G FP
Sbjct: 346 VSNLKQLTLFDVSDNNLNGNFP 367



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++++ L+ ++  G +P  +  L  L +F ++ N   G  P    NL  L  +DI +N F 
Sbjct: 328 LSNLVLSENNFVGEIPSSVSNLKQLTLFDVSDNNLNGNFPSSLLNLNQLRYIDICSNHFT 387

Query: 669 GKFP 680
           G  P
Sbjct: 388 GFLP 391



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 3/70 (4%)
 Frame = +3

Query: 480 IRTVASIDLNHD-DIAGYLPEEL--GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           I  + SI L+H+ ++ G LP  L    L  L +++ +   F GTIP    NLK L  L +
Sbjct: 253 IPNLESISLDHNLNLEGSLPNFLRNNSLLKLSIYNTS---FSGTIPNSISNLKHLTSLKL 309

Query: 651 SNNRFAGKFP 680
             + F+G+ P
Sbjct: 310 QQSAFSGRIP 319



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           + ++S+D++H+ + G LP  L   + L + ++ SN    T P    +L  L  L + +N 
Sbjct: 664 KVLSSLDVSHNTLEGKLPASLAGCSALEILNVESNNINDTFPFWLNSLPKLQVLVLRSNN 723

Query: 663 FAG 671
           F G
Sbjct: 724 FRG 726



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 18/55 (32%), Positives = 28/55 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           ID+  +   G+LP  +  L++L  F    N F G+IP    N+  L  L +S N+
Sbjct: 379 IDICSNHFTGFLPPTISQLSNLEFFSACDNSFTGSIPSSLFNISSLTTLGLSYNQ 433



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+D++ + I G +P ELG L+ L   +++ N+  G+IP+
Sbjct: 851 LTNLESLDISQNKIGGEIPPELGTLSSLEWINVSHNQLVGSIPQ 894



>gb:AP003633_1831828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0637D03.
          Length = 1061

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 1/109 (0%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGS-DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYL 533
           AL A+K  + SDP      W  +   C + GV C           V S+D++   +AG L
Sbjct: 32  ALMAFKAGVTSDPTGVLRSWNETVHFCRWPGVNCTAG-------RVTSLDVSMGRLAGEL 84

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              +  L  L V ++ SN F G+IP     L+ +  L + +N FAG+ P
Sbjct: 85  SPAVANLTRLVVLNLTSNAFSGSIPGGLGRLRRMRYLSLCDNAFAGEIP 133



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    ++ +  ++L  + ++G +P ELG +  L   +++ N   G IP   + +  L EL
Sbjct: 552 PSLSGLKGLRRLNLTGNRLSGSIPPELGGMPGLQELYLSRNDLSGGIPASLETMSSLMEL 611

Query: 645 DISNNRFAGKFP 680
           D+S NR AG+ P
Sbjct: 612 DVSYNRLAGQVP 623



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 19/61 (31%), Positives = 35/61 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ + + G +P ++G L  L    ++ NRF G +P + ++ + L  LD++ N F G  
Sbjct: 491 MDLSDNQLDGPIPPDVGQLTKLAFMALSGNRFSGEVPTELESCQSLEFLDLARNVFVGSI 550

Query: 678 P 680
           P
Sbjct: 551 P 551



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = +3

Query: 429 VCNYTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI 605
           +C  + +F    P+   K++ +  + L  +++AG +P  +G L  L    ++ N   G+I
Sbjct: 394 LCLQSNLFSGEIPEAIGKLKNLRELLLEQNELAGPVPSAIGDLTQLLKLDLSGNSLNGSI 453

Query: 606 PKKFKNLKILFELDISNNRFAGKFP 680
           P    NL  L  L++S N   G  P
Sbjct: 454 PPSLGNLHQLTLLNLSGNELTGHVP 478



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+I ++  +    L  +  +G +PE +G L +L    +  N   G +P    +L  L +L
Sbjct: 383 PEIESLVGLQTLCLQSNLFSGEIPEAIGKLKNLRELLLEQNELAGPVPSAIGDLTQLLKL 442

Query: 645 DISNNRFAGKFP 680
           D+S N   G  P
Sbjct: 443 DLSGNSLNGSIP 454



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/64 (29%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A + L+H+ ++G +P  L  L  +    ++ N   G+IP     L  L  L +S N  A
Sbjct: 166 LAVLRLSHNSLSGRIPPSLANLTKIFRLELDQNLLEGSIPDGLSRLPALGMLALSQNSLA 225

Query: 669 GKFP 680
           G+ P
Sbjct: 226 GEIP 229



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL  +   G +P  L  L  L   ++  NR  G+IP +   +  L EL +S N  +G  
Sbjct: 539 LDLARNVFVGSIPPSLSGLKGLRRLNLTGNRLSGSIPPELGGMPGLQELYLSRNDLSGGI 598

Query: 678 P 680
           P
Sbjct: 599 P 599



>gb:AF528603_1808630 Arabidopsis thaliana ecotype Jl-3 receptor-like
           protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528605_1808632 Arabidopsis thaliana ecotype
           El-0 receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528606_1808633 Arabidopsis thaliana ecotype
           Bu-0 receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528607_1808634 Arabidopsis thaliana ecotype
           Kas-1 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528608_1808635 Arabidopsis thaliana
           ecotype Co-1 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528609_1808636 Arabidopsis thaliana
           ecotype Gr-3 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528610_1808637 Arabidopsis thaliana
           ecotype Lu-1 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528611_1808638 Arabidopsis thaliana
           ecotype Pi-0 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.
          Length = 310

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 26/69 (37%), Positives = 43/69 (62%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L   +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFIGSIPPTFMSLKELGEV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRNLG 84



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++G +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFIGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 28/120 (23%), Positives = 57/120 (47%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+   + ++S+ RN       W G    N   V   FC+   + P+    ++++  +
Sbjct: 66  FMSLKELGEVVLSENRNLGGVVPHWFGDFSMNLERVDLSFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SNRF GT+P  + +   L  L+++ N   G  P
Sbjct: 126 NLESNNMTGTLRD---FQQPLVVLNLASNRFSGTLPCFYASRPSLSVLNLAENSLVGGLP 182



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/65 (29%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ ++L  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSVLNLAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLVFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



>gb:AF527809_1808449 Sorghum bicolor clone BAC SB_BBc0234M12
           php200725 orthologous region.
          Length = 690

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/120 (30%), Positives = 54/120 (45%), Gaps = 13/120 (10%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDV------------CNYTGVFCAPAPDNPKIRTVASID 503
           L+AW       P +  S W G                N +G F   A    K+  + S++
Sbjct: 55  LEAWSATSPFPPCDAASPWPGVQCYKGSLVGVRLTHMNLSGTFDFGAI--AKLPRLHSVN 112

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-FKNLKILFELDISNNRFAGKFP 680
           L H+ ++G LP  LG L  L   +++SN F G IP   F N++ L +L + NNR  G  P
Sbjct: 113 LKHNALSGPLPASLGTLRGLRALYLSSNNFSGPIPADVFANMRWLKKLYLDNNRITGPLP 172



>gb:AC119796_1739716 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1172F09, complete sequence.
          Length = 1030

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 33/108 (30%), Positives = 54/108 (50%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL A K +++ DP      W  +  C + GV C           V  ++L   +++G +P
Sbjct: 33  ALLAIKASLV-DPLGELKGWSSAPHCTWKGVRCDARG------AVTGLNLAAMNLSGAIP 85

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +++  LA L    + SN F G +P    ++  L ELD+S+N F G+FP
Sbjct: 86  DDILGLAGLTSIVLQSNAFDGELPPVLVSIPTLRELDVSDNNFKGRFP 133



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/69 (31%), Positives = 37/69 (53%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P ++T A+ D   +++ G +P+EL     L    +++NR  G IP    + + L  L + 
Sbjct: 476 PALQTFAAAD---NELTGGVPDELADCPSLSALDLSNNRLSGAIPASLASCQRLVSLSLR 532

Query: 654 NNRFAGKFP 680
           NNRF G+ P
Sbjct: 533 NNRFTGQIP 541



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/65 (32%), Positives = 38/65 (58%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++++DL+++ ++G +P  L     L    + +NRF G IP     +  L  LD+SNN F
Sbjct: 501 SLSALDLSNNRLSGAIPASLASCQRLVSLSLRNNRFTGQIPAAVAMMPTLSVLDLSNNFF 560

Query: 666 AGKFP 680
           +G+ P
Sbjct: 561 SGEIP 565



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/61 (36%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+    + G +P ELG L  L   ++  N   G IPK+  NL  L  LD+S+N   G  
Sbjct: 241 LDMAIGSLEGPIPPELGRLPYLNTVYLYKNNIGGQIPKELGNLSSLIMLDLSDNAITGTI 300

Query: 678 P 680
           P
Sbjct: 301 P 301



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVAS-IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           PD+  + T  S IDL+H+ +   LP  +  +  L  F    N   G +P +  +   L  
Sbjct: 445 PDDLALSTSLSFIDLSHNQLRSALPSNILSIPALQTFAAADNELTGGVPDELADCPSLSA 504

Query: 642 LDISNNRFAGKFP 680
           LD+SNNR +G  P
Sbjct: 505 LDLSNNRLSGAIP 517



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/72 (29%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  ++  + ++ L  ++I G +P+ELG L+ L +  ++ N   GTIP +   L  L  L
Sbjct: 254 PELGRLPYLNTVYLYKNNIGGQIPKELGNLSSLIMLDLSDNAITGTIPPELAQLTNLQLL 313

Query: 645 DISNNRFAGKFP 680
           ++  N+  G  P
Sbjct: 314 NLMCNKIKGGIP 325



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 20/67 (29%), Positives = 30/67 (44%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I T+  +D++ ++  G  P  LG  A L   + + N F G +P    N   L  LD    
Sbjct: 115 IPTLRELDVSDNNFKGRFPAGLGACASLTHLNASGNNFAGPLPADIGNATALETLDFRGG 174

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 175 FFSGGIP 181



>gb:AC087553_1734109 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 1007

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 36/118 (30%), Positives = 52/118 (44%), Gaps = 20/118 (16%)
 Frame = +3

Query: 387 SDPRNTTSDWVG-SDVCNYTGVFCAP-------------------APDNPKIRTVASIDL 506
           +DP    S W   +DVC++ GV C                     +P    + +V SIDL
Sbjct: 65  TDPNGVLSGWSPEADVCSWHGVTCLTGEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDL 124

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + + + G +P ELG +  L    ++SN   G IP +   LK L  L I NN   G+ P
Sbjct: 125 SSNSLTGAIPPELGTMKSLKTLLLHSNLLTGAIPPELGGLKNLKLLRIGNNPLRGEIP 182



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L+ + ++G +P E+G L  L V ++  N F G IP + +    L+EL +S N   G  
Sbjct: 728 LSLSGNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPI 787

Query: 678 P 680
           P
Sbjct: 788 P 788



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L+++ + G LPE+L   A+L V  +  N+  G IP     L  L  L+++NN
Sbjct: 212 LKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQSLNLANN 271

Query: 660 RFAGKFP 680
           +F+G  P
Sbjct: 272 QFSGVIP 278



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R++ ++ L  + ++G LPE  G LA+L V  + +N   G +P+    LK L  ++ S+NR
Sbjct: 532 RSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHNR 591

Query: 663 FAG 671
           F G
Sbjct: 592 FTG 594



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + +AG +P ELG L +L +  +++N F G IP +  N   L  L++  N   G  
Sbjct: 632 LQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLTGAV 691

Query: 678 P 680
           P
Sbjct: 692 P 692



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+I  +++++   L H+ + G +P E+G L  L +  +  N   G IP +  N   L E+
Sbjct: 430 PQIGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEV 489

Query: 645 DISNNRFAGKFP 680
           D   N F G  P
Sbjct: 490 DFFGNHFHGPIP 501



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P ELG  + L    ++ NR  G+IP +   L  L  L++  N
Sbjct: 698 LRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNRLSGSIPPEIGKLTSLNVLNLQKN 757

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 758 GFTGVIP 764



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++ S++L ++  +G +P E+G L+ L   ++  NR  G IP++   L  L  +D+S N
Sbjct: 260 LSSLQSLNLANNQFSGVIPPEIGNLSGLTYLNLLGNRLTGGIPEELNRLSQLQVVDLSKN 319

Query: 660 RFAGK 674
             +G+
Sbjct: 320 NLSGE 324



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L ++  +G +P  +     +    +  NR  G IP +  +L  L  LD+SNN F+G  P
Sbjct: 610 LTNNSFSGVIPAAVARSTGMVRLQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIP 668



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ SID++++ + G +P  +  L  L    +++N F G +P +  NL  L  L + +N  
Sbjct: 389 SLKSIDVSNNSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLEVLSLYHNGL 448

Query: 666 AGKFP 680
            G  P
Sbjct: 449 TGGIP 453



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++ +  + + ++ + G +P ELG  ++L    +   +  G IP +  NLK L +L
Sbjct: 159 PELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAIPHQIGNLKQLQQL 218

Query: 645 DISNNRFAGKFP 680
            + NN   G  P
Sbjct: 219 ALDNNTLTGGLP 230



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  +++ +  + L  +++ G +P+E+   + L       N F G IP    NLK L  L
Sbjct: 454 PEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVL 513

Query: 645 DISNNRFAGKFP 680
            +  N   G  P
Sbjct: 514 QLRQNDLTGPIP 525



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  ++ + L ++ + G LPE +  L +L V + + NRF G +     +   L  L ++N
Sbjct: 554 RLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHNRFTGAVVPLLGS-SSLTVLALTN 612

Query: 657 NRFAGKFP 680
           N F+G  P
Sbjct: 613 NSFSGVIP 620



>gb:AC084817_1733844 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0419C04, complete sequence.
          Length = 1117

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 36/118 (30%), Positives = 52/118 (44%), Gaps = 20/118 (16%)
 Frame = +3

Query: 387 SDPRNTTSDWVG-SDVCNYTGVFCAP-------------------APDNPKIRTVASIDL 506
           +DP    S W   +DVC++ GV C                     +P    + +V SIDL
Sbjct: 175 TDPNGVLSGWSPEADVCSWHGVTCLTGEGIVTGLNLSGYGLSGTISPAIAGLVSVESIDL 234

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + + + G +P ELG +  L    ++SN   G IP +   LK L  L I NN   G+ P
Sbjct: 235 SSNSLTGAIPPELGTMKSLKTLLLHSNLLTGAIPPELGGLKNLKLLRIGNNPLRGEIP 292



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 498  IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
            + L+ + ++G +P E+G L  L V ++  N F G IP + +    L+EL +S N   G  
Sbjct: 838  LSLSGNRLSGSIPPEIGKLTSLNVLNLQKNGFTGVIPPELRRCNKLYELRLSENSLEGPI 897

Query: 678  P 680
            P
Sbjct: 898  P 898



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L+++ + G LPE+L   A+L V  +  N+  G IP     L  L  L+++NN
Sbjct: 322 LKQLQQLALDNNTLTGGLPEQLAGCANLRVLSVADNKLDGVIPSSIGGLSSLQSLNLANN 381

Query: 660 RFAGKFP 680
           +F+G  P
Sbjct: 382 QFSGVIP 388



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R++ ++ L  + ++G LPE  G LA+L V  + +N   G +P+    LK L  ++ S+NR
Sbjct: 642 RSLQALALADNRLSGELPESFGRLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHNR 701

Query: 663 FAG 671
           F G
Sbjct: 702 FTG 704



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + +AG +P ELG L +L +  +++N F G IP +  N   L  L++  N   G  
Sbjct: 742 LQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIPPELSNCSRLTHLNLDGNSLTGAV 801

Query: 678 P 680
           P
Sbjct: 802 P 802



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+I  +++++   L H+ + G +P E+G L  L +  +  N   G IP +  N   L E+
Sbjct: 540 PQIGNLSNLEVLSLYHNGLTGGIPPEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEV 599

Query: 645 DISNNRFAGKFP 680
           D   N F G  P
Sbjct: 600 DFFGNHFHGPIP 611



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            +R++  +DL+ + + G +P ELG  + L    ++ NR  G+IP +   L  L  L++  N
Sbjct: 808  LRSLGELDLSSNALTGGIPVELGGCSGLLKLSLSGNRLSGSIPPEIGKLTSLNVLNLQKN 867

Query: 660  RFAGKFP 680
             F G  P
Sbjct: 868  GFTGVIP 874



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++ S++L ++  +G +P E+G L+ L   ++  NR  G IP++   L  L  +D+S N
Sbjct: 370 LSSLQSLNLANNQFSGVIPPEIGNLSGLTYLNLLGNRLTGGIPEELNRLSQLQVVDLSKN 429

Query: 660 RFAGK 674
             +G+
Sbjct: 430 NLSGE 434



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L ++  +G +P  +     +    +  NR  G IP +  +L  L  LD+SNN F+G  P
Sbjct: 720 LTNNSFSGVIPAAVARSTGMVRLQLAGNRLAGAIPAELGDLTELKILDLSNNNFSGDIP 778



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ SID++++ + G +P  +  L  L    +++N F G +P +  NL  L  L + +N  
Sbjct: 499 SLKSIDVSNNSLTGEIPPAIDRLPGLVNLALHNNSFAGVLPPQIGNLSNLEVLSLYHNGL 558

Query: 666 AGKFP 680
            G  P
Sbjct: 559 TGGIP 563



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/72 (26%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++ +  + + ++ + G +P ELG  ++L    +   +  G IP +  NLK L +L
Sbjct: 269 PELGGLKNLKLLRIGNNPLRGEIPPELGDCSELETIGMAYCQLIGAIPHQIGNLKQLQQL 328

Query: 645 DISNNRFAGKFP 680
            + NN   G  P
Sbjct: 329 ALDNNTLTGGLP 340



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  +++ +  + L  +++ G +P+E+   + L       N F G IP    NLK L  L
Sbjct: 564 PEIGRLQRLKLLFLYENEMTGAIPDEMTNCSSLEEVDFFGNHFHGPIPASIGNLKNLAVL 623

Query: 645 DISNNRFAGKFP 680
            +  N   G  P
Sbjct: 624 QLRQNDLTGPIP 635



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  ++ + L ++ + G LPE +  L +L V + + NRF G +     +   L  L ++N
Sbjct: 664 RLAELSVVTLYNNSLEGALPESMFELKNLTVINFSHNRFTGAVVPLLGS-SSLTVLALTN 722

Query: 657 NRFAGKFP 680
           N F+G  P
Sbjct: 723 NSFSGVIP 730



>gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich
           repeat receptor-like kinase, complete cds.
          Length = 627

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 20/142 (14%)
 Frame = +3

Query: 315 SLTFENDRIRNAYIALQAWKQAIISDPRNTTSDW-VGS-DVCNYTGVFCAP--------- 461
           S T     +    +AL A K  +  DP N   +W V S D C++  V C+P         
Sbjct: 25  SATLSPSGVNYEVVALIAIKTGL-HDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL 83

Query: 462 ---------APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
                    +P    +  + S+ L ++ I+G++P E+G L  L    +++N+F G IP  
Sbjct: 84  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLERLQTLDLSNNKFNGDIPST 143

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             +L+ L  L ++NN  +G+ P
Sbjct: 144 LGDLRNLNYLRLNNNSLSGQIP 165



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  + ++DL+++   G +P  LG L +L    +N+N   G IP+    +  L  +D+S 
Sbjct: 122 KLERLQTLDLSNNKFNGDIPSTLGDLRNLNYLRLNNNSLSGQIPESLSKVDGLTLVDVSF 181

Query: 657 NRFAGKFP 680
           N  +G+ P
Sbjct: 182 NNLSGRPP 189



>gb:AB029327_1518169 Nicotiana tabacum mRNA for elicitor-inducible
           LRR receptor-like protein EILP, complete cds.
          Length = 861

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 27/78 (34%), Positives = 44/78 (56%)
 Frame = +3

Query: 447 VFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           +F +  P+  K+  +  +DL+ + I+G +P ++G LA L   HI  N   G+IP +  +L
Sbjct: 106 LFGSIPPEIGKLTNLVYLDLSFNQISGTIPPQIGSLAKLQTLHILDNHLNGSIPGEIGHL 165

Query: 627 KILFELDISNNRFAGKFP 680
           + L ELD+S N   G  P
Sbjct: 166 RSLTELDLSINTLNGSIP 183



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + +++ + L H+ ++G +PEE+G L  L V  + +N   G+IP    NL  L  L +  N
Sbjct: 285 LTSLSILQLEHNQLSGSIPEEIGYLRTLAVLSLYTNFLNGSIPISLGNLTSLSSLSLYEN 344

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 345 HLSGPIP 351



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/72 (30%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  ++ + L  ++I+G++PEE+G L+ L    +N+N   G+IP   +NL  L  L
Sbjct: 184 PSLGNLHNLSLLCLYKNNISGFIPEEIGYLSSLIQLDLNTNFLNGSIPASLENLHNLSLL 243

Query: 645 DISNNRFAGKFP 680
            +  N+ +G  P
Sbjct: 244 YLYENQLSGSIP 255



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P  LG L +L +  +  N   G IP++   L  L +LD++ N
Sbjct: 165 LRSLTELDLSINTLNGSIPPSLGNLHNLSLLCLYKNNISGFIPEEIGYLSSLIQLDLNTN 224

Query: 660 RFAGKFP 680
              G  P
Sbjct: 225 FLNGSIP 231



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 19/67 (28%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L  + ++G +P+E+G L  L    +N+N   G+IP    NL  L  L + +N
Sbjct: 237 LHNLSLLYLYENQLSGSIPDEIGQLRTLTDIRLNTNFLTGSIPASLGNLTSLSILQLEHN 296

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 297 QLSGSIP 303



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCG 599
           S +  Y      P P +   +  +  + L  + ++G +P ELG L +L    ++ N+  G
Sbjct: 337 SSLSLYENHLSGPIPSSLGNLDNLVYLYLYANQLSGPIPSELGNLKNLNYMKLHDNQLNG 396

Query: 600 TIPKKFKNLKILFELDISNNRFAGKFP 680
           +IP  F NL+ +  L + +N   G+ P
Sbjct: 397 SIPASFGNLRNMQYLFLESNNLTGEIP 423



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+ + + G +P E+G L +L    ++ N+  GTIP +  +L  L  L I +N   G  
Sbjct: 99  IDLSMNQLFGSIPPEIGKLTNLVYLDLSFNQISGTIPPQIGSLAKLQTLHILDNHLNGSI 158

Query: 678 P 680
           P
Sbjct: 159 P 159



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 27/111 (24%), Positives = 47/111 (42%), Gaps = 11/111 (9%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS-----------IDLNHDDIAG 527
           ++  P N  S+ + S +CN T +       N    ++             +D++ + I+G
Sbjct: 458 VLKIPDNNLSEEIPSSICNLTSLRILDLSRNNLKGSIPQCFGDMGGHLEVLDIHKNGISG 517

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            LP    + + L  F ++ N   G IP+   N K L  LD+ +N     FP
Sbjct: 518 TLPTTFRIGSVLRSFTLHENELEGKIPRSLANCKELQVLDLGDNLLNDTFP 568



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  +DLN + + G +P  L  L +L + ++  N+  G+IP +   L+ L ++ ++ N
Sbjct: 213 LSSLIQLDLNTNFLNGSIPASLENLHNLSLLYLYENQLSGSIPDEIGQLRTLTDIRLNTN 272

Query: 660 RFAGKFP 680
              G  P
Sbjct: 273 FLTGSIP 279



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +3

Query: 474 PKIRTVASIDLNH---DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+I ++A +   H   + + G +P E+G L  L    ++ N   G+IP    NL  L  L
Sbjct: 136 PQIGSLAKLQTLHILDNHLNGSIPGEIGHLRSLTELDLSINTLNGSIPPSLGNLHNLSLL 195

Query: 645 DISNNRFAGKFP 680
            +  N  +G  P
Sbjct: 196 CLYKNNISGFIP 207



>gb:AX008789_1456287 Sequence 1 from Patent
           WO9964600.>gb:AF053127_1764428 Malus domestica
           leucine-rich receptor-like protein kinase (LRPKm1) mRNA,
           complete cds.
          Length = 999

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P++  ++  + ++DL+ ++++G LP  +    +L   ++ SN+  G IP    NL
Sbjct: 489 FSGPLPESIVRLGQLGTLDLHSNEVSGELPVGIQSWTNLNELNLASNQLSGKIPDGIGNL 548

Query: 627 KILFELDISNNRFAGKFP 680
            +L  LD+S NRF+GK P
Sbjct: 549 SVLNYLDLSGNRFSGKIP 566



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           + DP +  S W    S  CN+ GV C  A  +  +  V S+DL   ++AG  P  L  L 
Sbjct: 36  LDDPDSALSSWNYADSTPCNWLGVTCDDASSSSPV--VRSLDLPSANLAGPFPTVLCRLP 93

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L    + +N    T+P      + L +LD++ N   G  P
Sbjct: 94  NLTHLSLYNNSINSTLPPSLSTCQTLEDLDLAQNLLTGALP 134



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N  G   A   ++P +  V    L  + ++G LP+ LG  + L  F ++SN+F GTIP  
Sbjct: 320 NLEGSVPASIANSPNLYEVR---LFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPAS 376

Query: 615 FKNLKILFELDISNNRFAGKFP 680
                 + E+ + +N F+G+ P
Sbjct: 377 LCEKGQMEEILMLHNEFSGEIP 398



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/61 (31%), Positives = 37/61 (60%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + ++G +P+ +G L+ L    ++ NRF G IP   +N+K L   ++S N+ +G+ 
Sbjct: 530 LNLASNQLSGKIPDGIGNLSVLNYLDLSGNRFSGKIPFGLQNMK-LNVFNLSYNQLSGEL 588

Query: 678 P 680
           P
Sbjct: 589 P 589



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +  +G +PEE+G + +L  F    N+F G +P+    L  L  LD+ +N  +G+ P
Sbjct: 460 LAKNKFSGPIPEEIGWVENLMEFSGGDNKFSGPLPESIVRLGQLGTLDLHSNEVSGELP 518



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           I T+  ++L+++    G +P ELG L +L V  +      G IP     LK L +LD++ 
Sbjct: 188 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLRLTECNLVGEIPDSLGRLKNLKDLDLAI 247

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 248 NGLTGRIP 255



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 1/81 (1%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG   A  PD P ++    +DL+ ++ +G +P+  G    L V  +  N    TIP    
Sbjct: 130 TGALPATLPDLPNLKY---LDLSGNNFSGAIPDSFGRFQKLEVLSLVYNLIENTIPPFLG 186

Query: 621 NLKILFELDISNNRF-AGKFP 680
           N+  L  L++S N F  G+ P
Sbjct: 187 NISTLKMLNLSYNPFHPGRIP 207



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 14/61 (22%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++++G + + +    +L +  +  N+F G IP++   ++ L E    +N+F+G  
Sbjct: 434 MELAENELSGPIAKSIARATNLSLLILAKNKFSGPIPEEIGWVENLMEFSGGDNKFSGPL 493

Query: 678 P 680
           P
Sbjct: 494 P 494



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 20/72 (27%), Positives = 30/72 (41%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P     +T+  +DL  + + G LP  L  L +L    ++ N F G IP  F   + L  L
Sbjct: 111 PSLSTCQTLEDLDLAQNLLTGALPATLPDLPNLKYLDLSGNNFSGAIPDSFGRFQKLEVL 170

Query: 645 DISNNRFAGKFP 680
            +  N      P
Sbjct: 171 SLVYNLIENTIP 182



>gb:CQ768539_1451787 Sequence 34 from Patent WO2004007712.
          Length = 218

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 33  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 86  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 135



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 11/116 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 48  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 101

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR  G+
Sbjct: 102 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGQ 157



>gb:CQ768537_1451786 Sequence 32 from Patent WO2004007712.
          Length = 217

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 33  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 86  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 135



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 11/112 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 48  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 101

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR
Sbjct: 102 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNR 153



>gb:A67825_1450281 Sequence 30 from Patent WO9743427.
          Length = 218

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 33  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 86  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 135



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL ++++ G +P  LG L  L    +N NR  G IP+    +  L  +D+S+N
Sbjct: 117 LKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSN 176

Query: 660 RFAGKFP 680
              G  P
Sbjct: 177 DLCGTIP 183



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 11/118 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 48  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 101

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR  G  P
Sbjct: 102 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIP 159



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++++  + LN + + G +P  L  +  L V  ++SN  CGTIP
Sbjct: 140 KLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSNDLCGTIP 183



>gb:A67821_1450279 Sequence 26 from Patent WO9743427.
          Length = 220

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 35  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 87

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 88  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 137



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL ++++ G +P  LG L  L    +N NR  G IP+    +  L  +D+S+N
Sbjct: 119 LKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSN 178

Query: 660 RFAGKFP 680
              G  P
Sbjct: 179 DLCGTIP 185



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 11/118 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 50  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 103

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR  G  P
Sbjct: 104 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIP 161



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++++  + LN + + G +P  L  +  L V  ++SN  CGTIP
Sbjct: 142 KLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSNDLCGTIP 185



>gb:A67819_1450278 Sequence 24 from Patent
           WO9743427.>gb:AY081542_1568802 Arabidopsis thaliana
           unknown protein mRNA, complete cds.>gb:BT002517_1636120
           Arabidopsis thaliana Unknown protein (At5g21090) mRNA,
           complete cds.>gb:BT006268_1639160 Arabidopsis thaliana
           At5g21090 mRNA, complete cds.>gb:AC140977_1744082
           Arabidopsis thaliana chromosome 5 BAC F13M11 genomic
           sequence, complete sequence.>gb:AF324989_1786443
           Arabidopsis thaliana AT5g21090 (AT5g21090/T10F18_120)
           mRNA, complete cds.>gb:AF370543_1792328 Arabidopsis
           thaliana Unknown protein mRNA, complete cds.
          Length = 218

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 33  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 86  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 135



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL ++++ G +P  LG L  L    +N NR  G IP+    +  L  +D+S+N
Sbjct: 117 LKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSN 176

Query: 660 RFAGKFP 680
              G  P
Sbjct: 177 DLCGTIP 183



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 11/118 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 48  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 101

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR  G  P
Sbjct: 102 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTSLGKLKSLVFLRLNDNRLTGPIP 159



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++++  + LN + + G +P  L  +  L V  ++SN  CGTIP
Sbjct: 140 KLKSLVFLRLNDNRLTGPIPRALTAIPSLKVVDVSSNDLCGTIP 183



>gb:A67817_1450277 Sequence 22 from Patent WO9743427.
          Length = 218

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL A ++++ +DP +    W  + V  C +  V C    DN     V  +DL + +++G+
Sbjct: 33  ALYALRRSL-TDPDHVLQSWDPTLVNPCTWFHVTCNQ--DN----RVTRVDLGNSNLSGH 85

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  ELG L  L    +  N   GTIP +  NLK L  LD+ NN   G  P
Sbjct: 86  LAPELGKLEHLQYLELYKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVP 135



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 11/115 (9%)
 Frame = +3

Query: 360 LQAWKQAIIS-----------DPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDL 506
           LQ+W   +++           D R T  D   S++  +       AP+  K+  +  ++L
Sbjct: 48  LQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHL------APELGKLEHLQYLEL 101

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
             ++I G +P ELG L +L    + +N   G +P     LK L  L +++NR  G
Sbjct: 102 YKNNIQGTIPSELGNLKNLISLDLYNNNLTGIVPTFLGKLKSLVFLRLNDNRLTG 156



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/67 (28%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL ++++ G +P  LG L  L    +N NR  G I +  +  +    +D+S+N
Sbjct: 117 LKNLISLDLYNNNLTGIVPTFLGKLKSLVFLRLNDNRLTGPILEHSRQSQAFKVVDVSSN 176

Query: 660 RFAGKFP 680
              G  P
Sbjct: 177 DLCGTIP 183



>pir|B86460|B86460 hypothetical protein F14M2.19 [imported] -
           Arabidopsis thaliana>gb:AE005172_892174 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC010164_1536955 Arabidopsis thaliana
           chromosome I BAC F14M2 genomic sequence, complete
           sequence.
          Length = 486

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 26/69 (37%), Positives = 41/69 (59%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           PK+RTV    L ++ ++G LP  +G L++L +  +  NRF G+IP     L  L +L ++
Sbjct: 159 PKLRTVY---LENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLN 215

Query: 654 NNRFAGKFP 680
            NR +G FP
Sbjct: 216 GNRLSGIFP 224



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 36/137 (26%), Positives = 52/137 (37%), Gaps = 30/137 (21%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGS-DVCNYTGVFCAPAPDNPKIRTVASIDLNHD------- 515
           L A+K  I  DP    S W    D C++ G+FC P     ++ T+ ++D N D       
Sbjct: 65  LLAFKSGITQDPSGILSSWQKDIDCCSWYGIFCLPTIHGDRV-TMMALDGNTDVGETFLS 123

Query: 516 ----------------------DIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
                                  I G  P  L  L  L   ++ +NR  G +P     L 
Sbjct: 124 GTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALS 183

Query: 630 ILFELDISNNRFAGKFP 680
            L  L ++ NRF+G  P
Sbjct: 184 NLEILSVAGNRFSGSIP 200



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 19/65 (29%), Positives = 38/65 (58%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T++++++ H+ ++G +P+ L     L   +++ N + G +P  F NL  +  LD+S+N  
Sbjct: 257 TLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLL 316

Query: 666 AGKFP 680
            G FP
Sbjct: 317 TGPFP 321



>pir|H86208|H86208 protein F22G5.26 [imported] - Arabidopsis
           thaliana>gb:AE005172_889742 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022464_1539017 Genomic sequence for
           Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.
          Length = 677

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 24/67 (35%), Positives = 42/67 (62%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R +  +DL+ ++++G +P E+G L ++   +++SNR  G+IP     LK L  LD+SNN
Sbjct: 477 LRYMHGLDLSSNELSGEIPIEIGDLQNIRSLNLSSNRLTGSIPDSISKLKGLESLDLSNN 536

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 537 KLDGSIP 543



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V  +D++H+  +G +P  +     L    + +N F G +P        L  LD+ NN F+
Sbjct: 293 VEVMDISHNSFSGSIPRNVNF-PSLRELRLQNNEFTGLVPGNLFKAAGLEVLDLRNNNFS 351

Query: 669 GK 674
           GK
Sbjct: 352 GK 353



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 17/61 (27%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL +++ +G +   +   + L +  + +N F   IP K   L  +  LD+S+N+F G  
Sbjct: 343 LDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIPGKICQLSEVGLLDLSHNQFRGPI 402

Query: 678 P 680
           P
Sbjct: 403 P 403



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 17/68 (25%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K + +  +D++ +  +G LP  +G ++ L   +++ N+  G  P   +    +  +DIS+
Sbjct: 242 KSKNLTLLDISDNRFSGMLPLWIGRISRLSYLYMSGNQLKGPFPF-LRQSPWVEVMDISH 300

Query: 657 NRFAGKFP 680
           N F+G  P
Sbjct: 301 NSFSGSIP 308



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L+++ + G +  +   L  L    ++ N F G++ +     K L  LDIS+NRF+G  
Sbjct: 201 LKLSNNQLQGKIFSKHANLTGLVGLFLDGNNFTGSLEEGLLKSKNLTLLDISDNRFSGML 260

Query: 678 P 680
           P
Sbjct: 261 P 261



>gb:AF528604_1808631 Arabidopsis thaliana ecotype Ler-0
           receptor-like protein CLAVATA2 (CLV2) gene, partial cds.
          Length = 310

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 26/69 (37%), Positives = 42/69 (60%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++  G +P   G L +L   +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFCGNIPSCFGSLRNLRTLNLSRNRFIGSIPPTFMSLKELGEV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRNLG 84



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++G +   L  L+ L    ++ N FCG IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSGQIHPSLCKLSSLQSLDLSHNNFCGNIPSCFGSLRNLRTLNLSRNRFIGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 28/120 (23%), Positives = 57/120 (47%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+   + ++S+ RN       W G    N   V   FC+   + P+    ++++  +
Sbjct: 66  FMSLKELGEVVLSENRNLGGVVPHWFGDFSMNLERVDLSFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SNRF GT+P  + +   L  L+++ N   G  P
Sbjct: 126 NLESNNMTGTLRD---FQQPLVVLNLASNRFSGTLPCFYASRPSLSVLNLAENSLVGGLP 182



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/65 (29%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ ++L  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSVLNLAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLVFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



>gb:AF528602_1808629 Arabidopsis thaliana ecotype Ita-0
           receptor-like protein CLAVATA2 (CLV2) gene, partial cds.
          Length = 310

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 26/69 (37%), Positives = 43/69 (62%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L   +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSLKELREV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRDLG 84



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/62 (33%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++G +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSGQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G    N   V   FC+   + P+    ++++  +
Sbjct: 66  FVSLKELREVVLSENRDLGGVVPHWFGDFSMNLERVDLSFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  ++I G L +       L V ++ SNRF GT+P  + +   L  L+++ N   G  P
Sbjct: 126 NLESNNITGTLRD---FQQPLVVLNLASNRFSGTLPCFYASRPSLSVLNLAENSLVGGLP 182



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ ++L  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSVLNLAENSLVGGLPSCLGSLTELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G  P
Sbjct: 226 SGCLP 230



>gb:AF528591_1808618 Arabidopsis thaliana ecotype Columbia
           receptor-like protein CLAVATA2 (CLV2) gene, partial
           cds.>gb:AF528592_1808619 Arabidopsis thaliana ecotype
           Lan-0 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.>gb:AF528593_1808620 Arabidopsis thaliana
           ecotype Fi-0 receptor-like protein CLAVATA2 (CLV2) gene,
           partial cds.
          Length = 310

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 26/69 (37%), Positives = 43/69 (62%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+ ++ S+DL+H++ +G +P   G L +L   +++ NRF G+IP  F +LK L E+
Sbjct: 16  PSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSLKELREV 75

Query: 645 DISNNRFAG 671
            +S NR  G
Sbjct: 76  VLSENRDLG 84



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L+  +++  +   L  L+ L    ++ N F G IP  F +L+ L  L++S NRF G 
Sbjct: 2   SLTLSGLNLSSQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGS 61

Query: 675 FP 680
            P
Sbjct: 62  IP 63



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 27/120 (22%), Positives = 59/120 (49%), Gaps = 10/120 (8%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRN---TTSDWVGSDVCNYTGV---FCAPAPDNPK----IRTVASI 500
           +++L+  ++ ++S+ R+       W G+   N   V   FC+   + P+    ++++  +
Sbjct: 66  FVSLKELREVVLSENRDLGGVVPHWFGNFSMNLERVDFSFCSFVGELPESLLYLKSLKYL 125

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L  +++ G L +       L V ++ SN+F GT+P  + +   L  L+I+ N   G  P
Sbjct: 126 NLESNNMTGTLRD---FQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLP 182



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/65 (27%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +++ +++  + + G LP  LG L +L   +++ N F   I  +    + L  LD+S+N F
Sbjct: 166 SLSILNIAENSLVGGLPSCLGSLKELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGF 225

Query: 666 AGKFP 680
           +G+ P
Sbjct: 226 SGRLP 230



>gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 map
           MAP_LOC, complete sequence.
          Length = 1250

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 25/67 (37%), Positives = 42/67 (62%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           IR ++ +DL+ +++ G +P +L L   L    +N+NR  G+IP    NL +L EL +S+N
Sbjct: 623 IRELSLLDLSGNELTGLIPPQLSLCRKLTHLDLNNNRLYGSIPFWLGNLPLLGELKLSSN 682

Query: 660 RFAGKFP 680
           +F+G  P
Sbjct: 683 KFSGPLP 689



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 2/105 (1%)
 Frame = +3

Query: 372 KQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEEL 545
           K++ + DP N  S+W     + C ++GV C    D  K   V  ++L+   I+G +   +
Sbjct: 35  KKSFLDDPENVLSNWSDKNQNFCQWSGVSC--EEDTLK---VVRLNLSDCSISGSISPSI 89

Query: 546 GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G L DL    ++SN   G IP    NL  L  L + +N+  G  P
Sbjct: 90  GFLHDLLHLDLSSNLLSGPIPPTLSNLSSLQSLLLYSNQLTGPIP 134



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 19/67 (28%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + ++ L+H+ + G +P+E+G++ +L +  +  N+F G IP +  N   L  +D   N
Sbjct: 408 LTNLQTLALSHNSLHGNIPKEIGMVENLEILFLYENQFSGEIPMEIGNCSRLQMIDFYGN 467

Query: 660 RFAGKFP 680
            F+G+ P
Sbjct: 468 AFSGRIP 474



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/66 (33%), Positives = 36/66 (54%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R +  +DLN++ + G +P  LG L  LG   ++SN+F G +P++  N   L  L + +N 
Sbjct: 648 RKLTHLDLNNNRLYGSIPFWLGNLPLLGELKLSSNKFSGPLPRELFNCSKLLVLSLEDNS 707

Query: 663 FAGKFP 680
             G  P
Sbjct: 708 INGTLP 713



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/88 (25%), Positives = 47/88 (53%)
 Frame = +3

Query: 417 VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFC 596
           +G   C+ +G+     P+  K+  + +++L  + +   +P E+G  + L  F +  N   
Sbjct: 171 LGLASCSLSGMI---PPELGKLGRIENMNLQENQLENEIPSEIGNCSSLVAFSVAVNNLN 227

Query: 597 GTIPKKFKNLKILFELDISNNRFAGKFP 680
           G+IP++   LK L  ++++NN  +G+ P
Sbjct: 228 GSIPEELSMLKNLQVMNLANNSISGQIP 255



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L ++ I+G +P +LG + +L   ++  N+  G+IP     L  +  LD+S N
Sbjct: 237 LKNLQVMNLANNSISGQIPTQLGEMIELQYLNLLGNQLEGSIPMSLAKLSNVRNLDLSGN 296

Query: 660 RFAGKFP 680
           R  G+ P
Sbjct: 297 RLTGEIP 303



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/59 (32%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L ++   G +P  LGL+ +L +  ++ N   G IP +    + L  LD++NNR  G  P
Sbjct: 607 LGNNRFTGEIPWTLGLIRELSLLDLSGNELTGLIPPQLSLCRKLTHLDLNNNRLYGSIP 665



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF---KNLKILFELD 647
           K+  V ++DL+ + + G +P E G +  L V  + SN   G IPK          L  + 
Sbjct: 284 KLSNVRNLDLSGNRLTGEIPGEFGNMDQLQVLVLTSNNLSGGIPKTICSSNGNSSLEHMM 343

Query: 648 ISNNRFAGKFP 680
           +S N+ +G+ P
Sbjct: 344 LSENQLSGEIP 354



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/65 (29%), Positives = 34/65 (52%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  +DL+++ + G +P EL  L +L    +N+N   G++     NL  L  L +S+N  
Sbjct: 362 SLKQLDLSNNTLNGSIPVELYELVELTDLLLNNNTLVGSVSPLIANLTNLQTLALSHNSL 421

Query: 666 AGKFP 680
            G  P
Sbjct: 422 HGNIP 426



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/61 (31%), Positives = 28/61 (45%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID   +  +G +P  +G L +L       N   G IP    N   L  LD+++NR +G  
Sbjct: 462 IDFYGNAFSGRIPITIGGLKELNFIDFRQNDLSGEIPASVGNCHQLKILDLADNRLSGSV 521

Query: 678 P 680
           P
Sbjct: 522 P 522



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  + L+ +  +G LP EL   + L V  +  N   GT+P +   LK L  L+   N+ +
Sbjct: 674 LGELKLSSNKFSGPLPRELFNCSKLLVLSLEDNSINGTLPLEIGELKSLNILNFDKNQLS 733

Query: 669 GKFP 680
           G  P
Sbjct: 734 GPIP 737



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 19/62 (30%), Positives = 28/62 (45%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S D+ ++     +P  LG    L    + +NRF G IP     ++ L  LD+S N   G 
Sbjct: 580 SFDVTNNAFDHEVPPHLGYSPFLERLRLGNNRFTGEIPWTLGLIRELSLLDLSGNELTGL 639

Query: 675 FP 680
            P
Sbjct: 640 IP 641



>gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03
           genomic sequence, complete sequence.
          Length = 1029

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 11/113 (9%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDV-----------CNYTGVFCAPAPDNPKIRTVASIDLNHDDI 521
           +A +SDP    + W G+             C + GV C+          V  +D++  ++
Sbjct: 30  KAAMSDPTGALASWGGNGTRTNTTAAAAAHCAWAGVTCSSRG------AVVGLDVSGLNL 83

Query: 522 AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +G LP EL  L  L    + +N F G IP     L+ L  L++SNN F G FP
Sbjct: 84  SGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFP 136



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  K++ + ++ L  + +AG +P ELG L  L    +++N   G IP  F  LK L  L
Sbjct: 258 PELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSELKNLTLL 317

Query: 645 DISNNRFAGKFP 680
           ++  N+  G  P
Sbjct: 318 NLFRNKLRGDIP 329



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +  +D  +  ++G +P ELG L +L    +  N   G IP +   LK L  L
Sbjct: 234 PELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSL 293

Query: 645 DISNNRFAGKFP 680
           D+SNN   G+ P
Sbjct: 294 DLSNNVLTGEIP 305



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V  + L+ +  +G +P E+G L  L    ++SN   G +P +    ++L  LD+S N  +
Sbjct: 483 VQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNIS 542

Query: 669 GKFP 680
           GK P
Sbjct: 543 GKIP 546



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  ++L  + + G +P+ +G L  L V  +  N F G +P++      L  LD+S+
Sbjct: 310 ELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSS 369

Query: 657 NRFAGKFP 680
           NR  G  P
Sbjct: 370 NRLTGTLP 377



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 16/52 (30%), Positives = 25/52 (48%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +P+ LG    L    +  N   G+IPK    L  L ++++ +N   G FP
Sbjct: 398 GAIPDSLGECKSLSRVRLGENYLNGSIPKGLFELPKLTQVELQDNLLTGNFP 449



>gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich
           repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P+   ++  + ++DL+ ++++G LP  +     L   ++ SN+  G IP    NL
Sbjct: 488 FSGPLPEGIARLGQLGTLDLHSNEVSGELPVGIQSWTKLNELNLASNQLSGKIPDGIANL 547

Query: 627 KILFELDISNNRFAGKFP 680
            +L  LD+S NRF+GK P
Sbjct: 548 SVLNYLDLSGNRFSGKIP 565



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 30/101 (29%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           + DP +  S W  +D   CN+ GV C  A  +  +  V S+DL   ++AG  P  L  L 
Sbjct: 35  LDDPDSALSSWNDADSTPCNWLGVECDDASSSSPV--VRSLDLPSANLAGPFPTVLCRLP 92

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L    + +N    T+P      + L  LD++ N   G  P
Sbjct: 93  NLTHLSLYNNSINSTLPPSLSTCQTLEHLDLAQNLLTGALP 133



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N  G   A   ++P +  V    L  + ++G LP+ LG  + L  F ++SN+F GTIP  
Sbjct: 319 NLEGSVPASIANSPNLYEVR---LFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPAS 375

Query: 615 FKNLKILFELDISNNRFAGKFP 680
                 + E+ + +N F+G+ P
Sbjct: 376 LCEKGQMEEILMLHNEFSGEIP 397



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +  +G +PEE+G + +L  F    N+F G +P+    L  L  LD+ +N  +G+ P
Sbjct: 459 LAKNKFSGPIPEEIGWVKNLMEFSGGDNKFSGPLPEGIARLGQLGTLDLHSNEVSGELP 517



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           I T+  ++L+++    G +P ELG L +L V  +      G IP     LK L +LD++ 
Sbjct: 187 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 246

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 247 NGLTGRIP 254



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 1/81 (1%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG   A  PD P ++    +DL  ++ +G +P+  G    L V  +  N    TIP    
Sbjct: 129 TGALPATLPDLPNLKY---LDLTGNNFSGPIPDSFGRFQKLEVLSLVYNLIESTIPPFLG 185

Query: 621 NLKILFELDISNNRF-AGKFP 680
           N+  L  L++S N F  G+ P
Sbjct: 186 NISTLKMLNLSYNPFHPGRIP 206



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 18/61 (29%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + ++G +P+ +  L+ L    ++ NRF G IP   +N+K L   ++S N+ +G+ 
Sbjct: 529 LNLASNQLSGKIPDGIANLSVLNYLDLSGNRFSGKIPFGLQNMK-LNVFNLSYNQLSGEL 587

Query: 678 P 680
           P
Sbjct: 588 P 588



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 15/61 (24%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++++G + + +    +L +  +  N+F G IP++   +K L E    +N+F+G  
Sbjct: 433 MELAENELSGPIAKSIAGATNLSLLILAKNKFSGPIPEEIGWVKNLMEFSGGDNKFSGPL 492

Query: 678 P 680
           P
Sbjct: 493 P 493



>gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich
           repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P+   ++  + ++DL+ ++++G LP  +     L   ++ SN+  G IP    NL
Sbjct: 488 FSGPLPEGIARLGQLGTLDLHSNEVSGELPVGIQSWTKLNELNLASNQLSGKIPDGIANL 547

Query: 627 KILFELDISNNRFAGKFP 680
            +L  LD+S NRF+GK P
Sbjct: 548 SVLNYLDLSGNRFSGKIP 565



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 31/101 (30%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           + DP +  S W  +D   CN+ GV C  A  +  +  V S+DL   ++AG  P  L  L 
Sbjct: 35  LDDPDSALSSWNDADSTPCNWLGVSCDDASSSYPV--VLSLDLPSANLAGPFPTVLCRLP 92

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L    + +N    T+P      + L  LD+S N   G  P
Sbjct: 93  NLTHLSLYNNSINSTLPPSLSTCQNLEHLDLSQNLLTGGLP 133



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N  G   A   ++P +  V    L  + ++G LP+ LG  + L  F ++SN+F GTIP  
Sbjct: 319 NLEGSVPASIANSPNLYEVR---LFRNKLSGELPQNLGKNSPLKWFDVSSNQFTGTIPAS 375

Query: 615 FKNLKILFELDISNNRFAGKFP 680
                 + E+ + +N F+G+ P
Sbjct: 376 LCEKGQMEEILMLHNEFSGEIP 397



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/59 (32%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +  +G +PEE+G + +L  F    N+F G +P+    L  L  LD+ +N  +G+ P
Sbjct: 459 LAKNKFSGPIPEEIGWVKNLMEFSGGDNKFSGPLPEGIARLGQLGTLDLHSNEVSGELP 517



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           I T+  ++L+++    G +P ELG L +L V  +      G IP     LK L +LD++ 
Sbjct: 187 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 246

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 247 NGLTGRIP 254



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 18/61 (29%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + ++G +P+ +  L+ L    ++ NRF G IP   +N+K L   ++S N+ +G+ 
Sbjct: 529 LNLASNQLSGKIPDGIANLSVLNYLDLSGNRFSGKIPFGLQNMK-LNVFNLSYNQLSGEL 587

Query: 678 P 680
           P
Sbjct: 588 P 588



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 15/61 (24%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++++G + + +    +L +  +  N+F G IP++   +K L E    +N+F+G  
Sbjct: 433 MELAENELSGPIAKSIAGATNLSLLILAKNKFSGPIPEEIGWVKNLMEFSGGDNKFSGPL 492

Query: 678 P 680
           P
Sbjct: 493 P 493



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG   A   D P ++    +DL  ++ +G +P+  G    L V  +  N    TIP    
Sbjct: 129 TGGLPATLSDVPNLKY---LDLTGNNFSGPIPDSFGRFQKLEVLSLVYNLIESTIPPFLG 185

Query: 621 NLKILFELDISNNRF-AGKFP 680
           N+  L  L++S N F  G+ P
Sbjct: 186 NISTLKMLNLSYNPFHPGRIP 206



>gb:AY059776_1564626 Arabidopsis thaliana putative disease
           resistance Cf-2 (At4g13920) mRNA, complete
           cds.>gb:AY091445_1574645 Arabidopsis thaliana putative
           disease resistance Cf-2 protein (At4g13920) mRNA,
           complete cds.
          Length = 891

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 24/62 (38%), Positives = 39/62 (62%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE +G+L +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 717 TIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 776

Query: 675 FP 680
            P
Sbjct: 777 IP 778



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
 Frame = +3

Query: 489 VASIDLNH-DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +  +DL++ DD+ G + + +G L  L V  + S +F G IP    NL  L +LD+S N F
Sbjct: 155 LTDLDLSYNDDLTGEILDSMGNLKHLRVLSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYF 214

Query: 666 AGKFP 680
            G+ P
Sbjct: 215 TGELP 219



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++ ++DL+ +     LP  +  L+ L  F I+ N F GTIP     L  L +LD+  N
Sbjct: 286 LSSLTNVDLSSNQFKAMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMLPSLIKLDLGTN 345

Query: 660 RFAG 671
            F+G
Sbjct: 346 DFSG 349



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 25/83 (30%), Positives = 41/83 (49%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           C +TG   +   +   +  +  +DL+ +   G LP+ +G L  L V +++   F G IP 
Sbjct: 188 CKFTGKIPSSLGN---LTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKIPT 244

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
              +L  L +LDIS N F  + P
Sbjct: 245 SLGSLSNLTDLDISKNEFTSEGP 267



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 22/108 (20%)
 Frame = +3

Query: 402 TTSDWVGS-DVCNYTGVFCAPAPD------------NPKIRT---------VASIDLNHD 515
           TT+ W  + D C++ G+ C P               N ++R+         + S+DL+++
Sbjct: 56  TTAKWRNNTDCCSWGGISCDPKTGVVVELDLGNSDLNGRLRSNSSLFRLQHLQSLDLSYN 115

Query: 516 DIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           D++  LP+  G    L V ++      G IP   ++L  L +LD+S N
Sbjct: 116 DLSCTLPDSSGNFKYLRVLNLLGCNLFGEIPTSLRSLSYLTDLDLSYN 163



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +T++ + L ++ ++G +PEE  L   L    + SNR  G  PK   N   L  L++  NR
Sbjct: 545 KTLSILHLRNNSLSGVIPEE-SLHGYLRSLDVGSNRLSGQFPKSLINCSYLQFLNVEENR 603

Query: 663 FAGKFP 680
               FP
Sbjct: 604 INDTFP 609



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/61 (32%), Positives = 27/61 (44%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L      G +P  LG L  L    ++ N F G +P    NLK L  L++    F GK 
Sbjct: 183 LSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKI 242

Query: 678 P 680
           P
Sbjct: 243 P 243



>gb:ATAC011620_1543299 Arabidopsis thaliana chromosome III BAC F18C1
           genomic sequence, complete sequence.
          Length = 883

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 22/67 (32%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++   ++D + +   G +P  +GLL +L + +++SN F G IP    NL+ L  LD+S N
Sbjct: 686 LKIYTALDFSGNKFEGEIPRSIGLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRN 745

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 746 KLSGEIP 752



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/64 (37%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + ++DL+ ++ +G++P  LG L  L   H+  N F G IP    NL  L  LD+S N F 
Sbjct: 137 LTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFV 196

Query: 669 GKFP 680
           G+ P
Sbjct: 197 GEIP 200



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 24/120 (20%)
 Frame = +3

Query: 393 PRNTTSDWVGSDVCNYTGVFCAPAPDN------------------------PKIRTVASI 500
           P  T S   GSD C++ G+ C                                   + ++
Sbjct: 57  PLKTKSWENGSDCCHWDGITCDAKTGEVIEIDLMCSCLHGWFHSNSNLSMLQNFHFLTTL 116

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL+++ ++G +   +G L+ L    ++ N F G IP    NL  L  L + +N F G+ P
Sbjct: 117 DLSYNHLSGQISSSIGNLSHLTTLDLSGNNFSGWIPSSLGNLFHLTSLHLYDNNFGGEIP 176



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+ L  ++  G +P  LG L+ L    +++N F G IP  F +L  L  L + NN+ +
Sbjct: 161 LTSLHLYDNNFGGEIPSSLGNLSYLTFLDLSTNNFVGEIPSSFGSLNQLSILRLDNNKLS 220

Query: 669 GKFP 680
           G  P
Sbjct: 221 GNLP 224



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 22/65 (33%), Positives = 38/65 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I+++ S+D++H+++ G LP  L   + L V ++ SNR   T P    +LK L  L + +N
Sbjct: 549 IKSLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRINDTFPFWLSSLKKLQVLVLRSN 608

Query: 660 RFAGK 674
            F G+
Sbjct: 609 AFHGR 613



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L+++ ++G LP E+  L  L    ++ N+F GT+P    +L IL     S N
Sbjct: 206 LNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLPPNITSLSILESFSASGN 265

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 266 NFVGTIP 272



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/61 (29%), Positives = 31/61 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++ I L+H+   G LP  +  L+ L  F  + N F GTIP     +  +  + + NN+ +
Sbjct: 233 LSEISLSHNQFTGTLPPNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLS 292

Query: 669 G 671
           G
Sbjct: 293 G 293



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 13/43 (30%), Positives = 28/43 (65%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           +R + S+D++ + ++G +P+ELG L+ L   + + N+  G +P
Sbjct: 734 LRELESLDVSRNKLSGEIPQELGNLSYLAYMNFSHNQLVGQVP 776



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +3

Query: 570 FHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           F  ++N F G IP    +L+ L  LD+SNN F+G  P
Sbjct: 484 FFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIP 520



>pir|T05260|T05260 probable disease resistance protein F18A5.300 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545155 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549076 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 509

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 24/62 (38%), Positives = 39/62 (62%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE +G+L +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 328 TIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 387

Query: 675 FP 680
            P
Sbjct: 388 IP 389



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           P    +  + S+DL+ + ++G +P ELG L  L   + + NR  G IP+
Sbjct: 366 PSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQ 414



>pir|T05257|T05257 probable disease resistance protein F18A5.270 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545152 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549073 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 668

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 24/62 (38%), Positives = 39/62 (62%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE +G+L +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 502 TIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 561

Query: 675 FP 680
            P
Sbjct: 562 IP 563



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 19/65 (29%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S   + +  +G +P  +  L  L    +++N+F G+IP+ F+N K +  L + NN  
Sbjct: 283 SIYSFIASDNQFSGEIPRTVCELVSLNTLVLSNNKFSGSIPRCFENFKTISILHLRNNSL 342

Query: 666 AGKFP 680
           +G FP
Sbjct: 343 SGVFP 347



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + S++L+ ++I+G LP+ +G L  L      +    G IP    +L  L  LD+S 
Sbjct: 53  RLQHLQSLELSSNNISGILPDSIGNLKYLRSLSFRTCHLFGKIPSSLGSLSYLTHLDLSY 112

Query: 657 NRFAGKFP 680
           N F  + P
Sbjct: 113 NDFTSEGP 120



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+ S+D+ H+ ++G LP+ L    DL   ++  NR     P   ++L  L  L + +N F
Sbjct: 354 TLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNRINDKFPFWLRSLSNLQILVLRSNEF 413

Query: 666 AG 671
            G
Sbjct: 414 YG 415



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           P    +  + S+DL+ + ++G +P ELG L  L   + + NR  G IP+
Sbjct: 540 PSLSNLSNLQSLDLSQNRLSGSIPPELGKLTFLEWMNFSYNRLEGPIPQ 588



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 17/66 (25%), Positives = 33/66 (50%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +T++ + L ++ ++G  P+E+ +   L    +  N   G +PK       L  L++ +NR
Sbjct: 330 KTISILHLRNNSLSGVFPKEI-ISETLTSLDVGHNWLSGQLPKSLIKCTDLEFLNVEDNR 388

Query: 663 FAGKFP 680
              KFP
Sbjct: 389 INDKFP 394



>pir|A71400|A71400 probable disease resistance protein - Arabidopsis
           thaliana>gb:ATCHRIV37_1545156 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 37.>gb:ATFCA0_1551442
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 0.
          Length = 869

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 24/62 (38%), Positives = 39/62 (62%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE +G+L +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 695 TIDVSGNRLEGDIPESIGILKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 754

Query: 675 FP 680
            P
Sbjct: 755 IP 756



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%)
 Frame = +3

Query: 489 VASIDLNH-DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +  +DL++ DD+ G + + +G L  L V  + S +F G IP    NL  L +LD+S N F
Sbjct: 155 LTDLDLSYNDDLTGEILDSMGNLKHLRVLSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYF 214

Query: 666 AGKFP 680
            G+ P
Sbjct: 215 TGELP 219



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++ ++DL+ +     LP  +  L+ L  F I+ N F GTIP     L  L +LD+  N
Sbjct: 286 LSSLTNVDLSSNQFKAMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMLPSLIKLDLGTN 345

Query: 660 RFAG 671
            F+G
Sbjct: 346 DFSG 349



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 25/83 (30%), Positives = 41/83 (49%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           C +TG   +   +   +  +  +DL+ +   G LP+ +G L  L V +++   F G IP 
Sbjct: 188 CKFTGKIPSSLGN---LTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKIPT 244

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
              +L  L +LDIS N F  + P
Sbjct: 245 SLGSLSNLTDLDISKNEFTSEGP 267



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 22/108 (20%)
 Frame = +3

Query: 402 TTSDWVGS-DVCNYTGVFCAPAPD------------NPKIRT---------VASIDLNHD 515
           TT+ W  + D C++ G+ C P               N ++R+         + S+DL+++
Sbjct: 56  TTAKWRNNTDCCSWGGISCDPKTGVVVELDLGNSDLNGRLRSNSSLFRLQHLQSLDLSYN 115

Query: 516 DIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           D++  LP+  G    L V ++      G IP   ++L  L +LD+S N
Sbjct: 116 DLSCTLPDSSGNFKYLRVLNLLGCNLFGEIPTSLRSLSYLTDLDLSYN 163



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/66 (31%), Positives = 33/66 (50%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +T++ + L ++ ++G +PEE  L   L    + SNR  G  PK   N   L  L++  NR
Sbjct: 523 KTLSILHLRNNSLSGVIPEE-SLHGYLRSLDVGSNRLSGQFPKSLINCSYLQFLNVEENR 581

Query: 663 FAGKFP 680
               FP
Sbjct: 582 INDTFP 587



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/61 (32%), Positives = 27/61 (44%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L      G +P  LG L  L    ++ N F G +P    NLK L  L++    F GK 
Sbjct: 183 LSLTSCKFTGKIPSSLGNLTYLTDLDLSWNYFTGELPDSMGNLKSLRVLNLHRCNFFGKI 242

Query: 678 P 680
           P
Sbjct: 243 P 243



>pir|T00502|T00502 probable receptor-like protein kinase At2g23300
           [imported] - Arabidopsis thaliana>gb:AC002391_1530628
           Arabidopsis thaliana chromosome 2 clone T20D16 map
           CIC06C07, complete sequence.
          Length = 773

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 2/124 (1%)
 Frame = +3

Query: 315 SLTFENDRIRNAYIALQAWKQAIISDPRNTTSDWV--GSDVCNYTGVFCAPAPDNPKIRT 488
           SL   +  + +  + L ++K +++ DP +    W     + C++ GV C     N   R 
Sbjct: 23  SLFLLSSALNSDGVLLLSFKYSVLLDPLSLLQSWNYDHDNPCSWRGVLC-----NNDSRV 77

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V ++ L + ++ G +P +LG L +L   ++++N   G++P +F     L  LD+SNN  +
Sbjct: 78  V-TLSLPNSNLVGSIPSDLGFLQNLQSLNLSNNSLNGSLPVEFFAADKLRFLDLSNNLIS 136

Query: 669 GKFP 680
           G+ P
Sbjct: 137 GEIP 140



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+++ I+G +P  +G L +L   +++ N F G +P    +L  L E+ + NN F+G+F
Sbjct: 128 LDLSNNLISGEIPVSIGGLHNLQTLNLSDNIFTGKLPANLASLGSLTEVSLKNNYFSGEF 187

Query: 678 P 680
           P
Sbjct: 188 P 188



>gb:AP006156_1861014 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1043F11.
          Length = 1214

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/61 (39%), Positives = 38/61 (62%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+++ + G +P  LG +  L V ++  N   GTIP  F+NLK +  LD+SNN+ +G  
Sbjct: 695 LDLSYNGLTGTIPGSLGNMMYLQVLNLGHNELNGTIPDAFQNLKSIGALDLSNNQLSGGI 754

Query: 678 P 680
           P
Sbjct: 755 P 755



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 10/118 (8%)
 Frame = +3

Query: 357 ALQAWKQAIISD-PRNTTSDWV-------GSDVCNYTGVFCAPAPDNPKIRTVASIDLNH 512
           AL A+++A ++D P    + WV        +  C++ GV CAP PD      VA++DL+ 
Sbjct: 36  ALLAFRRASVADDPDGALASWVLGAGGANSTAPCSWDGVSCAPPPDG----RVAAVDLSG 91

Query: 513 DDIAGYLP-EELGLLADLGVFHINSNRFCGTIPKKFKNLK-ILFELDISNNRFAGKFP 680
             +AG L  + L  L  L   ++  N F G +     +    L E+DIS+N   G  P
Sbjct: 92  MSLAGELRLDALLALPALQRLNLRGNAFYGNLSHAAPSPPCALVEVDISSNALNGTLP 149



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 18/61 (29%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L H+++ G +P+    L  +G   +++N+  G IP     L  L + D+SNN   G  
Sbjct: 719 LNLGHNELNGTIPDAFQNLKSIGALDLSNNQLSGGIPPGLGGLNFLADFDVSNNNLTGPI 778

Query: 678 P 680
           P
Sbjct: 779 P 779



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 18/44 (40%), Positives = 29/44 (65%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K++ +A + LN + ++G++P ELG   +L    +NSN F GTIP
Sbjct: 572 KLQKLAILQLNKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTIP 615



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L+ + + G +P   G L  L +  +N N   G +P +  +   L  LD+++N F G  
Sbjct: 555 VSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGSCNNLIWLDLNSNSFTGTI 614

Query: 678 P 680
           P
Sbjct: 615 P 615



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++  G +P ELG L    V   ++SNR  G +P  F   K L  LD+  N+ AG F
Sbjct: 338 NEFTGAIPVELGQLCGRIVELDLSSNRLVGALPASFAKCKSLEVLDLGGNQLAGDF 393



>gb:AP004762_1844627 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686H11.
          Length = 1104

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L  +D+AG++P E+G   +L    +N NR  GTIP +  NLK L  LD+  N
Sbjct: 439 LQNLTKLLLLSNDLAGFIPPEIGNCTNLYRLRLNGNRLSGTIPAEIGNLKNLNFLDLGGN 498

Query: 660 RFAGKFP 680
           R  G  P
Sbjct: 499 RLTGPLP 505



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           YT +     P++      + S+ L  + ++G +P +LG L  L    +  N+  GTIP +
Sbjct: 256 YTAMLTGSIPESIGNCTELTSLYLYQNTLSGGIPPQLGQLKKLQTVLLWQNQLVGTIPPE 315

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N K L  +D+S N   G  P
Sbjct: 316 IGNCKELVLIDLSLNELTGPIP 337



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/72 (26%), Positives = 37/72 (51%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   +++ + ++ L  + + G +P E+G   +L +  ++ N   G IP+ F  L  L +L
Sbjct: 290 PQLGQLKKLQTVLLWQNQLVGTIPPEIGNCKELVLIDLSLNELTGPIPRSFGGLPNLQQL 349

Query: 645 DISNNRFAGKFP 680
            +S N+  G  P
Sbjct: 350 QLSTNKLTGVIP 361



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 31/115 (26%), Positives = 47/115 (40%), Gaps = 7/115 (6%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNT---TSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDI 521
           AL  WK ++++           W  SD   C + GV C    D      V ++ +   D+
Sbjct: 36  ALLRWKASLLNGTGGGGGGLDSWRASDASPCRWLGVSCDARGD------VVAVTIKTVDL 89

Query: 522 AGYLPEE--LGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            G LP    L L   L    ++     G IPK+  +L  L  LD++ N+  G  P
Sbjct: 90  GGALPAASVLPLARSLKTLVLSGTNLTGAIPKELGDLAELSTLDLTKNQLTGAIP 144



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +DL  + ++G +P ELG L  L +  +++ NR  G IP +F  L  L  LD+S N+ +G
Sbjct: 587 LDLGDNALSGGIPPELGKLPFLEISLNLSCNRLSGEIPSQFAGLDKLGCLDVSYNQLSG 645



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 21/64 (32%), Positives = 32/64 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++++DL  + + G +P EL  L  L    +NSN   G IP    NL  L  L + +N  +
Sbjct: 129 LSTLDLTKNQLTGAIPAELCRLRKLQSLALNSNSLRGAIPDAIGNLTGLTSLTLYDNELS 188

Query: 669 GKFP 680
           G  P
Sbjct: 189 GAIP 192



>gb:AP003708_1832227 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0041F13.
          Length = 961

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 21/61 (34%), Positives = 35/61 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D +++++ G++P  LG L  LG  H+N+NR  G +P    +  +L  LDI +N   G  
Sbjct: 596 VDFSYNNLEGHIPSSLGSLTFLGSLHLNNNRLSGLLPSSLSSCGLLVFLDIGDNNLEGSI 655

Query: 678 P 680
           P
Sbjct: 656 P 656



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 34/104 (32%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD-IAGYLPEELGL 551
           +A + DP    S WVG + CN+ GV C     +     +A+ +++ +D + G +   L  
Sbjct: 36  KATLRDPGGMLSSWVGLNCCNWYGVTCNNRTGHIIKLNLANYNISKEDALTGDISPSLVH 95

Query: 552 LADLGVFHINSNRFCGT-IPKKFKNLKILFELDISNNRFAGKFP 680
           L  L   ++ SN F G  IP    +LK L  LD+S   F GK P
Sbjct: 96  LTHLMYLNLRSNDFGGARIPAFIGSLKNLRHLDLSFANFGGKIP 139



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D+  +++ G +PE +G  +  L +  + SNRF G+IP +   L+ L  LD++NN+ +G 
Sbjct: 644 LDIGDNNLEGSIPEWIGDNMQYLMILRLRSNRFTGSIPSELSQLQGLQVLDLANNKLSGP 703

Query: 675 FP 680
            P
Sbjct: 704 LP 705



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           SIDL+++ + G +P E+G L  L   +++ N   G IP+   N+  L  LD+S NR +G 
Sbjct: 762 SIDLSNNYLTGGIPAEVGDLVGLKNLNLSKNLLSGHIPETIGNMSSLESLDLSWNRLSGI 821

Query: 675 FP 680
            P
Sbjct: 822 IP 823



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 18/62 (29%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+ + ++G++PE +G ++ L    ++ NR  G IP+   +L +L  L++S N  +G 
Sbjct: 786 NLNLSKNLLSGHIPETIGNMSSLESLDLSWNRLSGIIPESMTSLHLLSHLNMSYNNLSGM 845

Query: 675 FP 680
            P
Sbjct: 846 VP 847



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 23/72 (31%), Positives = 42/72 (58%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD P+  ++  +DL+++ ++G LP  +G      +  ++SNR   +IP  F N+  L  +
Sbjct: 516 PDMPE--SLDLLDLSNNSLSGSLPNSVGGNKTRYIL-LSSNRLNRSIPAYFCNMPWLSAI 572

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G+ P
Sbjct: 573 DLSNNSLSGELP 584



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 24/114 (21%), Positives = 46/114 (40%), Gaps = 4/114 (3%)
 Frame = +3

Query: 351 YIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP----KIRTVASIDLNHDD 518
           Y+ +  W  ++ SD   + +      V   +G    P   N         +  IDL+ ++
Sbjct: 183 YLDMSLWNLSVASDWLQSLNMLASLKVLRLSGTNLPPTNQNSLSQSNFTVLNEIDLSGNN 242

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +   P  L  +  L + +++     G+IP+   NL  L  L +++N   G  P
Sbjct: 243 FSSRFPNWLASIYTLSLINLDYCELHGSIPESVGNLTALNTLYLADNSLIGAIP 296



>gb:AP002522_1822355 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824373 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1070

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 1/108 (0%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGS-DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           L A+K  + S    T + W  S   CN+ GV C+      +   V  + L   ++AG LP
Sbjct: 53  LPAFKAGLSS---RTLTSWNSSTSFCNWEGVKCS----RHRPTRVVGLSLPSSNLAGTLP 105

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             +G L  L  F+++SN   G IP    +L+ L  LD+ +N F+G FP
Sbjct: 106 PAIGNLTFLRWFNLSSNGLHGEIPPSLGHLQHLRILDLGSNSFSGAFP 153



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ +A ++L  +  +G +P  +G + +L    +  N   G+IP+  +NL  L+ LD+S 
Sbjct: 576 KLKGIAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIPETLQNLTQLWHLDVSF 635

Query: 657 NRFAGKFP 680
           N   GK P
Sbjct: 636 NNLQGKVP 643



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 26/86 (30%), Positives = 35/86 (40%), Gaps = 24/86 (27%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN----------------- 623
           ++DL    ++G +PE +G LADL +  + S R  G IP    N                 
Sbjct: 413 TLDLGSTSLSGVIPESIGKLADLAIITLYSTRLSGLIPSVIGNLTNLNILAAYDAHLEGP 472

Query: 624 -------LKILFELDISNNRFAGKFP 680
                  LK LF LD+S N   G  P
Sbjct: 473 IPATLGKLKKLFALDLSINHLNGSVP 498



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/62 (30%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           SI+L+ + ++  +P+ +G    L    ++SN F G+IP+    LK +  L+++ N+F+G 
Sbjct: 534 SIELSGNQLSDQIPDSIGNCEVLEYLLLDSNSFEGSIPQSLTKLKGIAILNLTMNKFSGS 593

Query: 675 FP 680
            P
Sbjct: 594 IP 595



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           PA    K+  +    L+ +  +G +P  L  L+ L   +++ N+F G +P     LK L 
Sbjct: 274 PANIGDKLPNMQHFVLSVNQFSGVIPSSLFNLSSLTDVYLDGNKFSGFVPPTVGRLKSLV 333

Query: 639 ELDISNNR 662
            L +S+NR
Sbjct: 334 RLSLSSNR 341



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 15/59 (25%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ +   G +P+ L  L  + + ++  N+F G+IP    ++  L +L +++N  +G  P
Sbjct: 561 LDSNSFEGSIPQSLTKLKGIAILNLTMNKFSGSIPNAIGSMGNLQQLCLAHNNLSGSIP 619



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/89 (24%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = +3

Query: 417 VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG-LLADLGVFHINSNRF 593
           +G D  + +G F    P    +  +  + +  + + G +P  +G  L ++  F ++ N+F
Sbjct: 238 IGLDGNSLSGEF---PPSIWNLSKLTVLQVYENKLKGSIPANIGDKLPNMQHFVLSVNQF 294

Query: 594 CGTIPKKFKNLKILFELDISNNRFAGKFP 680
            G IP    NL  L ++ +  N+F+G  P
Sbjct: 295 SGVIPSSLFNLSSLTDVYLDGNKFSGFVP 323



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHI-NSNRFCGTIPKKFKNLKILFELDIS 653
           K++ + ++DL+ + + G +P+E+  L  L  F I + N   G IP +   L  L  +++S
Sbjct: 479 KLKKLFALDLSINHLNGSVPKEIFELPSLSWFLILSDNTLSGPIPSEVGTLVNLNSIELS 538

Query: 654 NNRFAGKFP 680
            N+ + + P
Sbjct: 539 GNQLSDQIP 547



>gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,
           complete cds.
          Length = 1096

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/64 (37%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNN 659
           R++  ++L  +D +G +P+ELG +  L +  +++ NRF G IP +F +LK L  LD+S+N
Sbjct: 573 RSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHN 632

Query: 660 RFAG 671
           +  G
Sbjct: 633 QLTG 636



 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/67 (35%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R +  + L  +D++G++P ++G   +L    +N NR  G+IP +  NLK L  +DIS N
Sbjct: 429 LRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISEN 488

Query: 660 RFAGKFP 680
           R  G  P
Sbjct: 489 RLVGSIP 495



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+ L  +++ G +P ELG   +L +   + N   GTIP+ F  L+ L EL +S N
Sbjct: 285 LKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVN 344

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 345 QISGTIP 351



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 22/66 (33%), Positives = 37/66 (56%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R + +IDL+++ ++G +P+E+  L +L    + SN   G IP    N   L+ L ++ NR
Sbjct: 406 RELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNR 465

Query: 663 FAGKFP 680
            AG  P
Sbjct: 466 LAGSIP 471



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID + + + G +P   G L +L    ++ N+  GTIP++  N   L  L+I NN   G+ 
Sbjct: 315 IDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEI 374

Query: 678 P 680
           P
Sbjct: 375 P 375



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  ID + + ++  LP  +GLL +L   ++  NR  G IP++    + L  L++  N 
Sbjct: 525 KSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGEND 584

Query: 663 FAGKFP 680
           F+G+ P
Sbjct: 585 FSGEIP 590



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TGV      D  ++     +DL+ + ++G +P E+  L  L    +N+N   G IP +
Sbjct: 104 NLTGVIPKEIGDFTELEL---LDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPME 160

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             NL  L EL + +N+ +G+ P
Sbjct: 161 IGNLSGLVELMLFDNKLSGEIP 182



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD      +  + LN + +AG +P E+G L +L    I+ NR  G+IP      + L  L
Sbjct: 448 PDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFL 507

Query: 645 DISNNRFAG 671
           D+  N  +G
Sbjct: 508 DLHTNSLSG 516



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 3/111 (2%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL +WK  + +   +  S W  +D   CN+ GV C    +      V+ I L   D+ G 
Sbjct: 31  ALLSWKSQL-NISGDAFSSWHVADTSPCNWVGVKCNRRGE------VSEIQLKGMDLQGS 83

Query: 531 LP-EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LP   L  L  L    ++S    G IPK+  +   L  LD+S+N  +G  P
Sbjct: 84  LPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIP 134



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 20/68 (29%), Positives = 31/68 (45%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  +  + L+ + I+G +PEEL     L    I++N   G IP    NL+ L       
Sbjct: 332 KLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQ 391

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 392 NKLTGNIP 399



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/67 (28%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ V +I +    ++G +P+E+G   +L   ++  N   G+IP     LK L  L +  N
Sbjct: 237 LKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQN 296

Query: 660 RFAGKFP 680
              GK P
Sbjct: 297 NLVGKIP 303



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + ++ LN +++ G++P E+G L+ L    +  N+  G IP+    LK L  L    
Sbjct: 139 RLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGG 198

Query: 657 NR-FAGKFP 680
           N+   G+ P
Sbjct: 199 NKNLRGELP 207



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++++++ I G +P  +  L  L +F    N+  G IP+     + L  +D+S N  +G  
Sbjct: 363 LEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSI 422

Query: 678 P 680
           P
Sbjct: 423 P 423



>gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 2 (SERK2) mRNA, complete cds.
          Length = 628

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P D   +  + S+DL  +   G +P+ LG L  L    +N+N   G IP  
Sbjct: 104 YSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMS 163

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 164 LTNITTLQVLDLSNNRLSGSVP 185



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 34/104 (32%), Positives = 48/104 (46%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG 548
           +A + DP N    W  + V  C +  V C    +N  IR    +DL + D++G L  +LG
Sbjct: 40  RANLVDPYNVLQSWDPTLVNPCTWFHVTCNN--ENSVIR----VDLGNADLSGQLVPQLG 93

Query: 549 LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L +L    + SN   G +P    NL  L  LD+  N F G  P
Sbjct: 94  QLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIP 137



>gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-rich
           repeat receptor-like protein kinase mRNA, partial cds.
          Length = 987

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 27/78 (34%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P++  ++  + ++DL+ ++I+G LP  +     L   ++ SN+  G IP    NL
Sbjct: 477 FSGPLPESIVRLGQLGTLDLHSNEISGELPIGIQSWTKLNELNLASNQLSGKIPDGIGNL 536

Query: 627 KILFELDISNNRFAGKFP 680
            +L  LD+S NRF+GK P
Sbjct: 537 SVLNYLDLSGNRFSGKIP 554



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = +3

Query: 390 DPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL 563
           DP +  S W  +D   CN+ GV C  A  +  +  V S+DL   ++AG  P  L  L +L
Sbjct: 26  DPDSALSSWNDADSTPCNWLGVECDDASSSSPV--VRSLDLPSANLAGPFPTVLCRLPNL 83

Query: 564 GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
               + +N    T+P      + L  LD+S N   G  P
Sbjct: 84  THLSLYNNSINSTLPPSLSTCQNLEHLDLSQNLLTGGLP 122



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 21/61 (34%), Positives = 38/61 (62%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + ++G +P+ +G L+ L    ++ NRF G IP   +N+K L   ++SNNR +G+ 
Sbjct: 518 LNLASNQLSGKIPDGIGNLSVLNYLDLSGNRFSGKIPFGLQNMK-LNVFNLSNNRLSGEL 576

Query: 678 P 680
           P
Sbjct: 577 P 577



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+ G   A   ++P +     + L  + + G LP+ LG  + L    ++SN+F GTIP  
Sbjct: 308 NFEGSVPASIANSPHLY---ELRLFRNRLTGELPQNLGKNSPLKWLDVSSNQFTGTIPAS 364

Query: 615 FKNLKILFELDISNNRFAGKFP 680
               + + EL + +N F+G+ P
Sbjct: 365 LCEKRQMEELLMIHNEFSGEIP 386



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +PEE+G + +L  F    N+F G +P+    L  L  LD+ +N  +G+ P
Sbjct: 455 GQIPEEIGWVENLMEFSGGENKFSGPLPESIVRLGQLGTLDLHSNEISGELP 506



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           I T+  ++L+++    G +P ELG L +L V  +      G IP     LK L +LD++ 
Sbjct: 176 ISTLKMLNLSYNPFHPGRIPAELGNLTNLEVLWLTECNLVGEIPDSLGRLKNLKDLDLAI 235

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 236 NGLTGRIP 243



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 20/74 (27%), Positives = 33/74 (44%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           P PD      + S++L  ++  G +P  +     L    +  NR  G +P+       L 
Sbjct: 289 PIPDELCRLPLESLNLYENNFEGSVPASIANSPHLYELRLFRNRLTGELPQNLGKNSPLK 348

Query: 639 ELDISNNRFAGKFP 680
            LD+S+N+F G  P
Sbjct: 349 WLDVSSNQFTGTIP 362



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 1/81 (1%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG   A   D P ++    +DL  ++ +G +P+  G    L V  +  N    TIP    
Sbjct: 118 TGGLPATLSDVPNLKY---LDLTGNNFSGPIPDSFGRFQKLEVLSLVYNLIESTIPPFLG 174

Query: 621 NLKILFELDISNNRF-AGKFP 680
           N+  L  L++S N F  G+ P
Sbjct: 175 NISTLKMLNLSYNPFHPGRIP 195



>gb:AY534122S2_1612167 Aegilops tauschii transposons Caspar, XJ,
           Angela, and XJ, complete sequence; LRR protein WM1.7
           (WM1.7) and LRR protein WM1.12 (WM1.12) genes, complete
           cds; transposons Ophelia2, Angela3s, and XJ3, complete
           sequence; LRR protein WM1.3 (WM1.3) gene, complete cds;
           Stowaway MITE, transposons XJ1, Jody, Angela, and XJ and
           Stowaway MITE, complete sequence; LRR protein WM1.2
           (WM1.2) and LLR protein WM1.1 (WM1.1) genes, complete
           cds; transposons XJ, XA, Angela, and Fred and WM1.11
           gene, complete sequence; RPM1-like sequence and LRR
           protein WM1.10 (WM1.10) genes, complete cds; and
           transposon XJ, complete sequence.
          Length = 1102

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/67 (35%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + T+  +D+  +D+ G +P ELG L  L   +++ N   G+IP +  NL+ L  LD+S+N
Sbjct: 426 LTTLTYLDIGSNDLNGGVPAELGNLRYLTALYLSDNEIAGSIPPQLGNLRSLTALDLSDN 485

Query: 660 RFAGKFP 680
             AG  P
Sbjct: 486 EIAGSIP 492



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 25/72 (34%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  + S+DL  + + G +P ELG L  L    I SN   G +P +  NL+ L  L
Sbjct: 397 PQLGNLTCLTSLDLGGNHLTGSIPTELGALTTLTYLDIGSNDLNGGVPAELGNLRYLTAL 456

Query: 645 DISNNRFAGKFP 680
            +S+N  AG  P
Sbjct: 457 YLSDNEIAGSIP 468



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +R++ ++DL+ ++IAG +P +LG L  L    + +N   G+IP++  +   L  L
Sbjct: 469 PQLGNLRSLTALDLSDNEIAGSIPPQLGNLTGLTYLELRNNHLTGSIPRELMHSTSLTIL 528

Query: 645 DISNNRFAGKFP 680
           D+  N   G  P
Sbjct: 529 DLPGNHLIGSVP 540



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 22/67 (32%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R + ++ L+ ++IAG +P +LG L  L    ++ N   G+IP +  NL  L  L++ NN
Sbjct: 450 LRYLTALYLSDNEIAGSIPPQLGNLRSLTALDLSDNEIAGSIPPQLGNLTGLTYLELRNN 509

Query: 660 RFAGKFP 680
              G  P
Sbjct: 510 HLTGSIP 516



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +  +G LP  +G L  L    ++ N+F   IP     L  L  LD+S+N F+G  
Sbjct: 787 LDLSWNKFSGGLPTWIGTLVHLRFLILSHNKFSDNIPVDITKLGYLQYLDLSSNNFSGAI 846

Query: 678 P 680
           P
Sbjct: 847 P 847



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/61 (37%), Positives = 37/61 (60%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D++++ I+G LP  L  +A   V+ +NSN+  G IP   K++ +L   DIS N+F G  
Sbjct: 649 MDISNNQISGRLPAHLHGMAFEEVY-LNSNQLTGPIPALPKSIHLL---DISKNQFFGTI 704

Query: 678 P 680
           P
Sbjct: 705 P 705



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 30/140 (21%), Positives = 55/140 (39%), Gaps = 39/140 (27%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAP------------------------- 461
           AL ++K+ IIS+  N  + W G D C + GV C+                          
Sbjct: 44  ALLSFKEGIISNNTNLLASWKGQDCCRWRGVSCSNRTGHVIKLRLRNPNVALYPNGYYDV 103

Query: 462 -----------APDNPKIRTVASIDLNHDDIAG---YLPEELGLLADLGVFHINSNRFCG 599
                      +P    ++ +  +DL+ + + G    +P  LG + +L   +++   F G
Sbjct: 104 CGGASALFGEISPSLLSLKHLEHLDLSVNCLLGSNNQIPHLLGSMGNLRYLNLSGIPFNG 163

Query: 600 TIPKKFKNLKILFELDISNN 659
            +P +  NL  L  LD+  +
Sbjct: 164 RVPSQLGNLSKLQYLDLGQD 183



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
           P P  PK  ++  +D++ +   G +P  LG    L +  ++SN+  G IP+    L+ L 
Sbjct: 682 PIPALPK--SIHLLDISKNQFFGTIPSILGA-PRLQMLSMHSNQISGYIPESICKLEPLI 738

Query: 639 ELDISNNRFAGK 674
            LD+SNN   G+
Sbjct: 739 YLDLSNNILEGE 750



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/59 (32%), Positives = 30/59 (50%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+++++ G +P +LG L  L    +  N   G+IP +   L  L  LDI +N   G  P
Sbjct: 386 LDYNNLVGPIPPQLGNLTCLTSLDLGGNHLTGSIPTELGALTTLTYLDIGSNDLNGGVP 444



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-FKNLKILFELDISNN 659
           +DL  + + G +P E+G L +L    +++N F G I ++   NL  L ++D+S+N
Sbjct: 528 LDLPGNHLIGSVPTEIGSLINLQFLDLSNNSFTGMITEEHLANLTSLQKIDLSSN 582



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 19/61 (31%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + ++ + I+GY+PE +  L  L    +++N   G I K F ++  L  L + NN  +GK 
Sbjct: 716 LSMHSNQISGYIPESICKLEPLIYLDLSNNILEGEIVKCF-DIYSLEHLILGNNSLSGKI 774

Query: 678 P 680
           P
Sbjct: 775 P 775



>gb:AY084350_1569441 Arabidopsis thaliana clone 105146 mRNA,
           complete sequence.
          Length = 477

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query: 474 PKIRTVASI----DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           P I ++A I    +L H+ ++G +P  L     L    ++ NRF G IPK F NL  +F 
Sbjct: 240 PSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFN 299

Query: 642 LDISNNRFAGKFP 680
           LD+S+N     FP
Sbjct: 300 LDLSHNLLTDPFP 312



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 28/86 (32%), Positives = 42/86 (48%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT 602
           +D+ N TG F       P ++ V    + ++ ++G LP  +G L+ L  F +  NRF G 
Sbjct: 109 TDLKNITGSFPQFLFQLPNLKYVY---IENNRLSGPLPANIGALSQLEAFSLEGNRFTGP 165

Query: 603 IPKKFKNLKILFELDISNNRFAGKFP 680
           IP    NL  L +L + NN   G  P
Sbjct: 166 IPSSISNLTRLTQLKLGNNLLTGTIP 191



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 2/109 (1%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           L A+K  I  DP    S W  G+  C++ GV C        +      D+    ++G L 
Sbjct: 35  LLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLS 94

Query: 537 EELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             L  L  L G++  +     G+ P+    L  L  + I NNR +G  P
Sbjct: 95  PSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLP 143



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +   +  +  + L ++ + G +P  +  L  +   ++  NR  GTIP  FK++
Sbjct: 162 FTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSM 221

Query: 627 KILFELDISNNRFAGKFP 680
             L  L +S N F+G  P
Sbjct: 222 PELRSLTLSRNGFSGNLP 239



>gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR
           receptor-like kinase 1 (rch1 gene).
          Length = 1135

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 25/68 (36%), Positives = 39/68 (57%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ +  + L  +++ G +PEE+G +  L    ++ N F GTIPK F NL  L EL +S+
Sbjct: 297 KLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSS 356

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 357 NNITGSIP 364



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 25/82 (30%), Positives = 39/82 (47%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TG   +   D  K+       ++ + I+G +P E+GLL +L +F    N+  G IP +
Sbjct: 358 NITGSIPSILSDCTKL---VQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDE 414

Query: 615 FKNLKILFELDISNNRFAGKFP 680
               + L  LD+S N   G  P
Sbjct: 415 LAGCQNLQALDLSQNYLTGSLP 436



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +D++G LP+ELG L +L    +  N   G IP++   +K L  +D+S N F+G  P
Sbjct: 282 LYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIP 340



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 18/67 (26%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ ++ +DL+ ++++G +P E+     L + ++++N   G +P    +L  L  LD+S+N
Sbjct: 490 LQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSN 549

Query: 660 RFAGKFP 680
              GK P
Sbjct: 550 DLTGKIP 556



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +DL+ ++I+G +PEEL  + DL +  +++ N   G IP++   L  L  LDIS+N  +G
Sbjct: 592 LDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDGFIPERISALNRLSVLDISHNMLSG 650



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 20/62 (32%), Positives = 35/62 (56%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+ + + G++PE +  L  L V  I+ N   G +      L+ L  L+IS+NRF+G 
Sbjct: 616 ALNLSWNSLDGFIPERISALNRLSVLDISHNMLSGDL-SALSGLENLVSLNISHNRFSGY 674

Query: 675 FP 680
            P
Sbjct: 675 LP 676



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/67 (26%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ +IDL+ +  +G +P+  G L++L    ++SN   G+IP    +   L +  I  N
Sbjct: 322 MKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSDCTKLVQFQIDAN 381

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 382 QISGLIP 388



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++R +  + L  + I+G +P E G    L    + +NR  G IPK    L+ L  LD+S 
Sbjct: 441 QLRNLTKLLLISNAISGVIPLETGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSE 500

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 501 NNLSGPVP 508



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+ + + G +P  LG L +L    +NSN   G IP +  +   L  L+I +N  +   
Sbjct: 135 IDLSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENL 194

Query: 678 P 680
           P
Sbjct: 195 P 195



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLN-HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           KI T+ SI    + +++G +PEE+G   +L V  + + +  G++P     L  L  L + 
Sbjct: 200 KISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLFVY 259

Query: 654 NNRFAGKFP 680
           +   +G+ P
Sbjct: 260 STMLSGEIP 268



>gb:ATAC009991_1543120 Arabidopsis thaliana chromosome III BAC F9F8
           genomic sequence, complete sequence.
          Length = 957

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 25/64 (39%), Positives = 37/64 (57%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL+ +  +G +P  +G L+ L    ++ NRF G IP    NL  L  L +S NRF 
Sbjct: 171 LTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFF 230

Query: 669 GKFP 680
           G+FP
Sbjct: 231 GQFP 234



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 23/67 (34%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + ++ L+++  +G +P  +G L+ L V +++ N F G IP  F NL  L  LD+S N
Sbjct: 240 LSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFN 299

Query: 660 RFAGKFP 680
           +  G FP
Sbjct: 300 KLGGNFP 306



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/62 (35%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++D + +   G +P+ +GLL +L V ++++N F G IP    NL  L  LD+S N+  G+
Sbjct: 770 AVDFSGNKFEGEIPKSIGLLKELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGE 829

Query: 675 FP 680
            P
Sbjct: 830 IP 831



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 36/124 (29%), Positives = 51/124 (41%), Gaps = 21/124 (16%)
 Frame = +3

Query: 372 KQAIISDPRNTTSDWVGSDVCNYTGVFCAPAP------------------DNPKIRTV-- 491
           K   I   R T S    SD CN+ GV C                       N  IR +  
Sbjct: 63  KMVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHF 122

Query: 492 -ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
             ++D +H+D  G +   +  L+ L    ++ NRF G I     NL  L  LD+S N+F+
Sbjct: 123 LTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFS 182

Query: 669 GKFP 680
           G+ P
Sbjct: 183 GQIP 186



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL+++  +G +   +G L+ L    ++ N+F G IP    NL  L  L +S NRF 
Sbjct: 147 LTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIGNLSHLTFLGLSGNRFF 206

Query: 669 GKFP 680
           G+ P
Sbjct: 207 GQIP 210



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/67 (29%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  +  +D++ + + G  P  L  L  L V  +++N+F GT+P    +L  L     S+N
Sbjct: 288 LNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDN 347

Query: 660 RFAGKFP 680
            F G FP
Sbjct: 348 AFTGTFP 354



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+D+ H+ + G LP  L   ++L V ++ SNR     P    +L+ L  L + +N F
Sbjct: 630 SLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAF 689

Query: 666 AG 671
            G
Sbjct: 690 HG 691



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI-LFELDISNNRFAGKFP 680
           ++++  G +P  +  L  L    ++ N F G+IP+  +NLK  L EL++  N  +G FP
Sbjct: 566 SNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFP 624



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  +++ S+ L+   I  + PE L    +LG   +++N+  G +P     L  LF L++
Sbjct: 484 DPPSQSIQSLYLSGCGITDF-PEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNL 542

Query: 651 SNNRFAG 671
           SNN F G
Sbjct: 543 SNNTFIG 549



>gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic
           embryogenesis receptor kinase 1, complete cds.
          Length = 621

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P D   + ++ S+DL  +   G +P+ LG L+ L    +N+N   G IP  
Sbjct: 97  YSNNITGPIPSDLGNLTSLVSLDLYLNSFTGPIPDTLGKLSKLRFLRLNNNSLSGPIPMS 156

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 157 LTNISSLQVLDLSNNRLSGVVP 178



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 34/108 (31%), Positives = 48/108 (44%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL + +  +I DP N    W      +   V C    +N    +V  +DL +  ++G L 
Sbjct: 28  ALHSLRSNLI-DPNNVLHSWDPYPCQSLHMVSCYMQMNN----SVILVDLENAALSGQLV 82

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +LGLL +L    + SN   G IP    NL  L  LD+  N F G  P
Sbjct: 83  SQLGLLKNLQYLELYSNNITGPIPSDLGNLTSLVSLDLYLNSFTGPIP 130



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/67 (29%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L  ++I G +P +LG L  L    +  N F G IP     L  L  L ++NN
Sbjct: 88  LKNLQYLELYSNNITGPIPSDLGNLTSLVSLDLYLNSFTGPIPDTLGKLSKLRFLRLNNN 147

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 148 SLSGPIP 154



>gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19E20.
          Length = 1110

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 25/68 (36%), Positives = 39/68 (57%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ +  + L  +++ G +PEE+G +  L    ++ N F GTIPK F NL  L EL +S+
Sbjct: 297 KLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSS 356

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 357 NNITGSIP 364



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/64 (31%), Positives = 33/64 (51%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +    ++ + I+G +P E+GLL +L +F    N+  G IP +    + L  LD+S N   
Sbjct: 373 LVQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLT 432

Query: 669 GKFP 680
           G  P
Sbjct: 433 GSLP 436



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +D++G LP+ELG L +L    +  N   G IP++   +K L  +D+S N F+G  P
Sbjct: 282 LYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIP 340



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 18/67 (26%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ ++ +DL+ ++++G +P E+     L + ++++N   G +P    +L  L  LD+S+N
Sbjct: 490 LQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSN 549

Query: 660 RFAGKFP 680
              GK P
Sbjct: 550 DLTGKIP 556



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +DL+ ++I+G +PEEL  + DL +  +++ N   G IP++   L  L  LDIS+N  +G
Sbjct: 592 LDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDGFIPERISALNRLSVLDISHNMLSG 650



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ +IDL+ +  +G +P+  G L++L    ++SN   G+IP    N   L +  I  N
Sbjct: 322 MKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSNCTKLVQFQIDAN 381

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 382 QISGLIP 388



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 20/62 (32%), Positives = 35/62 (56%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+ + + G++PE +  L  L V  I+ N   G +      L+ L  L+IS+NRF+G 
Sbjct: 616 ALNLSWNSLDGFIPERISALNRLSVLDISHNMLSGDL-SALSGLENLVSLNISHNRFSGY 674

Query: 675 FP 680
            P
Sbjct: 675 LP 676



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 22/68 (32%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++R +  + L  + I+G +P E+G    L    + +NR  G IPK    L+ L  LD+S 
Sbjct: 441 QLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSE 500

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 501 NNLSGPVP 508



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL+ + + G +P  LG L +L    +NSN   G IP +  +   L  L+I +N  +   
Sbjct: 135 IDLSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENL 194

Query: 678 P 680
           P
Sbjct: 195 P 195



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLN-HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           KI T+ SI    + +++G +PEE+G   +L V  + + +  G++P     L  L  L + 
Sbjct: 200 KISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLSVY 259

Query: 654 NNRFAGKFP 680
           +   +G+ P
Sbjct: 260 STMLSGEIP 268



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 17/68 (25%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  + S+ +    ++G +P+ELG  ++L    +  N   GT+PK+   L+ L ++ +  
Sbjct: 249 QLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQ 308

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 309 NNLHGPIP 316



>gb:AB010699_1511239 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN9.
          Length = 770

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 26/65 (40%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T  SID + +   G +PE +G L  L V  +++N F G IP     LK L  LD+S NR 
Sbjct: 593 TYTSIDFSGNSFEGQIPESIGDLKSLIVLDLSNNSFTGRIPSSLAKLKQLESLDLSQNRI 652

Query: 666 AGKFP 680
           +G  P
Sbjct: 653 SGNIP 657



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++  +DL+++   G +P  L  L  L    ++ NR  G IP++ + L  L  +++S+N
Sbjct: 615 LKSLIVLDLSNNSFTGRIPSSLAKLKQLESLDLSQNRISGNIPQELRELTFLGYVNMSHN 674

Query: 660 RFAGKFP 680
           R  G+ P
Sbjct: 675 RLTGQIP 681



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 17/45 (37%), Positives = 30/45 (66%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           K++ + S+DL+ + I+G +P+EL  L  LG  +++ NR  G IP+
Sbjct: 638 KLKQLESLDLSQNRISGNIPQELRELTFLGYVNMSHNRLTGQIPQ 682



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 19/68 (27%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  + S+DL+ +   G +P  +  L+ L    ++ N+  G IP    +L +L  +D+S 
Sbjct: 115 RLTYLESLDLSKNGFIGEVPSSISNLSRLTNLDLSYNKLTGGIPN-LHSLTLLENIDLSY 173

Query: 657 NRFAGKFP 680
           N+F+G  P
Sbjct: 174 NKFSGAIP 181



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%)
 Frame = +3

Query: 561 LGVFHINSNRFCGTIPKKFKNLKILFE-LDISNNRFAGKFP 680
           L +  +++N F GTIP+   N+ +  E L +SNN   G+ P
Sbjct: 400 LSLLDLSNNNFSGTIPRCLTNVSLGLEALKLSNNSLTGRLP 440



>pir|G86459|G86459 Hypothetical 55.6 kDa protein - Arabidopsis
           thaliana>gb:AE005172_892171 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069299_1540789 Arabidopsis thaliana
           chromosome 1 BAC T1E4 genomic sequence, complete
           sequence.
          Length = 512

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)
 Frame = +3

Query: 474 PKIRTVASI----DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           P I ++A I    +L H+ ++G +P  L     L    ++ NRF G IPK F NL  +F 
Sbjct: 275 PSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFN 334

Query: 642 LDISNNRFAGKFP 680
           LD+S+N     FP
Sbjct: 335 LDLSHNLLTDPFP 347



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/86 (32%), Positives = 43/86 (50%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT 602
           +D+ N TG F       P ++ V    + ++ ++G LP  +G L+ L  F +  NRF G 
Sbjct: 144 TDLKNITGSFPQFLFQLPNLKYVY---IENNRLSGTLPANIGALSQLEAFSLEGNRFTGP 200

Query: 603 IPKKFKNLKILFELDISNNRFAGKFP 680
           IP    NL +L +L + NN   G  P
Sbjct: 201 IPSSISNLTLLTQLKLGNNLLTGTIP 226



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 2/109 (1%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           L A+K  I  DP    S W  G+  C++ GV C        +      D+    ++G L 
Sbjct: 70  LLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLS 129

Query: 537 EELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             L  L  L G++  +     G+ P+    L  L  + I NNR +G  P
Sbjct: 130 PSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLP 178



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +   +  +  + L ++ + G +P  +  L  +   ++  NR  GTIP  FK++
Sbjct: 197 FTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSM 256

Query: 627 KILFELDISNNRFAGKFP 680
             L  L +S N F+G  P
Sbjct: 257 PELRSLTLSRNGFSGNLP 274



>pir|T14354|T14354 probable somatic embryogenesis receptor-like
           kinase - carrot>gb:A67797_1450276 Sequence 2 from Patent
           WO9743427.>gb:DCU93048_1675787 Daucus carota somatic
           embryogenesis receptor-like kinase mRNA, complete cds.
          Length = 553

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P D   +  + S+DL  +  +G +P+ LG L  L    +N+N   G IP  
Sbjct: 31  YSNNISGPIPSDLGNLTNLVSLDLYMNSFSGPIPDTLGKLTRLRFLRLNNNSLSGPIPMS 90

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 91  LTNITTLQVLDLSNNRLSGPVP 112



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K   + +++L  ++I+G +P +LG L +L    +  N F G IP     L  L  L ++N
Sbjct: 21  KYGVLMTLELYSNNISGPIPSDLGNLTNLVSLDLYMNSFSGPIPDTLGKLTRLRFLRLNN 80

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 81  NSLSGPIP 88



>pir|T05050|T05050 protein kinase homolog M3E9.30 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546535 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 65.>gb:ATM3E9_1553616
           Arabidopsis thaliana DNA chromosome 4, P1 clone M3E9
           (ESSA project).
          Length = 1029

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/64 (37%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGV-FHINSNRFCGTIPKKFKNLKILFELDISNN 659
           R++  ++L  +D +G +P+ELG +  L +  +++ NRF G IP +F +LK L  LD+S+N
Sbjct: 498 RSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHN 557

Query: 660 RFAG 671
           +  G
Sbjct: 558 QLTG 561



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+ L  +++ G +P ELG   +L +   + N   GTIP+ F  L+ L EL +S N
Sbjct: 285 LKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVN 344

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 345 QISGTIP 351



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID + + + G +P   G L +L    ++ N+  GTIP++  N   L  L+I NN   G+ 
Sbjct: 315 IDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEI 374

Query: 678 P 680
           P
Sbjct: 375 P 375



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  ID + + ++  LP  +GLL +L   ++  NR  G IP++    + L  L++  N 
Sbjct: 450 KSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGEND 509

Query: 663 FAGKFP 680
           F+G+ P
Sbjct: 510 FSGEIP 515



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 25/82 (30%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TGV      D  ++     +DL+ + ++G +P E+  L  L    +N+N   G IP +
Sbjct: 104 NLTGVIPKEIGDFTELEL---LDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPME 160

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             NL  L EL + +N+ +G+ P
Sbjct: 161 IGNLSGLVELMLFDNKLSGEIP 182



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 3/111 (2%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL +WK  + +   +  S W  +D   CN+ GV C    +      V+ I L   D+ G 
Sbjct: 31  ALLSWKSQL-NISGDAFSSWHVADTSPCNWVGVKCNRRGE------VSEIQLKGMDLQGS 83

Query: 531 LP-EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LP   L  L  L    ++S    G IPK+  +   L  LD+S+N  +G  P
Sbjct: 84  LPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIP 134



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 20/68 (29%), Positives = 31/68 (45%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  +  + L+ + I+G +PEEL     L    I++N   G IP    NL+ L       
Sbjct: 332 KLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQ 391

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 392 NKLTGNIP 399



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/67 (28%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ V +I +    ++G +P+E+G   +L   ++  N   G+IP     LK L  L +  N
Sbjct: 237 LKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQN 296

Query: 660 RFAGKFP 680
              GK P
Sbjct: 297 NLVGKIP 303



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + ++ LN +++ G++P E+G L+ L    +  N+  G IP+    LK L  L    
Sbjct: 139 RLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGG 198

Query: 657 NR-FAGKFP 680
           N+   G+ P
Sbjct: 199 NKNLRGELP 207



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++++++ I G +P  +  L  L +F    N+  G IP+     + L  +D+S N  +G  
Sbjct: 363 LEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSI 422

Query: 678 P 680
           P
Sbjct: 423 P 423



>pir|D86466|D86466 69.4K hypothetical protein F23M19.11 -
           Arabidopsis thaliana>gb:AE005172_892224 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:CQ768559_1451797 Sequence 54 from Patent
           WO2004007712.>gb:AX120063_1461711 Sequence 46 from
           Patent WO0129240.>gb:F23M19_1677952 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 628

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P D   +  + S+DL  +   G +P+ LG L  L    +N+N   G IP  
Sbjct: 104 YSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMS 163

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 164 LTNIMTLQVLDLSNNRLSGSVP 185



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 34/104 (32%), Positives = 48/104 (46%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG 548
           +A + DP N    W  + V  C +  V C    +N  IR    +DL + D++G L  +LG
Sbjct: 40  RANLVDPNNVLQSWDPTLVNPCTWFHVTCNN--ENSVIR----VDLGNADLSGQLVPQLG 93

Query: 549 LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L +L    + SN   G +P    NL  L  LD+  N F G  P
Sbjct: 94  QLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIP 137



>pir|A85357|A85357 receptor-like kinase homolog [imported] -
           Arabidopsis thaliana>gb:ATCHRIV73_1546973 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 73.
          Length = 573

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 20/119 (16%)
 Frame = +3

Query: 384 ISDPRNTTSDW--VGSDVCNYTGVFCAP--------APDNP----------KIRTVASID 503
           + DP    ++W     D C++  + C+P        AP              +  +  + 
Sbjct: 40  LHDPHGALNNWDEFSVDPCSWAMITCSPDNLVIGLGAPSQSLSGGLSESIGNLTNLRQVS 99

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L +++I+G +P ELG L  L    +++NRF G IP     L  L  LD+S N  +G  P
Sbjct: 100 LQNNNISGKIPPELGFLPKLQTLDLSNNRFSGDIPVSIDQLSSLQYLDLSYNNLSGPVP 158



>gb:AP004747_1844318 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0407A09.
          Length = 1001

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435 NYTGVFCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           N TG+     PD      ++  IDL+ + + G LP  LG L++L   ++++N+  GTIP+
Sbjct: 137 NLTGII----PDELTNCSSLTYIDLSGNALTGALPPNLGSLSNLAYLYLSANKLTGTIPQ 192

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
              N+  L E+ +  NRF G  P
Sbjct: 193 ALGNITTLVEIYLDTNRFEGGIP 215



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 23/66 (34%), Positives = 39/66 (59%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           + +A+I + ++ + G +P   G L  LGV +++ N   GTIP    +L ++ +LD+S NR
Sbjct: 517 KDLANIQMGNNFLTGNIPVTFGDLKSLGVLNLSHNSLSGTIPTTLNDLPVMSKLDLSYNR 576

Query: 663 FAGKFP 680
             GK P
Sbjct: 577 LQGKIP 582



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           P N    ++  + L ++     LP+ +  ++ +L +  ++ N F G IP    N   L E
Sbjct: 239 PFNFSSLSLQLLSLEYNMFGKVLPQNISDMVPNLQILRLDYNMFQGQIPSSLGNALQLTE 298

Query: 642 LDISNNRFAGKFP 680
           + ++NN F G+ P
Sbjct: 299 ISMANNYFTGQIP 311



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 20/62 (32%), Positives = 30/62 (48%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+DLN+  + G + E +  L  L    ++ N F G+IP     L  L  L ++ N F G 
Sbjct: 403 SLDLNN--LTGKIDEWVPKLTKLQKLLLHRNNFSGSIPSSIAELPRLSTLSLAYNAFDGP 460

Query: 675 FP 680
            P
Sbjct: 461 IP 462



>gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0038C05.>gb:AP005813_1858325 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0676F10.
          Length = 640

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 20/120 (16%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDV--CNYTGVFCAP--------APD-------NPKIRTVASID-- 503
           ++ DP      W  + V  C++  + C+P        AP        +P I  + +++  
Sbjct: 42  LLKDPHGVLKSWDQNSVDPCSWAMITCSPDFLVTGLEAPSQHLSGLLSPSIGNLTNLETV 101

Query: 504 -LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L +++I G +P E+G L +L    ++SN F G IP    +L+ L  L ++NN  +G FP
Sbjct: 102 LLQNNNITGPIPAEIGRLENLKTLDLSSNSFYGEIPSSVGHLESLQYLRLNNNTLSGPFP 161



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++  + ++DL+ +   G +P  +G L  L    +N+N   G  P    NL  L  LD+S 
Sbjct: 118 RLENLKTLDLSSNSFYGEIPSSVGHLESLQYLRLNNNTLSGPFPSASANLSHLVFLDLSY 177

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 178 NNLSGPIP 185



>gb:AP003044_1824339 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0038C05.>gb:AP005813_1858323 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0676F10.
          Length = 263

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 20/120 (16%)
 Frame = +3

Query: 381 IISDPRNTTSDWVGSDV--CNYTGVFCAP------------------APDNPKIRTVASI 500
           ++ DP      W  + V  C++  + C+P                  AP    +  + +I
Sbjct: 53  LLEDPHGVLKSWDQNSVDPCSWALITCSPDSLVTTLEAPGQHLSGLLAPSIGDLTNLETI 112

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L +++I+G +P E+G LA+L    ++SN+F G IP    +LK L  L ++NN  +G  P
Sbjct: 113 LLQNNNISGPIPAEIGKLANLKRLDLSSNQFHGEIPCSVGHLKSLQYLRLNNNTLSGPIP 172



>gb:AP002522_1822351 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0009G03.>gb:AP003045_1824369 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0030H07.
          Length = 1051

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 1/108 (0%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGS-DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           L A+K A      +  + W  S   C++ GV C    D      VA++ L   ++AG LP
Sbjct: 38  LLAFKAAFRGSSSSALASWNSSTSFCSWEGVTC----DRRTPARVAALTLPSGNLAGGLP 93

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
             +G L+ L   +++SN   G IP     L+ L  LDI  N F+G+ P
Sbjct: 94  PVIGNLSFLQSLNLSSNELYGEIPPSLGRLRRLEILDIGGNSFSGELP 141



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + ++G +P+ +G + +L    +  N F G IP   +NL +L++LD+S N   G+ 
Sbjct: 571 LNLTMNKLSGRIPDTIGRIGNLQQLFLAQNNFSGPIPATLQNLTMLWKLDVSFNNLQGEV 630

Query: 678 P 680
           P
Sbjct: 631 P 631



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 20/71 (28%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +3

Query: 477 KIRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           ++ T+A+++   L+ + ++G +P+ +G    L    ++ N F G IP+   NLK L  L+
Sbjct: 513 EVATLANLNQLILSGNQLSGQIPDSIGNCQVLESLLLDKNSFEGGIPQSLTNLKGLNILN 572

Query: 648 ISNNRFAGKFP 680
           ++ N+ +G+ P
Sbjct: 573 LTMNKLSGRIP 583



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +3

Query: 510 HDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL-FELDISNNRFAGKFP 680
           + ++ G +P  LG L  L V  +++NR  G+IPK+   L  L + LD+S N  +G  P
Sbjct: 454 YTNLEGPIPASLGKLKTLFVLDLSTNRLNGSIPKEILELPSLSWYLDLSYNSLSGPLP 511



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 19/69 (27%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVF-HINSNRFCGTIPKKFKNLKILFELDIS 653
           K++T+  +DL+ + + G +P+E+  L  L  +  ++ N   G +P +   L  L +L +S
Sbjct: 467 KLKTLFVLDLSTNRLNGSIPKEILELPSLSWYLDLSYNSLSGPLPIEVATLANLNQLILS 526

Query: 654 NNRFAGKFP 680
            N+ +G+ P
Sbjct: 527 GNQLSGQIP 535



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           + T+  +  N + + G +P  +G     +  F +  N+F G IP    NL  L  + +  
Sbjct: 244 LSTLTVLAANDNMLQGSIPANIGDKFPGIQYFGLADNQFSGVIPSSLFNLSSLTIVLLYG 303

Query: 657 NRFAGKFP 680
           NRF+G  P
Sbjct: 304 NRFSGFVP 311



>gb:AK117429_1815463 Arabidopsis thaliana At3g11010 mRNA for
           putative disease resistance protein, complete cds,
           clone: RAFL17-03-J22.
          Length = 894

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 23/67 (34%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + ++ L+++  +G +P  +G L+ L V +++ N F G IP  F NL  L  LD+S N
Sbjct: 177 LSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFN 236

Query: 660 RFAGKFP 680
           +  G FP
Sbjct: 237 KLGGNFP 243



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/62 (35%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++D + +   G +P+ +GLL +L V ++++N F G IP    NL  L  LD+S N+  G+
Sbjct: 707 AVDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGE 766

Query: 675 FP 680
            P
Sbjct: 767 IP 768



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 24/64 (37%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL+ +  +G +P  +  L+ L    ++ NRF G IP    NL  L  L +S NRF 
Sbjct: 108 LTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFF 167

Query: 669 GKFP 680
           G+FP
Sbjct: 168 GQFP 171



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 21/120 (17%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPAP------------------DNPKIRTV---ASI 500
           I   R T S    SD CN+ GV C                       N  IR +    ++
Sbjct: 4   IESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTL 63

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           D +H+D  G +   +  L+ L    ++ NRF G I     NL  L  LD+S N+F+G+ P
Sbjct: 64  DRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIP 123



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL+++  +G +   +G L+ L    ++ N+F G IP    NL  L  L +S NRF 
Sbjct: 84  LTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFF 143

Query: 669 GKFP 680
           G+ P
Sbjct: 144 GQIP 147



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 20/67 (29%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  +  +D++ + + G  P  L  L  L V  +++N+F GT+P    +L  L     S+N
Sbjct: 225 LNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDN 284

Query: 660 RFAGKFP 680
            F G FP
Sbjct: 285 AFTGTFP 291



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+D+ H+ + G LP  L   ++L V ++ SNR     P    +L+ L  L + +N F
Sbjct: 567 SLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAF 626

Query: 666 AG 671
            G
Sbjct: 627 HG 628



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)
 Frame = +3

Query: 507 NHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI-LFELDISNNRFAGKFP 680
           ++++  G +P  +  L  L    ++ N F G+IP+  +NLK  L EL++  N  +G FP
Sbjct: 503 SNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFP 561



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           +P  +++ S+ L+   I  + PE L    +LG   +++N+  G +P     L  LF L++
Sbjct: 421 DPPSQSIQSLYLSGCGITDF-PEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNL 479

Query: 651 SNNRFAG 671
           SNN F G
Sbjct: 480 SNNTFIG 486



>gb:AF137354_1771222 Pisum sativum leucine-rich repeat protein
           (LRRP) mRNA, partial cds.
          Length = 122

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 26/72 (36%), Positives = 43/72 (59%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  ++  +  ++L +++I G +P+ELG L +L    +  N+F G IPK F NLK L  L
Sbjct: 29  PELAQLTHLQYLELYNNNINGNIPQELGNLKNLISMDLYDNQFEGNIPKSFSNLKTLKFL 88

Query: 645 DISNNRFAGKFP 680
            ++NN+  G  P
Sbjct: 89  RLNNNKLTGPIP 100



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 23/64 (35%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V  +DL + +I+G L  EL  L  L    + +N   G IP++  NLK L  +D+ +N+F 
Sbjct: 13  VIRLDLGNSNISGSLGPELAQLTHLQYLELYNNNINGNIPQELGNLKNLISMDLYDNQFE 72

Query: 669 GKFP 680
           G  P
Sbjct: 73  GNIP 76



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL  +   G +P+    L  L    +N+N+  G IP++  +LK L  LD+SNN
Sbjct: 58  LKNLISMDLYDNQFEGNIPKSFSNLKTLKFLRLNNNKLTGPIPRELTHLKNLKILDVSNN 117

Query: 660 RFAG 671
              G
Sbjct: 118 DLCG 121



>gb:AF049920_1764119 Petunia x hybrida PGPS/D4 (PGPS/D4) mRNA,
           complete cds.>gb:AF325673_1786592 Petunia x hybrida LRR
           protein S/D4 gene, complete cds.
          Length = 353

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 40/169 (23%), Positives = 65/169 (38%), Gaps = 62/169 (36%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDVCNYTGVFC------------------------APAP 467
           L  +K  I SD     S+W G++ CN+ G+ C                        APAP
Sbjct: 32  LNDFKVGIHSDTSGRLSNWKGTECCNWPGISCNSTTGRVVQINLPGYYEESSDDDEAPAP 91

Query: 468 D---------NPKIRTVASIDL-----------------------------NHDDIAGYL 533
                     +P I  + S++L                               + I+G +
Sbjct: 92  VIGRTMTGSISPSITLLTSLELIDLSKLVGLTGPIPSSIGFNLKNLKKLFLEGNQISGVI 151

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           P+ +  L +L + ++ +N   G+IP+   NL+ L EL +SNN  +GK P
Sbjct: 152 PQSMSNLTNLVILNLENNLLTGSIPENIGNLQALQELSLSNNSLSGKIP 200



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  + L ++ + G +P  +G L  L  F +++N+  G IP    NLK L  L + NN+ +
Sbjct: 235 IEHLRLENNRLTGIIPPSVGFLTSLLRFSVSNNQLTGPIPTTLGNLKSLQHLFVDNNQLS 294

Query: 669 GKFP 680
            + P
Sbjct: 295 VQLP 298



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
           protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
           somatic embryogenesis receptor-like kinase 1, exons
           1-11.
          Length = 622

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + S+DL  ++  G +P+ LG L+ L    +N+N   G IPK   N+  L  L
Sbjct: 110 PELGNLTNLVSLDLYLNNFTGGIPDTLGQLSKLRFLRLNNNSLSGQIPKTLTNINTLQVL 169

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G  P
Sbjct: 170 DLSNNNLSGGVP 181



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++  D  N    W  + V  C +  V C P  DN  IR    +DL +  ++G 
Sbjct: 31  ALYSLRQSL-KDNNNVLQSWDPTLVNPCTWFHVTCNP--DNSVIR----LDLGNAQLSGP 83

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L ++    + SN   G IP +  NL  L  LD+  N F G  P
Sbjct: 84  LVPQLGQLKNMQYLELYSNNISGPIPPELGNLTNLVSLDLYLNNFTGGIP 133



>gb:T1N24_1723666 Arabidopsis thaliana BAC T1N24.
          Length = 811

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/67 (35%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + T  +ID + +   G +P  +GLL +L V ++++N F G IP    NL  L  LD+S N
Sbjct: 625 LNTFTTIDFSGNKFEGEIPRSVGLLKELHVLNLSNNGFTGHIPSSMGNLIELESLDVSQN 684

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 685 KLSGEIP 691



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 20/72 (27%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P +   + +  +DL+ +++ G +PE +G L +L + ++  N   G IP+    L  L EL
Sbjct: 276 PKSISAKNLVHLDLSANNLNGSIPESIGNLTNLELLYLFVNELTGEIPRAIGKLPELKEL 335

Query: 645 DISNNRFAGKFP 680
            +  N+  G+ P
Sbjct: 336 KLFTNKLTGEIP 347



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +V SID+ H+ +AG LP  L  ++ L V ++ SN+   T P    +++ L  L + +N F
Sbjct: 489 SVKSIDIGHNQLAGKLPRSLVRISSLEVLNVESNKINDTFPFWLDSMQQLQVLVLRSNAF 548

Query: 666 AG 671
            G
Sbjct: 549 HG 550



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+++   ++++  G +P  +  L  L +  +++N+F G+IP+   NL  L  L++  N  
Sbjct: 419 TISNNTRSNNNFTGKIPSFICELHSLILLDLSTNKFNGSIPRCIANLSTLEVLNLGKNHL 478

Query: 666 AGKFP 680
           +G  P
Sbjct: 479 SGSIP 483



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 18/68 (26%), Positives = 36/68 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ ++  +DL+ +   G +P  +  L+ L V ++  N   G+IP+       +  +DI +
Sbjct: 440 ELHSLILLDLSTNKFNGSIPRCIANLSTLEVLNLGKNHLSGSIPENIST--SVKSIDIGH 497

Query: 657 NRFAGKFP 680
           N+ AGK P
Sbjct: 498 NQLAGKLP 505



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 22/86 (25%), Positives = 34/86 (39%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT 602
           S  CN+  + C           V  I+  + +  G +P  +    +L   +++ N F G 
Sbjct: 50  SSPCNWPRITCTAG-------NVTEINFQNQNFTGTVPTTICNFPNLKSLNLSFNYFAGE 102

Query: 603 IPKKFKNLKILFELDISNNRFAGKFP 680
            P    N   L  LD+S N F G  P
Sbjct: 103 FPTVLYNCTKLQYLDLSQNLFNGSLP 128



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +++ G +P+ L  L +L   ++ +N   G IPK   + K L  LD+S N   G  
Sbjct: 240 VDLSVNNLTGRIPDVLFGLKNLTELYLFANDLTGEIPKSI-SAKNLVHLDLSANNLNGSI 298

Query: 678 P 680
           P
Sbjct: 299 P 299



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           S+D++ + ++G +P ELG L+ L   + + N+F G +P
Sbjct: 678 SLDVSQNKLSGEIPPELGKLSYLAYMNFSQNQFVGLVP 715



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 16/54 (29%), Positives = 31/54 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +DL  +  AG +P+ +G ++ L V ++  + + GT P +  +L  L EL ++ N
Sbjct: 141 LDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGTFPSEIGDLSELEELQLALN 194



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           I G   E + +L        + N+F G IP+    LK L  L++SNN F G  P
Sbjct: 614 IKGIALEMVRILNTFTTIDFSGNKFEGEIPRSVGLLKELHVLNLSNNGFTGHIP 667



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLAD-LGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL+ +   G LP+++  LA  L    + +N F G IPK    +  L  L++  + + G 
Sbjct: 116 LDLSQNLFNGSLPDDINRLAPKLKYLDLAANSFAGDIPKNIGRISKLKVLNLYMSEYDGT 175

Query: 675 FP 680
           FP
Sbjct: 176 FP 177



>gb:OSJN00195_1696527 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0015G09, complete sequence.
          Length = 347

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ S+DL H+ + G +P+ LG L  + +  ++ N F G IP+   N   L +LD+SNN F
Sbjct: 47  SLLSLDLKHNMLNGSIPQLLGQLKSIVLLDLSQNMFVGQIPEFLVNFSFLNQLDLSNNYF 106

Query: 666 AGKFP 680
            G  P
Sbjct: 107 EGPIP 111



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 9/71 (12%)
 Frame = +3

Query: 495 SIDLNHDDIAGYL---------PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           S+DL+++ + GY+         P  LG    L    +  N   G+IP+    LK +  LD
Sbjct: 17  SLDLSNNLLTGYISFNKFSGEIPSSLGQCVSLLSLDLKHNMLNGSIPQLLGQLKSIVLLD 76

Query: 648 ISNNRFAGKFP 680
           +S N F G+ P
Sbjct: 77  LSQNMFVGQIP 87



>gb:OSJN00174_1696186 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0058K23, complete sequence.
          Length = 1174

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K++ +  +DL+ + ++G +P E+G L++L +  +  NRF G IP++    K L  L
Sbjct: 203 PSMAKLKGIMVVDLSCNQLSGSIPPEIGDLSNLQILQLYENRFSGHIPRELGRCKNLTLL 262

Query: 645 DISNNRFAGKFP 680
           +I +N F G+ P
Sbjct: 263 NIFSNGFTGEIP 274



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 39/139 (28%), Positives = 55/139 (39%), Gaps = 31/139 (22%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDW-VGSDV------------CNYTGVFC-------------- 455
           AL  +K  +  DP    + W VG               CN+TGV C              
Sbjct: 40  ALLEFKNGVADDPLGVLAGWRVGKSGDGAVRGGALPRHCNWTGVACDGAGQVTSIQLPES 99

Query: 456 ----APAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
               A +P    I T+  IDL  +  AG +P +LG L +L    ++SN F G IP    N
Sbjct: 100 KLRGALSPFLGNISTLQVIDLTSNAFAGGIPPQLGRLGELEQLVVSSNYFAGGIPSSLCN 159

Query: 624 LKILFELDISNNRFAGKFP 680
              ++ L ++ N   G  P
Sbjct: 160 CSAMWALALNVNNLTGAIP 178



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+ + +AG +P ELG L  L    +++NR  GT+P    NL  L  L++S N  
Sbjct: 306 SLLNLDLSMNQLAGPIPPELGELPSLQRLSLHANRLAGTVPASLTNLVNLTILELSENHL 365

Query: 666 AGKFP 680
           +G  P
Sbjct: 366 SGPLP 370



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 24/61 (39%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL H+ + G  P E+  L  L +    SNRF G IP    NL+ L  LD+S+N   G  
Sbjct: 526 LDLGHNRLDGVFPAEVFELRQLTILGAGSNRFAGPIPDAVANLRSLSFLDLSSNMLNGTV 585

Query: 678 P 680
           P
Sbjct: 586 P 586



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + ++G +PEE+G +  L    +  NRF G +P    N+  L  LD+ +NR  G F
Sbjct: 478 LQLQGNALSGEIPEEIGNMTKLISLKLGRNRFAGHVPASISNMSSLQLLDLGHNRLDGVF 537

Query: 678 P 680
           P
Sbjct: 538 P 538



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 21/61 (34%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +   G L   +G L +L V  +  N   G IP++  N+  L  L +  NRFAG  
Sbjct: 454 LDLSENSFTGGLSRLVGQLGNLTVLQLQGNALSGEIPEEIGNMTKLISLKLGRNRFAGHV 513

Query: 678 P 680
           P
Sbjct: 514 P 514



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++R +  +    +  AG +P+ +  L  L    ++SN   GT+P     L  L  LD+S+
Sbjct: 543 ELRQLTILGAGSNRFAGPIPDAVANLRSLSFLDLSSNMLNGTVPAALGRLDQLLTLDLSH 602

Query: 657 NRFAGKFP 680
           NR AG  P
Sbjct: 603 NRLAGAIP 610



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 17/61 (27%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+++   G +P E+G L  +    +++N+  G +P      K L+ LD+S N   G+ 
Sbjct: 624 LNLSNNAFTGAIPAEIGGLVMVQTIDLSNNQLSGGVPATLAGCKNLYSLDLSGNSLTGEL 683

Query: 678 P 680
           P
Sbjct: 684 P 684



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           + + +  +++  +   G +P ELG L +L V  +  N     IP+  +    L  LD+S 
Sbjct: 255 RCKNLTLLNIFSNGFTGEIPGELGELTNLEVMRLYKNALTSEIPRSLRRCVSLLNLDLSM 314

Query: 657 NRFAGKFP 680
           N+ AG  P
Sbjct: 315 NQLAGPIP 322



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + + S+DL+ + + G LP  L    DL    +I+ N   G IP     LK +  LD+S N
Sbjct: 667 KNLYSLDLSGNSLTGELPANLFPQLDLLTTLNISGNDLDGEIPADIAALKHIQTLDVSRN 726

Query: 660 RFAGKFP 680
            FAG  P
Sbjct: 727 AFAGAIP 733



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/62 (30%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L  +  AG++P  +  ++ L +  +  NR  G  P +   L+ L  L   +NRFAG 
Sbjct: 501 SLKLGRNRFAGHVPASISNMSSLQLLDLGHNRLDGVFPAEVFELRQLTILGAGSNRFAGP 560

Query: 675 FP 680
            P
Sbjct: 561 IP 562



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +++ G LP  +  L  + V  ++ N+  G+IP +  +L  L  L +  NRF+G  P
Sbjct: 195 NNLDGELPPSMAKLKGIMVVDLSCNQLSGSIPPEIGDLSNLQILQLYENRFSGHIP 250



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A+  ++ +  +G LP  LG L  L    +  N   G IP    +   L +LD+S N F 
Sbjct: 403 LANASMSFNLFSGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSENSFT 462

Query: 669 G 671
           G
Sbjct: 463 G 463



>gb:OSB6015_1692796 Oryza sativa indica(GLA4) genomic DNA,
           chromosome 4, BAC clone: b6015.
          Length = 1344

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K++ +  +DL+ + ++G +P E+G L++L +  +  NRF G IP++    K L  L
Sbjct: 203 PSMAKLKGIMVVDLSCNQLSGSIPPEIGDLSNLQILQLYENRFSGHIPRELGRCKNLTLL 262

Query: 645 DISNNRFAGKFP 680
           +I +N F G+ P
Sbjct: 263 NIFSNGFTGEIP 274



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 39/139 (28%), Positives = 55/139 (39%), Gaps = 31/139 (22%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDW-VGSDV------------CNYTGVFC-------------- 455
           AL  +K  +  DP    + W VG               CN+TGV C              
Sbjct: 40  ALLEFKNGVADDPLGVLAGWRVGKSGDGAVRGGALPRHCNWTGVACDGAGQVTSIQLPES 99

Query: 456 ----APAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKN 623
               A +P    I T+  IDL  +  AG +P +LG L +L    ++SN F G IP    N
Sbjct: 100 KLRGALSPFLGNISTLQVIDLTSNAFAGGIPPQLGRLGELEQLVVSSNYFAGGIPSSLCN 159

Query: 624 LKILFELDISNNRFAGKFP 680
              ++ L ++ N   G  P
Sbjct: 160 CSAMWALALNVNNLTGAIP 178



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 23/65 (35%), Positives = 38/65 (58%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+ + +AG +P ELG L  L    +++NR  GT+P    NL  L  L++S N  
Sbjct: 306 SLLNLDLSMNQLAGPIPPELGELPSLQRLSLHANRLAGTVPASLTNLVNLTILELSENHL 365

Query: 666 AGKFP 680
           +G  P
Sbjct: 366 SGPLP 370



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + ++G +PEE+G L  L    +  NRF G +P    N+  L  LD+ +NR  G F
Sbjct: 478 LQLQGNALSGEIPEEIGNLTKLISLKLGRNRFAGHVPASISNMSSLQLLDLGHNRLDGMF 537

Query: 678 P 680
           P
Sbjct: 538 P 538



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 24/61 (39%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL H+ + G  P E+  L  L +    SNRF G IP    NL+ L  LD+S+N   G  
Sbjct: 526 LDLGHNRLDGMFPAEVFELRQLTILGAGSNRFAGPIPDAVANLRSLSFLDLSSNMLNGTV 585

Query: 678 P 680
           P
Sbjct: 586 P 586



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/61 (36%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +   G L   +G L +L V  +  N   G IP++  NL  L  L +  NRFAG  
Sbjct: 454 LDLSENSFTGGLSRRVGQLGNLTVLQLQGNALSGEIPEEIGNLTKLISLKLGRNRFAGHV 513

Query: 678 P 680
           P
Sbjct: 514 P 514



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++R +  +    +  AG +P+ +  L  L    ++SN   GT+P     L  L  LD+S+
Sbjct: 543 ELRQLTILGAGSNRFAGPIPDAVANLRSLSFLDLSSNMLNGTVPAALGRLDQLLTLDLSH 602

Query: 657 NRFAGKFP 680
           NR AG  P
Sbjct: 603 NRLAGAIP 610



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           + + +  +++  +   G +P ELG L +L V  +  N     IP+  +    L  LD+S 
Sbjct: 255 RCKNLTLLNIFSNGFTGEIPGELGELTNLEVMRLYKNALTSEIPRSLRRCVSLLNLDLSM 314

Query: 657 NRFAGKFP 680
           N+ AG  P
Sbjct: 315 NQLAGPIP 322



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADL-GVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + + S+DL+ + + G LP  L    DL    +I+ N   G IP     LK +  LD+S N
Sbjct: 662 KNLYSLDLSGNSLTGELPANLFPQLDLLTTLNISGNDLDGEIPADIAALKHIQTLDVSRN 721

Query: 660 RFAGKFP 680
            FAG  P
Sbjct: 722 AFAGAIP 728



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 19/62 (30%), Positives = 31/62 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S+ L  +  AG++P  +  ++ L +  +  NR  G  P +   L+ L  L   +NRFAG 
Sbjct: 501 SLKLGRNRFAGHVPASISNMSSLQLLDLGHNRLDGMFPAEVFELRQLTILGAGSNRFAGP 560

Query: 675 FP 680
            P
Sbjct: 561 IP 562



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 22/99 (22%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK---- 614
           F  P PD    +R+++ +DL+ + + G +P  LG L  L    ++ NR  G IP++    
Sbjct: 557 FAGPIPDAVANLRSLSFLDLSSNMLNGTVPAALGRLDQLLTLDLSHNRLAGAIPRRATCR 616

Query: 615 -----------------FKNLKILFELDISNNRFAGKFP 680
                               L ++  +D+SNN+ +G  P
Sbjct: 617 CTSTCRTTRSRARSPAEIGGLVMVQTIDLSNNQLSGGVP 655



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 21/89 (23%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPE---------------------ELGLLADLGVFHINSNRF 593
           ++  + ++DL+H+ +AG +P                      E+G L  +    +++N+ 
Sbjct: 591 RLDQLLTLDLSHNRLAGAIPRRATCRCTSTCRTTRSRARSPAEIGGLVMVQTIDLSNNQL 650

Query: 594 CGTIPKKFKNLKILFELDISNNRFAGKFP 680
            G +P      K L+ LD+S N   G+ P
Sbjct: 651 SGGVPATLAGCKNLYSLDLSGNSLTGELP 679



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +++ G LP  +  L  + V  ++ N+  G+IP +  +L  L  L +  NRF+G  P
Sbjct: 195 NNLDGELPPSMAKLKGIMVVDLSCNQLSGSIPPEIGDLSNLQILQLYENRFSGHIP 250



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A+  ++ +  +G LP  LG L  L    +  N   G IP    +   L +LD+S N F 
Sbjct: 403 LANASMSFNLFSGPLPAGLGRLQSLMFLSLGQNSLAGDIPDDLFDCGQLQKLDLSENSFT 462

Query: 669 G 671
           G
Sbjct: 463 G 463



>gb:AC016163_1538126 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.
          Length = 846

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 26/66 (39%), Positives = 38/66 (57%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R   +ID + + I G +PE LG L +L V +++ N F   IP+   NL  L  LDIS N+
Sbjct: 657 RDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNK 716

Query: 663 FAGKFP 680
            +G+ P
Sbjct: 717 LSGQIP 722



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/68 (32%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K++ +  +DL + ++ G +P  LG L+ L + ++  N+F G IP    NL  L  L ++N
Sbjct: 107 KLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILAN 166

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 167 NVLTGEIP 174



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L H+ + G +P  +G L +L V    +N   G IP  F NL  L    +S+N F   FP
Sbjct: 236 LTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFP 294



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK-ILFELDISNNRF 665
           +  +DLN +   G +P  +  L+ LG   +++N F G+IP   +N    + EL++ +N F
Sbjct: 444 IEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNF 503

Query: 666 AGKFP 680
           +G  P
Sbjct: 504 SGTLP 508



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEEL-GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           K+ ++  +DL+++  +G +P  +      +   ++  N F GT+P  F     L  LD+S
Sbjct: 464 KLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVS 523

Query: 654 NNRFAGKFP 680
           +N+  GKFP
Sbjct: 524 HNQLEGKFP 532



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 20/59 (33%), Positives = 28/59 (47%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  + + G +PE +  L +L    I+ N F G IP     L  L  LD+S N   G+ P
Sbjct: 357 LGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVP 415



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 30/102 (29%), Positives = 44/102 (43%), Gaps = 20/102 (19%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFH------------- 575
           N+TG   A  P   K+  +  +DL+ +++ G +P  L  L  + + H             
Sbjct: 385 NFTG---AIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEE 441

Query: 576 -------INSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
                  +NSN F G IP     L  L  LD+SNN F+G  P
Sbjct: 442 ALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIP 483



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +   ++ ++G +P     L  L +F ++SN F  T P        L   D+S N F+G F
Sbjct: 258 MSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPF 317

Query: 678 P 680
           P
Sbjct: 318 P 318



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  +   G +P  +G L  L    + +N   G IP    NL  L  L++ +NR  GK 
Sbjct: 138 VNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKI 197

Query: 678 P 680
           P
Sbjct: 198 P 198



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/65 (26%), Positives = 34/65 (52%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K   + S+D++H+ + G  P+ L     L + ++ SN+     P   ++L  L  L++ +
Sbjct: 513 KATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRS 572

Query: 657 NRFAG 671
           N+F G
Sbjct: 573 NKFYG 577



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-----FKNLKILFELDISNNR 662
           +++  + I    P  L  L  L V ++ SN+F G +  +     F++L+I+   DIS+N 
Sbjct: 544 VNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRII---DISHNN 600

Query: 663 FAGKFP 680
           F+G  P
Sbjct: 601 FSGTLP 606



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 15/65 (23%), Positives = 32/65 (49%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  ++L  ++ +G LP+      +L    ++ N+  G  PK   N K L  +++ +N+ 
Sbjct: 492 SIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKI 551

Query: 666 AGKFP 680
              FP
Sbjct: 552 KDIFP 556



>gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like
           kinase, partial cds.
          Length = 1001

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 21/65 (32%), Positives = 42/65 (64%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+ + + G +P+ +  L DL +F+++ N+  G +P++ + +  L  LD+SNN F
Sbjct: 545 SLTAVDLSRNMLEGKIPKGIKNLTDLSIFNVSINQISGPVPEEIRFMLSLTTLDLSNNNF 604

Query: 666 AGKFP 680
            GK P
Sbjct: 605 IGKVP 609



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 29/83 (34%), Positives = 47/83 (56%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           C ++GV C     + ++R VA I+++   + G+LP E+G L  L    ++ N   G +PK
Sbjct: 76  CFFSGVKC-----DRELRVVA-INVSFVPLFGHLPPEIGQLDKLENLTVSQNNLTGVLPK 129

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +   L  L  L+IS+N F+G FP
Sbjct: 130 ELAALTSLKHLNISHNVFSGHFP 152



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ +V  I+L ++   G LP E+     LG+  +++N F G IP   KNL+ L  L +  
Sbjct: 447 KLPSVTIIELANNRFNGELPPEISG-ESLGILTLSNNLFSGKIPPALKNLRALQTLSLDA 505

Query: 657 NRFAGKFP 680
           N F G+ P
Sbjct: 506 NEFVGEIP 513



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/72 (27%), Positives = 37/72 (51%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++++  +DL+  +++G +P  L  L +L    +  N   GTIP +   +  L  L
Sbjct: 251 PEFGSMKSLRYLDLSSCNLSGEIPPSLANLTNLDTLFLQINNLTGTIPSELSAMVSLMSL 310

Query: 645 DISNNRFAGKFP 680
           D+S N   G+ P
Sbjct: 311 DLSINDLTGEIP 322



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+  ++  G LP EL  L  L    ++ N F G+IP+ +   K L  L +S N  +GK 
Sbjct: 165 LDVYDNNFTGPLPVELVKLEKLKYLKLDGNYFSGSIPESYSEFKSLEFLSLSTNSLSGKI 224

Query: 678 P 680
           P
Sbjct: 225 P 225



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +R + ++ L+ ++  G +P E+  L  L V +I+ N   G IP        L  +
Sbjct: 490 PALKNLRALQTLSLDANEFVGEIPGEVFDLPMLTVVNISGNNLTGPIPTTLTRCVSLTAV 549

Query: 645 DISNNRFAGKFP 680
           D+S N   GK P
Sbjct: 550 DLSRNMLEGKIP 561



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 2/83 (2%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y   F  P P +  K+  +  + L+ +  +G +PE       L    +++N   G IPK 
Sbjct: 168 YDNNFTGPLPVELVKLEKLKYLKLDGNYFSGSIPESYSEFKSLEFLSLSTNSLSGKIPKS 227

Query: 615 FKNLKILFELDIS-NNRFAGKFP 680
              LK L  L +  NN + G  P
Sbjct: 228 LSKLKTLRYLKLGYNNAYEGGIP 250



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPK 611
           N TGV      +   + ++  ++++H+  +G+ P ++ L +  L V  +  N F G +P 
Sbjct: 122 NLTGVL---PKELAALTSLKHLNISHNVFSGHFPGQIILPMTKLEVLDVYDNNFTGPLPV 178

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +   L+ L  L +  N F+G  P
Sbjct: 179 ELVKLEKLKYLKLDGNYFSGSIP 201



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/82 (23%), Positives = 39/82 (47%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           ++TG+       + +++T+   D   +   G +P E+G    L     ++N   G +P  
Sbjct: 388 HFTGLIPRDLCKSGRLQTIMITD---NFFRGPIPNEIGNCKSLTKIRASNNYLNGVVPSG 444

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  +  ++++NNRF G+ P
Sbjct: 445 IFKLPSVTIIELANNRFNGELP 466



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++++ +++ G +P  L     L    ++ N   G IPK  KNL  L   ++S N+ +G  
Sbjct: 525 VNISGNNLTGPIPTTLTRCVSLTAVDLSRNMLEGKIPKGIKNLTDLSIFNVSINQISGPV 584

Query: 678 P 680
           P
Sbjct: 585 P 585



>gb:AB028609_1517928 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K7P8.
          Length = 962

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +3

Query: 471 NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           N  + + A+ID + + + G +PE +GLL  L   ++++N F G IP    NLK +  LD+
Sbjct: 776 NRVLSSSATIDFSGNRLEGEIPESIGLLKALIALNLSNNAFTGHIPLSLANLKKIESLDL 835

Query: 651 SNNRFAGKFP 680
           S+N+ +G  P
Sbjct: 836 SSNQLSGTIP 845



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 20/69 (28%), Positives = 30/69 (43%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  +  + L  +D  G LP    L   L + H++ N F GTIP     +  L  L
Sbjct: 318 PTISNLTQLTELYLPLNDFTGSLPLVQNL-TKLSILHLSDNHFSGTIPSSLFTMPFLSYL 376

Query: 645 DISNNRFAG 671
           D+  N  +G
Sbjct: 377 DLGGNNLSG 385



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +3

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +P E G+L  L V  +++  F G +P  F NL +L  L + +N   G
Sbjct: 194 IPSEFGMLNKLEVLFMSTGGFLGQVPSSFSNLSMLSALLLHHNELTG 240



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 21/65 (32%), Positives = 32/65 (49%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ +IDL +    G   E+  +L+       + NR  G IP+    LK L  L++SNN F
Sbjct: 760 SLEAIDLQYK---GLSMEQNRVLSSSATIDFSGNRLEGEIPESIGLLKALIALNLSNNAF 816

Query: 666 AGKFP 680
            G  P
Sbjct: 817 TGHIP 821



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 12/44 (27%), Positives = 28/44 (63%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           ++ + S+DL+ + ++G +P  +G L+ L   +++ N+  G IP+
Sbjct: 827 LKKIESLDLSSNQLSGTIPNGIGTLSFLAYMNVSHNQLNGEIPQ 870



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 20/65 (30%), Positives = 32/65 (49%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           +V  ++L  +++ G LP    L   +  F   +NR+ G IP    + + L  LD+S N F
Sbjct: 543 SVRILNLLSNNLEGALPH---LPLSVNYFSARNNRYGGDIPLSICSRRSLVFLDLSYNNF 599

Query: 666 AGKFP 680
            G  P
Sbjct: 600 TGPIP 604



>gb:AE005172_890258 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025416_1539470 Genomic sequence
           for Arabidopsis thaliana BAC F5O11 from chromosome I,
           complete sequence.
          Length = 893

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 20/127 (15%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGS-DVCN-YTGVFCAP------------------APDNPK 479
           L  +K +I  DP N+ + WV   D+CN + G+ C P                  AP    
Sbjct: 41  LLQFKGSISDDPYNSLASWVSDGDLCNSFNGITCNPQGFVDKIVLWNTSLAGTLAPGLSN 100

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ++L  +   G LP +   L  L   +++SN   G IP+    L  L  LD+S N
Sbjct: 101 LKFIRVLNLFGNRFTGNLPLDYFKLQTLWTINVSSNALSGPIPEFISELSSLRFLDLSKN 160

Query: 660 RFAGKFP 680
            F G+ P
Sbjct: 161 GFTGEIP 167



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/71 (28%), Positives = 39/71 (54%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D    R +  +D++ +D+ G + ++L  L ++ +  ++ NR  G+IP +  NL  +  LD
Sbjct: 386 DISNCRVLLELDVSGNDLEGKISKKLLNLTNIKILDLHRNRLNGSIPPELGNLSKVQFLD 445

Query: 648 ISNNRFAGKFP 680
           +S N  +G  P
Sbjct: 446 LSQNSLSGPIP 456



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 18/67 (26%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  +  +DL+ + + G +P ELG L+ +    ++ N   G IP    +L  L   ++S N
Sbjct: 414 LTNIKILDLHRNRLNGSIPPELGNLSKVQFLDLSQNSLSGPIPSSLGSLNTLTHFNVSYN 473

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 474 NLSGVIP 480



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/66 (25%), Positives = 34/66 (51%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  +DL  + + G +P  +G +  L V  + +N   G IP+   +L+ L  L++ N  
Sbjct: 319 KSLKLLDLESNKLNGSIPGSIGKMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLN 378

Query: 663 FAGKFP 680
             G+ P
Sbjct: 379 LIGEVP 384



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 24/92 (26%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ +++ I L ++ I G +P ++G L  L V ++++    G +P+   N ++L ELD+S 
Sbjct: 341 KMESLSVIRLGNNSIDGVIPRDIGSLEFLQVLNLHNLNLIGEVPEDISNCRVLLELDVSG 400

Query: 657 N------------------------RFAGKFP 680
           N                        R  G  P
Sbjct: 401 NDLEGKISKKLLNLTNIKILDLHRNRLNGSIP 432



>pir|T00475|T00475 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC004238_1531565 Arabidopsis
           thaliana chromosome 2 clone F19I3 map ve016, complete
           sequence.>gb:AY063944_1565891 Arabidopsis thaliana
           putative disease resistance protein (At2g34930) mRNA,
           complete cds.>gb:AY117169_1579210 Arabidopsis thaliana
           putative disease resistance protein (At2g34930) mRNA,
           complete cds.>gb:AF325082_1786536 Arabidopsis thaliana
           putative disease resistance protein (At2g34930) mRNA,
           complete cds.
          Length = 905

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ID++ ++++G +PE LG+L  L V  +N N   G IP+  +N   L  +D+  N+  GK 
Sbjct: 644 IDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKL 703

Query: 678 P 680
           P
Sbjct: 704 P 704



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K  ++  +DL+ + +AG LPE LG L +L    ++SN F G++P    N+  L +LD+SN
Sbjct: 347 KGNSLVFLDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSN 406

Query: 657 NRFAG 671
           N   G
Sbjct: 407 NAMNG 411



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/62 (37%), Positives = 39/62 (62%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           SI+L+ ++I+G +P E+  L  L + +++ N   G+IP+K   L  L  LD+S N+F+G 
Sbjct: 789 SINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGA 848

Query: 675 FP 680
            P
Sbjct: 849 IP 850



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+ + +AG +PE++  L+ L    ++ N+F G IP+ F  +  L  L++S N+  G  
Sbjct: 814 LNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSI 873

Query: 678 P 680
           P
Sbjct: 874 P 874



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 29/129 (22%), Positives = 50/129 (38%), Gaps = 32/129 (24%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDVCNYTGVFCAPA------------------------------ 464
           +A ++D  +    W G D CN+ GV C                                 
Sbjct: 45  RAALTDLSSRLFSWSGPDCCNWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKI 104

Query: 465 -PDNPKIRTVASIDLNHDDIAGY-LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILF 638
            P   +++ ++ +DL+ +D     +PE +G +  L   +++S+ F G IP    NL  L 
Sbjct: 105 HPSLTQLKFLSYLDLSSNDFNELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLE 164

Query: 639 ELDISNNRF 665
            LD+    F
Sbjct: 165 SLDLYAESF 173



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRT--VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           Y   F    P N  +    +  I L  +   G +P  L  ++ L +  +  N F G+ PK
Sbjct: 574 YENNFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPK 633

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
            +    +L+ +D+S N  +G+ P
Sbjct: 634 CWHRQFMLWGIDVSENNLSGEIP 656



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/60 (33%), Positives = 34/60 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  +DL+ + +   +P  L  L +L    +  +   G+IP  FKNLK+L  LD+SNN
Sbjct: 246 LKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLRWDFLQGSIPTGFKNLKLLETLDLSNN 305



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 17/64 (26%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R + ++DL+ +   G +P  +G +A L    +++N   GTI +    L  L +L++  N
Sbjct: 372 LRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAESLGQLAELVDLNLMAN 431

Query: 660 RFAG 671
            + G
Sbjct: 432 TWGG 435



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = +3

Query: 576 INSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           ++SN+  GT+P+   +L+ L  LD+S+N F G  P
Sbjct: 356 LSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVP 390



>pir|T01105|T01105 disease resistance protein homolog T21L14.4 -
           Arabidopsis thaliana
          Length = 818

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + + A+ID + + + G +PE +GLL  L   ++++N F G IP  F NL  L  LD+S N
Sbjct: 642 LTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGN 701

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 702 QLSGTIP 708



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 23/67 (34%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  ID+  + I G +PE L  L  L    I++N F G IP    N   L  +D+S N
Sbjct: 399 LQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFNGEIPLSICNRTSLTMVDLSYN 458

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 459 NFTGPIP 465



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 24/103 (23%), Positives = 41/103 (39%), Gaps = 9/103 (8%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGV---------FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL 551
           N+ +  +   +CN T +         F  P P    +     ++L  +D+ G +P+    
Sbjct: 434 NSFNGEIPLSICNRTSLTMVDLSYNNFTGPIPQC--LSNFMFVNLRKNDLEGSIPDTFYT 491

Query: 552 LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            + L    +  NR  G +P+   N   L  L + NNR    FP
Sbjct: 492 DSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFP 534



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ ++  ++L  ++I+  LP + G L  L V  ++ N F G       NL  + +L + N
Sbjct: 181 ELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHN 240

Query: 657 NRFAGKFP 680
           N   G FP
Sbjct: 241 NELTGSFP 248



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +IDL +    G   E+  +L        + NR  G IP+    LK L  L++SNN F G 
Sbjct: 626 TIDLQYK---GLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGH 682

Query: 675 FP 680
            P
Sbjct: 683 IP 684



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 29/123 (23%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP--EELGLLADLGVF 572
           N TS  + S+ CN   +       N        IDL+H+D+ G  P    LG LA   V 
Sbjct: 112 NFTSASLPSEFCNLNKLKLLSLFSN------GFIDLSHNDLMGSFPLVRNLGKLA---VL 162

Query: 573 HINSNRFCGT--------------------------IPKKFKNLKILFELDISNNRFAGK 674
            ++ N F GT                          +P KF NL  L  L +S N F+G+
Sbjct: 163 DLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQ 222

Query: 675 -FP 680
            FP
Sbjct: 223 CFP 225



>pir|D84740|D84740 hypothetical protein At2g33020 [imported] -
           Arabidopsis thaliana>gb:AC002334_1530392 Arabidopsis
           thaliana chromosome 2 clone F25I18 map TEn5, complete
           sequence.>gb:AC003033_1530991 Arabidopsis thaliana
           chromosome 2 BAC T21L14 genomic sequence, complete
           sequence.
          Length = 864

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/67 (37%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + + A+ID + + + G +PE +GLL  L   ++++N F G IP  F NL  L  LD+S N
Sbjct: 688 LTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGN 747

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 748 QLSGTIP 754



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 24/103 (23%), Positives = 41/103 (39%), Gaps = 9/103 (8%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGV---------FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL 551
           N+ +  +   +CN T +         F  P P    +     ++L  +D+ G +P+    
Sbjct: 480 NSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQC--LSNFMFVNLRKNDLEGSIPDTFYT 537

Query: 552 LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            + L    +  NR  G +P+   N   L  L + NNR    FP
Sbjct: 538 DSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFP 580



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/68 (27%), Positives = 34/68 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ ++  ++L  ++I+  LP + G L  L V  ++ N F G       NL  + +L + N
Sbjct: 181 ELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHN 240

Query: 657 NRFAGKFP 680
           N   G FP
Sbjct: 241 NELTGSFP 248



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +IDL +    G   E+  +L        + NR  G IP+    LK L  L++SNN F G 
Sbjct: 672 TIDLQYK---GLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGH 728

Query: 675 FP 680
            P
Sbjct: 729 IP 730



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 29/123 (23%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP--EELGLLADLGVF 572
           N TS  + S+ CN   +       N        IDL+H+D+ G  P    LG LA   V 
Sbjct: 112 NFTSASLPSEFCNLNKLKLLSLFSN------GFIDLSHNDLMGSFPLVRNLGKLA---VL 162

Query: 573 HINSNRFCGT--------------------------IPKKFKNLKILFELDISNNRFAGK 674
            ++ N F GT                          +P KF NL  L  L +S N F+G+
Sbjct: 163 DLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQ 222

Query: 675 -FP 680
            FP
Sbjct: 223 CFP 225



>pir|C84524|C84524 probable disease resistance protein [imported] -
            Arabidopsis thaliana>gb:AC005957_1533254 Arabidopsis
            thaliana chromosome 2 clone T15J14 map mi398, complete
            sequence.
          Length = 1011

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            ++   S+D + +   G +P+ +GLL +L V +++SN F G IP     L+ L  LD++ N
Sbjct: 822  LKIFTSVDFSRNKFEGEIPKSIGLLKELHVLNLSSNTFTGHIPSSMGKLRELESLDVAQN 881

Query: 660  RFAGKFP 680
            + +G  P
Sbjct: 882  KLSGDIP 888



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  +DL+++  +G +   LG  + L    ++ N F G IP    NL  L  LD+++N
Sbjct: 31  LQNLRFLDLSNNHFSGQILSSLGNFSSLTTLDLSENHFSGQIPSSLGNLLHLTSLDLTDN 90

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 91  NFVGDIP 97



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 19/64 (29%), Positives = 36/64 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L+ +   G LP  +  L++L +F+ ++N F GTIP    N+  L   D+S+N
Sbjct: 199 LTNLSDLSLSRNQFTGTLPPNMSSLSNLVLFYADANAFTGTIPSSLLNIPSLSCFDLSDN 258

Query: 660 RFAG 671
           +  G
Sbjct: 259 QLNG 262



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +++ G +P  LG L+ L    +  N   G IP  F+NL  L  LD+S N   G+ P
Sbjct: 111 LGANNLVGEIPFSLGNLSHLTDLTLCENDLAGEIPSSFENLSHLTNLDLSQNNLVGEIP 169



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/65 (30%), Positives = 31/65 (47%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+ +  +G +P  LG L  L    +  N F G IP    NL  L  L +  N  
Sbjct: 57  SLTTLDLSENHFSGQIPSSLGNLLHLTSLDLTDNNFVGDIPTSLGNLSHLTLLLLGANNL 116

Query: 666 AGKFP 680
            G+ P
Sbjct: 117 VGEIP 121



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           +GVF    P+N    ++ S+D+ H+ + G LP  L  ++ L V ++ +N+   T P    
Sbjct: 677 SGVF----PENIS-ESLKSLDVGHNQLVGKLPRSLVRISSLEVLNVENNKINDTFPFWLS 731

Query: 621 NLKILFELDISNNRFAG 671
           +L+ L  L + +N F G
Sbjct: 732 SLEELQVLVLRSNAFHG 748



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/64 (28%), Positives = 30/64 (46%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + ++DL+ +++ G +P   G    L    +  N F G       NL  L +L +S N+F 
Sbjct: 154 LTNLDLSQNNLVGEIPSFFGSFNQLVSLAVEENEFTGNFLLILLNLTNLSDLSLSRNQFT 213

Query: 669 GKFP 680
           G  P
Sbjct: 214 GTLP 217



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  + L  +D+AG +P     L+ L    ++ N   G IP  F +   L  L +  N F 
Sbjct: 130 LTDLTLCENDLAGEIPSSFENLSHLTNLDLSQNNLVGEIPSFFGSFNQLVSLAVEENEFT 189

Query: 669 GKF 677
           G F
Sbjct: 190 GNF 192



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 13/44 (29%), Positives = 28/44 (63%)
 Frame = +3

Query: 477  KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
            K+R + S+D+  + ++G +P++LG L+ L   + + N+  G +P
Sbjct: 869  KLRELESLDVAQNKLSGDIPQDLGDLSYLAYMNFSHNQLVGPLP 912



>pir|T50850|T50850 receptor protein kinase homolog [imported] -
           soybean>gb:AY166655_1586208 Glycine max nodule
           autoregulation receptor-like protein kinase precursor
           (NARK) gene, complete cds.>gb:AF197947_1776385 Glycine
           max receptor protein kinase-like protein (CLV1B) mRNA,
           complete cds.
          Length = 987

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 21/65 (32%), Positives = 42/65 (64%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+ + + G +P+ +  L DL +F+++ N+  G +P++ + +  L  LD+SNN F
Sbjct: 531 SLTAVDLSRNMLEGKIPKGIKNLTDLSIFNVSINQISGPVPEEIRFMLSLTTLDLSNNNF 590

Query: 666 AGKFP 680
            GK P
Sbjct: 591 IGKVP 595



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 29/83 (34%), Positives = 47/83 (56%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           C ++GV C     + ++R VA I+++   + G+LP E+G L  L    ++ N   G +PK
Sbjct: 62  CFFSGVKC-----DRELRVVA-INVSFVPLFGHLPPEIGQLDKLENLTVSQNNLTGVLPK 115

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +   L  L  L+IS+N F+G FP
Sbjct: 116 ELAALTSLKHLNISHNVFSGHFP 138



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ +V  I+L ++   G LP E+     LG+  +++N F G IP   KNL+ L  L +  
Sbjct: 433 KLPSVTIIELANNRFNGELPPEISG-ESLGILTLSNNLFSGKIPPALKNLRALQTLSLDA 491

Query: 657 NRFAGKFP 680
           N F G+ P
Sbjct: 492 NEFVGEIP 499



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 20/72 (27%), Positives = 37/72 (51%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++++  +DL+  +++G +P  L  L +L    +  N   GTIP +   +  L  L
Sbjct: 237 PEFGSMKSLRYLDLSSCNLSGEIPPSLANLTNLDTLFLQINNLTGTIPSELSAMVSLMSL 296

Query: 645 DISNNRFAGKFP 680
           D+S N   G+ P
Sbjct: 297 DLSINDLTGEIP 308



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D+  ++  G LP EL  L  L    ++ N F G+IP+ +   K L  L +S N  +GK 
Sbjct: 151 LDVYDNNFTGPLPVELVKLEKLKYLKLDGNYFSGSIPESYSEFKSLEFLSLSTNSLSGKI 210

Query: 678 P 680
           P
Sbjct: 211 P 211



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +R + ++ L+ ++  G +P E+  L  L V +I+ N   G IP        L  +
Sbjct: 476 PALKNLRALQTLSLDANEFVGEIPGEVFDLPMLTVVNISGNNLTGPIPTTLTRCVSLTAV 535

Query: 645 DISNNRFAGKFP 680
           D+S N   GK P
Sbjct: 536 DLSRNMLEGKIP 547



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 2/83 (2%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y   F  P P +  K+  +  + L+ +  +G +PE       L    +++N   G IPK 
Sbjct: 154 YDNNFTGPLPVELVKLEKLKYLKLDGNYFSGSIPESYSEFKSLEFLSLSTNSLSGKIPKS 213

Query: 615 FKNLKILFELDIS-NNRFAGKFP 680
              LK L  L +  NN + G  P
Sbjct: 214 LSKLKTLRYLKLGYNNAYEGGIP 236



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPK 611
           N TGV      +   + ++  ++++H+  +G+ P ++ L +  L V  +  N F G +P 
Sbjct: 108 NLTGVL---PKELAALTSLKHLNISHNVFSGHFPGQIILPMTKLEVLDVYDNNFTGPLPV 164

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +   L+ L  L +  N F+G  P
Sbjct: 165 ELVKLEKLKYLKLDGNYFSGSIP 187



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/82 (23%), Positives = 39/82 (47%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           ++TG+       + +++T+   D   +   G +P E+G    L     ++N   G +P  
Sbjct: 374 HFTGLIPRDLCKSGRLQTIMITD---NFFRGPIPNEIGNCKSLTKIRASNNYLNGVVPSG 430

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  +  ++++NNRF G+ P
Sbjct: 431 IFKLPSVTIIELANNRFNGELP 452



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++++ +++ G +P  L     L    ++ N   G IPK  KNL  L   ++S N+ +G  
Sbjct: 511 VNISGNNLTGPIPTTLTRCVSLTAVDLSRNMLEGKIPKGIKNLTDLSIFNVSINQISGPV 570

Query: 678 P 680
           P
Sbjct: 571 P 571



>pir|H96740|H96740 hypothetical protein F14O23.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_894730 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F14O23_1677509 Arabidopsis thaliana
           chromosome 1 BAC F14O23 sequence, complete sequence.
          Length = 601

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
 Frame = +3

Query: 390 DPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADL 563
           DP N    W  + V  C +  V C    +N  IR    +DL + +++G+L  ELG+L +L
Sbjct: 42  DPNNVLQSWDPTLVNPCTWFHVTCNN--ENSVIR----VDLGNAELSGHLVPELGVLKNL 95

Query: 564 GVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
               + SN   G IP    NL  L  LD+  N F+G  P
Sbjct: 96  QYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIP 134



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++ +  ++L  ++I G +P  LG L +L    +  N F G IP+    L  L  L
Sbjct: 87  PELGVLKNLQYLELYSNNITGPIPSNLGNLTNLVSLDLYLNSFSGPIPESLGKLSKLRFL 146

Query: 645 DISNNRFAGKFP 680
           D+SNNR +G  P
Sbjct: 147 DLSNNRLSGSVP 158



>pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis
           thaliana>gb:ATCHRIV52_1545865 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549347
           Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
           (ESSA project).
          Length = 992

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/80 (31%), Positives = 45/80 (56%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG        N +  ++  I+L+++ ++G +P  +  L  L +  + +NR  G IP +  
Sbjct: 452 TGEIPEEEAGNAQFSSLTQINLSNNRLSGPIPGSIRNLRSLQILLLGANRLSGQIPGEIG 511

Query: 621 NLKILFELDISNNRFAGKFP 680
           +LK L ++D+S N F+GKFP
Sbjct: 512 SLKSLLKIDMSRNNFSGKFP 531



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 23/71 (32%), Positives = 40/71 (56%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D  ++  +  +DL +  + G +P ELG L +L V  + +N   G++P++  N+  L  LD
Sbjct: 242 DFGRLINLVHLDLANCSLKGSIPAELGNLKNLEVLFLQTNELTGSVPRELGNMTSLKTLD 301

Query: 648 ISNNRFAGKFP 680
           +SNN   G+ P
Sbjct: 302 LSNNFLEGEIP 312



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  + L  + ++G +P E+G L  L    ++ N F G  P +F +   L  LD+S+N
Sbjct: 489 LRSLQILLLGANRLSGQIPGEIGSLKSLLKIDMSRNNFSGKFPPEFGDCMSLTYLDLSHN 548

Query: 660 RFAGKFP 680
           + +G+ P
Sbjct: 549 QISGQIP 555



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 22/65 (33%), Positives = 37/65 (56%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++DL+++ + G +P EL  L  L +F++  NR  G IP+    L  L  L + +N F
Sbjct: 296 SLKTLDLSNNFLEGEIPLELSGLQKLQLFNLFFNRLHGEIPEFVSELPDLQILKLWHNNF 355

Query: 666 AGKFP 680
            GK P
Sbjct: 356 TGKIP 360



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/52 (36%), Positives = 27/52 (51%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +PE +  L DL +  +  N F G IP K  +   L E+D+S N+  G  P
Sbjct: 333 GEIPEFVSELPDLQILKLWHNNFTGKIPSKLGSNGNLIEIDLSTNKLTGLIP 384



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R +  + L ++ + G LPE+LG    L  F +  N     +PK    L  L  L++ NN 
Sbjct: 391 RRLKILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTSKLPKGLIYLPNLSLLELQNNF 450

Query: 663 FAGKFP 680
             G+ P
Sbjct: 451 LTGEIP 456



>gb:AP003513_1830178 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0690H04.
          Length = 616

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 26/72 (36%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD  +++ + S++L  + I+G +P ELG LA L    +  N F G IP +  NL  L  L
Sbjct: 84  PDIWQLQALQSLELYGNSISGKIPSELGRLASLQTLDLYLNNFTGEIPNELGNLSKLSNL 143

Query: 645 DISNNRFAGKFP 680
            ++NN  +G  P
Sbjct: 144 RLNNNSLSGAIP 155



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/68 (30%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ ++ ++DL  ++  G +P ELG L+ L    +N+N   G IP     ++ L  LD+S+
Sbjct: 112 RLASLQTLDLYLNNFTGEIPNELGNLSKLSNLRLNNNSLSGAIPMSLTTIQNLEVLDLSH 171

Query: 657 NRFAGKFP 680
           N  +G  P
Sbjct: 172 NNLSGIIP 179



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/83 (27%), Positives = 34/83 (40%)
 Frame = +3

Query: 432 CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           C +  V C P         V  +DL +  ++G L  ++  L  L    +  N   G IP 
Sbjct: 55  CTWFHVTCGPG------NQVIRLDLGNQSLSGELKPDIWQLQALQSLELYGNSISGKIPS 108

Query: 612 KFKNLKILFELDISNNRFAGKFP 680
           +   L  L  LD+  N F G+ P
Sbjct: 109 ELGRLASLQTLDLYLNNFTGEIP 131



>gb:AF244888_1780445 Glycine max receptor-like protein kinase 1
           (RLK1) mRNA, complete cds.
          Length = 1008

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 2/112 (1%)
 Frame = +3

Query: 351 YIALQAWK-QAIISDPRNTTSDWVGSD-VCNYTGVFCAPAPDNPKIRTVASIDLNHDDIA 524
           Y AL ++K  ++  DP +  S W  S   C++ G+ C         R V S++L    ++
Sbjct: 22  YRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSR------RHVTSLNLTSLSLS 75

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G L ++L  L  L    +  N+F G IP  F  L  L  L++SNN F   FP
Sbjct: 76  GTLSDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFP 127



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/70 (31%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 465 PDNPKIRT-VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           P++  I T +  I L+++ ++G LP  +G    +    +N N F G IP +   L+ L +
Sbjct: 440 PEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSK 499

Query: 642 LDISNNRFAG 671
           +D S+N+F+G
Sbjct: 500 IDFSHNKFSG 509



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/73 (27%), Positives = 41/73 (56%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           AP+  K + +  IDL+ ++++G +P ++  +  L   +++ N   G+IP    +++ L  
Sbjct: 512 APEISKCKLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIPGNIASMQSLTS 571

Query: 642 LDISNNRFAGKFP 680
           +D S N F+G  P
Sbjct: 572 VDFSYNNFSGLVP 584



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 18/59 (30%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LN ++  G +P ++G+L  L     + N+F G I  +    K+L  +D+S N  +G+ P
Sbjct: 478 LNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIP 536



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 20/72 (27%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +  +D  +  ++G +P ELG L +L    +  N   G++  +  +LK L  +
Sbjct: 225 PEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSM 284

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G+ P
Sbjct: 285 DLSNNMLSGEVP 296



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 16/64 (25%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  ++L  + + G  PE+  +  DLG   +++N+  G++P    N   + +L ++ N F 
Sbjct: 425 LTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFT 484

Query: 669 GKFP 680
           G+ P
Sbjct: 485 GRIP 488



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  ++L  + + G +PE +G L  L V  +  N F G+IP+   N   L  +D+S+
Sbjct: 301 ELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSS 360

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 361 NKITGTLP 368



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/72 (26%), Positives = 38/72 (52%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   ++++ S+DL+++ ++G +P     L +L + ++  N+  G IP+    L  L  L
Sbjct: 273 PELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVL 332

Query: 645 DISNNRFAGKFP 680
            +  N F G  P
Sbjct: 333 QLWENNFTGSIP 344



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +P+ LG    L    +  N   G+IPK    L  L ++++ +N   G+FP
Sbjct: 389 GPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFP 440



>gb:AC097367_1736630 Oryza sativa chromosome 3 BAC OSJNBa0051C19
           genomic sequence, complete sequence.
          Length = 218

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 2/101 (1%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLA 557
           +SDP      W  + V  C +  V C  A        V  +DL + +I+G +  ELG L 
Sbjct: 42  LSDPNGVLQSWDPTLVNPCTWFHVTCDHAS------RVVRLDLGNSNISGSIGPELGRLV 95

Query: 558 DLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +L    +  N   G IPK+  NLK L  LD+  N+  G  P
Sbjct: 96  NLQYLELYRNNLNGEIPKELGNLKNLISLDLYANKLTGTIP 136



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + S+DL  + + G +P+ L  L  L    +N+N+  G+IP++   L  L  +D+SNN
Sbjct: 118 LKNLISLDLYANKLTGTIPKSLSKLGSLRFMRLNNNKLAGSIPRELAKLSNLKVIDLSNN 177

Query: 660 RFAGKFP 680
              G  P
Sbjct: 178 DLCGTIP 184



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 17/44 (38%), Positives = 30/44 (68%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           K+ ++  + LN++ +AG +P EL  L++L V  +++N  CGTIP
Sbjct: 141 KLGSLRFMRLNNNKLAGSIPRELAKLSNLKVIDLSNNDLCGTIP 184



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
           receptor-like kinase 2, exons 1-11.
          Length = 626

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + S+DL  ++ +G +P+ LG L  L    +N+N   G IP    N+  L  L
Sbjct: 113 PELGNLTNLVSLDLYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVL 172

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G+ P
Sbjct: 173 DLSNNNLSGQVP 184



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++  D  N    W  + V  C +  V C    DN  IR    +DL +  ++G 
Sbjct: 34  ALYSLRQSL-KDANNVLQSWDPTLVNPCTWFHVTCNN--DNSVIR----VDLGNAQLSGV 86

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L +L    + SN   GTIP +  NL  L  LD+  N F+G  P
Sbjct: 87  LVPQLGQLKNLQYLELYSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIP 136



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 8/122 (6%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPR------NTTSDWVGSDVCN--YTGVFCAPAPDNPKIRTVA 494
           +++A   LQ+W   +++         N  +  +  D+ N   +GV     P   +++ + 
Sbjct: 42  LKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVL---VPQLGQLKNLQ 98

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            ++L  ++I+G +P ELG L +L    +  N F G IP    NL  L  L ++NN   G 
Sbjct: 99  YLELYSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGP 158

Query: 675 FP 680
            P
Sbjct: 159 IP 160



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + S+DL  ++ +G +P+ LG L  L    +N+N   G IP    N+  L  L
Sbjct: 113 PELGNLTNLVSLDLYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVL 172

Query: 645 DISNNRFAGKFP 680
           D+SNN  +G+ P
Sbjct: 173 DLSNNNLSGQVP 184



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++  D  N    W  + V  C +  V C    DN  IR    +DL +  ++G 
Sbjct: 34  ALYSLRQSL-KDANNVLQSWDPTLVNPCTWFHVTCNN--DNSVIR----VDLGNAQLSGV 86

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L +L    + SN   GTIP +  NL  L  LD+  N F+G  P
Sbjct: 87  LVPQLGQLKNLQYLELYSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIP 136



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 8/122 (6%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPR------NTTSDWVGSDVCN--YTGVFCAPAPDNPKIRTVA 494
           +++A   LQ+W   +++         N  +  +  D+ N   +GV     P   +++ + 
Sbjct: 42  LKDANNVLQSWDPTLVNPCTWFHVTCNNDNSVIRVDLGNAQLSGVL---VPQLGQLKNLQ 98

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            ++L  ++I+G +P ELG L +L    +  N F G IP    NL  L  L ++NN   G 
Sbjct: 99  YLELYSNNISGTIPPELGNLTNLVSLDLYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGP 158

Query: 675 FP 680
            P
Sbjct: 159 IP 160



>gb:BT003164_1636745 Arabidopsis thaliana At2g32660 mRNA, complete
           cds.
          Length = 589

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           ++ID + + + G +PE +GLL  L   ++++N F G IP  F N+  L  LD+S N+ +G
Sbjct: 410 SAIDFSGNKLEGEIPESIGLLKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSG 469

Query: 672 KFP 680
           + P
Sbjct: 470 EIP 472



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 17/67 (25%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++T+ +++L+++   G++P     + +L    ++ N+  G IP++   L  L  +D+S+N
Sbjct: 430 LKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSGEIPQELGRLSYLAYIDVSDN 489

Query: 660 RFAGKFP 680
           +  GK P
Sbjct: 490 QLTGKIP 496



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+DL+ + ++G +P+ELG L+ L    ++ N+  G IP+
Sbjct: 454 VTELESLDLSGNKLSGEIPQELGRLSYLAYIDVSDNQLTGKIPQ 497



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +3

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           P  L  L  L    ++SNR  G +P    +L +L  LD+SNN F G
Sbjct: 115 PRFLKSLKKLWYLDLSSNRIKGNVPDWIWSLPLLVSLDLSNNSFTG 160



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 25/114 (21%), Positives = 42/114 (36%), Gaps = 5/114 (4%)
 Frame = +3

Query: 354 IALQAWKQAIISDP-----RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD 518
           I L AW  +   D        T+ D +     N+TG         P +     ++L    
Sbjct: 196 INLSAWNNSFTGDIPLSVCNRTSLDVLDLSYNNFTGSI------PPCMGNFTIVNLRKSK 249

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P+E    A      +  N+  G +P+   N   +  L + +NR    FP
Sbjct: 250 LEGNIPDEFYSGALTQTLDVGYNQLTGELPRSLLNCSFIRFLSVDHNRINDSFP 303



>gb:AY065068_1566222 Arabidopsis thaliana AT4g37250/C7A10_110 mRNA,
           complete cds.>gb:BT002237_1635840 Arabidopsis thaliana
           At4g37250/C7A10_110 mRNA, complete cds.
          Length = 768

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           + L  +K +++ DP +    W       C++ G+ C    ++ K+ T++   L +  + G
Sbjct: 27  LVLMKFKSSVLVDPLSLLQTWNYKHESPCSWRGISCN---NDSKVLTLS---LPNSQLLG 80

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +P +LG L  L    +++N F G +P  F N + L  LD+S+N  +G+ P
Sbjct: 81  SIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNMISGEIP 131



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R +  +DL+ + I+G +P  +G L +L   +++ N   G +P    +L+ L  + + NN 
Sbjct: 114 RELRFLDLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNY 173

Query: 663 FAGKFP 680
           F+G+ P
Sbjct: 174 FSGEIP 179



>gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,
           complete cds.>gb:AY142025_1582862 Arabidopsis thaliana
           At5g63710/MBK5_19 mRNA, complete cds.
          Length = 614

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 43/73 (58%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           +P   K++ + +++L ++ ++G LP+ LG + +L   +++ N F G+IP  +  L  L  
Sbjct: 109 SPAITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKH 168

Query: 642 LDISNNRFAGKFP 680
           LD+S+N   G  P
Sbjct: 169 LDLSSNNLTGSIP 181



>gb:AC026815_1539693 Oryza sativa chromosome 10 BAC OSJNBa0079L16
           genomic sequence, complete sequence.
          Length = 1172

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 20/128 (15%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNPKIR---------------- 485
           AL AWK +++       S W   + VC + GV C  A     +R                
Sbjct: 29  ALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFA 88

Query: 486 ---TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
               +  +DLN ++  G +P  +  L  L +  + SN   G+IP +  +L  L EL + N
Sbjct: 89  ALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYN 148

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 149 NNLVGAIP 156



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+ S+D N   I+G +PE  G +  L +  +  N   G IP    +L +LF L++S+N F
Sbjct: 620 TLLSMDGNR--ISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSF 677

Query: 666 AGKFP 680
           +G  P
Sbjct: 678 SGPIP 682



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+H+  +G +P  LG  + L    ++ N   GTIP     L  L  LD+S NR +GK
Sbjct: 669 NLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGK 728

Query: 675 FP 680
            P
Sbjct: 729 IP 730



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S ++ ++   G +P ELG    L + ++  N   G+IP +   L+ L ELD+S N   G 
Sbjct: 381 SFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGP 440

Query: 675 FP 680
            P
Sbjct: 441 IP 442



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPE-ELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ +  +DL+++  +G +P  +      L   H++SN F G  P   +  K L  LDI N
Sbjct: 786 LQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGN 845

Query: 657 NRFAGKFP 680
           N F G  P
Sbjct: 846 NNFFGDIP 853



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +3

Query: 498  IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            ++L+ + ++  +PE +G L +L    ++SN   G IP     +  L  L++SNN  +GK
Sbjct: 982  LNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGK 1040



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435  NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPK 611
            ++TGVF +      K+    ++D+ +++  G +P  +G  L  L +  + SN F G IP 
Sbjct: 823  DFTGVFPSALEGCKKL---INLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPS 879

Query: 612  KFKNLKILFELDISNNRFAGKFP 680
            +   L  L  LD++NN   G  P
Sbjct: 880  ELSQLSQLQLLDMTNNGLTGLIP 902



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            I+ V  I L+ + ++  +P+EL  L  L   +++ N    +IP+   +LK L  LD+S+N
Sbjct: 952  IQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSN 1011

Query: 660  RFAGKFP 680
              +G  P
Sbjct: 1012 ELSGAIP 1018



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 16/68 (23%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  +D+ +  +   LP +LG L +L    ++ N+F G +P  F  ++ + E  +S 
Sbjct: 302 QLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLST 361

Query: 657 NRFAGKFP 680
               G+ P
Sbjct: 362 TNVTGEIP 369



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +3

Query: 450 FCAPAP----DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           F  P P    +N K++    ID++ + + G +P  LG L  L    ++ NR  G IP++ 
Sbjct: 677 FSGPIPTSLGNNSKLQ---KIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPREL 733

Query: 618 KNL-KILFELDISNNRFAGKFP 680
            NL ++   LD+S+N  +G  P
Sbjct: 734 GNLVQLQTLLDLSSNFLSGWIP 755



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD  K   +  +  +++  +G LP  L     L  F +N N F GT+P   KN   LF +
Sbjct: 515 PDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRV 574

Query: 645 DISNNRFAG 671
            +  N F G
Sbjct: 575 RLEENHFTG 583



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TGV     P+   +  + S D+N + + G LP  +  L +L    +  N   GTIP  
Sbjct: 460 NLTGVI---PPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPD 516

Query: 615 FKNLKILFELDISNNRFAGKFP 680
                 L  +  SNN F+G+ P
Sbjct: 517 LGKGIALQHVSFSNNSFSGELP 538



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +  ++  +  + +  +++ G +PE LG +A L +  +  N+  G IP     L
Sbjct: 244 FSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQL 303

Query: 627 KILFELDISNNRFAGKFP 680
           ++L  LDI N       P
Sbjct: 304 QMLQRLDIKNASLVSTLP 321



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + + G +P  LG L  L    I +     T+P +  NL  L  LD+S N+F+G  
Sbjct: 285 LELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGL 344

Query: 678 P 680
           P
Sbjct: 345 P 345



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 22/68 (32%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K R +  + L  +++ G +P ELG L +L    ++ N   G IP    NLK L +L +  
Sbjct: 399 KARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFF 458

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 459 NNLTGVIP 466



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL+ + ++G++P+     L  L +  +++N+  G +P     L+ L  LD+SNN F+G+
Sbjct: 743 LDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGE 802

Query: 675 FP 680
            P
Sbjct: 803 IP 804



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +  ++R+++ +DL  + + G +P +LG L+ L    + +N   G IP +   L
Sbjct: 103 FTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRL 162

Query: 627 KILFELDISNN 659
             +   D+  N
Sbjct: 163 PNIVHFDLGAN 173



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L  +++ G +P E+G +  L  F +N+N   G +P     LK L  L + +N
Sbjct: 448 LKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDN 507

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 508 FMSGTIP 514



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 426 DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI 605
           D+ N + V   P P    +  +A +DL+ +  +G LP     +  +  F +++    G I
Sbjct: 310 DIKNASLVSTLP-PQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEI 368

Query: 606 PKK-FKNLKILFELDISNNRFAGKFP 680
           P   F +   L   ++ NN F GK P
Sbjct: 369 PPALFTSWPELISFEVQNNSFTGKIP 394



>gb:AC005312_1532514 Arabidopsis thaliana chromosome 2 clone T16F16
           map CIC11A04, complete sequence.
          Length = 910

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query: 414 WVGS----DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHIN 581
           W+ S    D CN+TG+ C    ++     V  ++L +  ++G L E LG L ++ V +++
Sbjct: 53  WINSSSSTDCCNWTGITC----NSNNTGRVIRLELGNKKLSGKLSESLGKLDEIRVLNLS 108

Query: 582 SNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            N    +IP    NLK L  LD+S+N  +G  P
Sbjct: 109 RNFIKDSIPLSIFNLKNLQTLDLSSNDLSGGIP 141



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 24/62 (38%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I+L H++++G + EE G L  L VF +  N   G+IP     +  L  LD+SNNR +G 
Sbjct: 527 TIELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGS 586

Query: 675 FP 680
            P
Sbjct: 587 IP 588



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 22/59 (37%), Positives = 35/59 (59%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +D+ G +PE+L  L  L +  I  NR  G++ ++ +NL  L  LD+S N F+G+ P
Sbjct: 203 LGMNDLTGNIPEDLFHLKRLNLLGIQENRLSGSLSREIRNLSSLVRLDVSWNLFSGEIP 261



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P  L    +L +  ++ NR  G IP    + K LF LD+SNN F G+ P
Sbjct: 427 LTGSMPRWLSSSNELQLLDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIP 480



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL  + ++G +P  L  +  L    +++NR  G+IP   + L  L +  ++ N  +G  P
Sbjct: 553 DLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKFSVAYNNLSGVIP 612



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           S+DL  +   G LPE L     L   ++  N F G +P+ FKN + L    +SN+  A
Sbjct: 320 SLDLGTNRFNGRLPENLPDCKRLKNVNLARNTFHGQVPESFKNFESLSYFSLSNSSLA 377



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ + + G +P  +G    L    +++N F G IPK    L+ L   +IS N  +  F
Sbjct: 444 LDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNEPSPDF 503

Query: 678 P 680
           P
Sbjct: 504 P 504



>gb:AX138089_1462210 Sequence 35 from Patent EP1094113.
          Length = 609

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 43/73 (58%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           +P   K++ + +++L ++ ++G LP+ LG + +L   +++ N F G+IP  +  L  L  
Sbjct: 104 SPAITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKH 163

Query: 642 LDISNNRFAGKFP 680
           LD+S+N   G  P
Sbjct: 164 LDLSSNNLTGSIP 176



>gb:CQ768549_1451792 Sequence 44 from Patent
           WO2004007712.>gb:AX120055_1461707 Sequence 38 from
           Patent WO0129240.>gb:AB005234_1509345 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1 clone:MBK5.
          Length = 579

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 22/73 (30%), Positives = 43/73 (58%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           +P   K++ + +++L ++ ++G LP+ LG + +L   +++ N F G+IP  +  L  L  
Sbjct: 74  SPAITKLKFLVTLELQNNSLSGALPDSLGNMVNLQTLNLSVNSFSGSIPASWSQLSNLKH 133

Query: 642 LDISNNRFAGKFP 680
           LD+S+N   G  P
Sbjct: 134 LDLSSNNLTGSIP 146



>gb:AE016959_1023026 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017103_1752845
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 57 of 77 of the complete sequence.
          Length = 1175

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 20/128 (15%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWV-GSDVCNYTGVFCAPAPDNPKIR---------------- 485
           AL AWK +++       S W   + VC + GV C  A     +R                
Sbjct: 29  ALLAWKASLLLGDAAALSGWTRAAPVCTWRGVACDAAGRVTSLRLRDAGLSGGLDTLDFA 88

Query: 486 ---TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
               +  +DLN ++  G +P  +  L  L +  + SN   G+IP +  +L  L EL + N
Sbjct: 89  ALPALTELDLNRNNFTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYN 148

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 149 NNLVGAIP 156



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/65 (35%), Positives = 36/65 (55%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+ S+D N   I+G +PE  G +  L +  +  N   G IP    +L +LF L++S+N F
Sbjct: 620 TLLSMDGNR--ISGRIPEAFGSMTRLQILSLAGNNLTGGIPLDLGHLNLLFNLNLSHNSF 677

Query: 666 AGKFP 680
           +G  P
Sbjct: 678 SGPIP 682



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+H+  +G +P  LG  + L    ++ N   GTIP     L  L  LD+S NR +GK
Sbjct: 669 NLNLSHNSFSGPIPTSLGNNSKLQKIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGK 728

Query: 675 FP 680
            P
Sbjct: 729 IP 730



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/62 (32%), Positives = 32/62 (51%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S ++ ++   G +P ELG    L + ++  N   G+IP +   L+ L ELD+S N   G 
Sbjct: 381 SFEVQNNSFTGKIPSELGKARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGP 440

Query: 675 FP 680
            P
Sbjct: 441 IP 442



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPE-ELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           ++ +  +DL+++  +G +P  +      L   H++SN F G  P   +  K L  LDI N
Sbjct: 786 LQNLQFLDLSNNAFSGEIPAAKASYSCSLISIHLSSNDFTGVFPSALEGCKKLINLDIGN 845

Query: 657 NRFAGKFP 680
           N F G  P
Sbjct: 846 NNFFGDIP 853



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +3

Query: 498  IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
            ++L+ + ++  +PE +G L +L    ++SN   G IP     +  L  L++SNN  +GK
Sbjct: 982  LNLSRNYLSRSIPENIGSLKNLESLDLSSNELSGAIPPSLAGISTLSSLNLSNNHLSGK 1040



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 1/83 (1%)
 Frame = +3

Query: 435  NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPK 611
            ++TGVF +      K+    ++D+ +++  G +P  +G  L  L +  + SN F G IP 
Sbjct: 823  DFTGVFPSALEGCKKL---INLDIGNNNFFGDIPIWIGKGLPSLKILSLKSNNFSGEIPS 879

Query: 612  KFKNLKILFELDISNNRFAGKFP 680
            +   L  L  LD++NN   G  P
Sbjct: 880  ELSQLSQLQLLDMTNNGLTGLIP 902



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/67 (31%), Positives = 37/67 (55%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
            I+ V  I L+ + ++  +P+EL  L  L   +++ N    +IP+   +LK L  LD+S+N
Sbjct: 952  IQLVTGISLSGNSLSQCIPDELMNLQGLQFLNLSRNYLSRSIPENIGSLKNLESLDLSSN 1011

Query: 660  RFAGKFP 680
              +G  P
Sbjct: 1012 ELSGAIP 1018



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 16/68 (23%), Positives = 35/68 (51%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  +D+ +  +   LP +LG L +L    ++ N+F G +P  F  ++ + E  +S 
Sbjct: 302 QLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLST 361

Query: 657 NRFAGKFP 680
               G+ P
Sbjct: 362 TNVTGEIP 369



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 5/82 (6%)
 Frame = +3

Query: 450 FCAPAP----DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKF 617
           F  P P    +N K++    ID++ + + G +P  LG L  L    ++ NR  G IP++ 
Sbjct: 677 FSGPIPTSLGNNSKLQ---KIDMSGNMLNGTIPVALGKLGALTFLDLSKNRLSGKIPREL 733

Query: 618 KNL-KILFELDISNNRFAGKFP 680
            NL ++   LD+S+N  +G  P
Sbjct: 734 GNLVQLQTLLDLSSNFLSGWIP 755



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 22/69 (31%), Positives = 32/69 (46%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           PD  K   +  +  +++  +G LP  L     L  F +N N F GT+P   KN   LF +
Sbjct: 515 PDLGKGIALQHVSFSNNSFSGELPRNLCDGFALEHFTVNYNNFTGTLPPCLKNCTGLFRV 574

Query: 645 DISNNRFAG 671
            +  N F G
Sbjct: 575 RLEENHFTG 583



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TGV     P+   +  + S D+N + + G LP  +  L +L    +  N   GTIP  
Sbjct: 460 NLTGVI---PPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDNFMSGTIPPD 516

Query: 615 FKNLKILFELDISNNRFAGKFP 680
                 L  +  SNN F+G+ P
Sbjct: 517 LGKGIALQHVSFSNNSFSGELP 538



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +  ++  +  + +  +++ G +PE LG +A L +  +  N+  G IP     L
Sbjct: 244 FSGPIPASLGRLTKLQDLRMAGNNLTGGVPEFLGSMAQLRILELGDNQLGGPIPSVLGQL 303

Query: 627 KILFELDISNNRFAGKFP 680
           ++L  LDI N       P
Sbjct: 304 QMLQRLDIKNASLVSTLP 321



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  + + G +P  LG L  L    I +     T+P +  NL  L  LD+S N+F+G  
Sbjct: 285 LELGDNQLGGPIPSVLGQLQMLQRLDIKNASLVSTLPPQLGNLNNLAYLDLSLNQFSGGL 344

Query: 678 P 680
           P
Sbjct: 345 P 345



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 22/68 (32%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K R +  + L  +++ G +P ELG L +L    ++ N   G IP    NLK L +L +  
Sbjct: 399 KARKLEILYLFLNNLNGSIPAELGELENLVELDLSVNSLTGPIPSSLGNLKQLIKLALFF 458

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 459 NNLTGVIP 466



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +DL+ + ++G++P+     L  L +  +++N+  G +P     L+ L  LD+SNN F+G+
Sbjct: 743 LDLSSNFLSGWIPQAAFCKLLSLQILILSNNQLTGKLPDCLWYLQNLQFLDLSNNAFSGE 802

Query: 675 FP 680
            P
Sbjct: 803 IP 804



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)
 Frame = +3

Query: 450 FCAPAPDN-PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  P P +  ++R+++ +DL  + + G +P +LG L+ L    + +N   G IP +   L
Sbjct: 103 FTGPIPASISRLRSLSLLDLGSNWLDGSIPPQLGDLSGLVELRLYNNNLVGAIPHQLSRL 162

Query: 627 KILFELDISNN 659
             +   D+  N
Sbjct: 163 PNIVHFDLGAN 173



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ +  + L  +++ G +P E+G +  L  F +N+N   G +P     LK L  L + +N
Sbjct: 448 LKQLIKLALFFNNLTGVIPPEIGNMTALQSFDVNTNILHGELPATITALKNLQYLAVFDN 507

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 508 FMSGTIP 514



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 1/86 (1%)
 Frame = +3

Query: 426 DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI 605
           D+ N + V   P P    +  +A +DL+ +  +G LP     +  +  F +++    G I
Sbjct: 310 DIKNASLVSTLP-PQLGNLNNLAYLDLSLNQFSGGLPPTFAGMRAMQEFGLSTTNVTGEI 368

Query: 606 PKK-FKNLKILFELDISNNRFAGKFP 680
           P   F +   L   ++ NN F GK P
Sbjct: 369 PPALFTSWPELISFEVQNNSFTGKIP 394



>pir|T05250|T05250 probable disease resistance protein F18A5.200 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545145 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549066 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 741

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/62 (38%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE +GLL ++ V  +++N F G IP    NL  L  LD+S NR +G 
Sbjct: 567 TIDVSGNRLEGDIPESIGLLKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 626

Query: 675 FP 680
            P
Sbjct: 627 IP 628



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 24/67 (35%), Positives = 34/67 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ +V  IDL  + + G LP  +  L+ L  F I+ N F GTIP     +  L  L +  
Sbjct: 130 KLSSVTWIDLGDNQLKGMLPSNMSSLSKLEAFDISGNSFSGTIPSSLFMIPSLILLHLGR 189

Query: 657 NRFAGKF 677
           N F+G F
Sbjct: 190 NDFSGPF 196



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 23/80 (28%), Positives = 47/80 (58%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           + +F  P P  P + ++  +  +++  +G +P+ +  L +L +  +++N F G+IP+ F+
Sbjct: 335 SNIFQDPFPLLPVV-SMNYLFSSNNRFSGEIPKTICELDNLRILVLSNNNFSGSIPRCFE 393

Query: 621 NLKILFELDISNNRFAGKFP 680
           NL  L+ L + NN  +G FP
Sbjct: 394 NLH-LYVLHLRNNNLSGIFP 412



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ V  + ++++   G++P  L  L++L    ++ NR  G+IP +   L  L  ++ S+N
Sbjct: 586 LKEVIVLSMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHN 645

Query: 660 RFAGKFP 680
           R  G  P
Sbjct: 646 RLEGPIP 652



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 29/112 (25%), Positives = 44/112 (39%), Gaps = 26/112 (23%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNH--------------------------DDIA 524
           +D C++ GV C     +PK   V  +DL +                          + ++
Sbjct: 9   TDCCSWDGVSC-----DPKTGVVVELDLQYSHLNGPLRSNSSLFRLQHLQKLVLGSNHLS 63

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G LP+ +G L  L V  + +    G IP    NL  L  LD+S N F  + P
Sbjct: 64  GILPDSIGNLKRLKVLVLVNCNLFGKIPSSLGNLSYLTHLDLSYNDFTSEGP 115



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N +G+F    P+      + S D+ H+  +G LP+ L   +D+   ++  NR   T P  
Sbjct: 406 NLSGIF----PEEAISHHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTFPSW 461

Query: 615 FKNLKILFELDISNNRFAG 671
            + L  L  L + +N F G
Sbjct: 462 LELLPNLQILVLRSNEFYG 480



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 18/61 (29%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L +++++G  PEE  +   L  F +  N F G +PK   N   +  L++ +NR    F
Sbjct: 400 LHLRNNNLSGIFPEE-AISHHLQSFDVGHNLFSGELPKSLINCSDIEFLNVEDNRINDTF 458

Query: 678 P 680
           P
Sbjct: 459 P 459



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           P    +  + S+DL+ + ++G +P ELG L  L   + + NR  G IP+
Sbjct: 605 PSLSNLSNLQSLDLSQNRLSGSIPGELGKLTFLEWMNFSHNRLEGPIPE 653



>pir|D84648|D84648 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC006300_1534034 Arabidopsis
           thaliana chromosome 2 clone F13B15 map mi238, complete
           sequence.
          Length = 671

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/67 (35%), Positives = 41/67 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + + ++ID + + + G +PE +GLL  L   ++++N F G IP+   NLK L  LD+S N
Sbjct: 488 LTSYSAIDFSRNLLEGNIPESIGLLKALIALNLSNNAFTGHIPQSLANLKELQSLDMSRN 547

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 548 QLSGTIP 554



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 18/72 (25%), Positives = 33/72 (45%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P +  +  V  ++L  +++ G +PE   + + +    +  NR  G +P+   N   L  L
Sbjct: 311 PVSQCLSNVTFVNLRKNNLEGTIPETFIVGSSIRTLDVGYNRLTGKLPRSLLNCSSLEFL 370

Query: 645 DISNNRFAGKFP 680
            + NNR    FP
Sbjct: 371 SVDNNRIKDTFP 382



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGT--IPKKFKNLKILFELDISNNRFAG 671
           ++L  ++ +  LP E G        ++N+ + CG    P  FK LK +  +D+SNNR  G
Sbjct: 165 LNLEVNNFSSSLPSEFG--------YLNNLQHCGLKEFPNIFKTLKKMEAIDVSNNRING 216

Query: 672 KFP 680
           K P
Sbjct: 217 KIP 219



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 18/62 (29%), Positives = 33/62 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++ ++D+ ++ + G LP  L   + L    +++NR   T P   K L  L  L +S+N+F
Sbjct: 342 SIRTLDVGYNRLTGKLPRSLLNCSSLEFLSVDNNRIKDTFPFWLKALPKLQVLTLSSNKF 401

Query: 666 AG 671
            G
Sbjct: 402 YG 403



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 20/61 (32%), Positives = 27/61 (44%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           IDL +    G   E+  +L        + N   G IP+    LK L  L++SNN F G  
Sbjct: 473 IDLKYK---GLNMEQARVLTSYSAIDFSRNLLEGNIPESIGLLKALIALNLSNNAFTGHI 529

Query: 678 P 680
           P
Sbjct: 530 P 530



>pir|T02565|T02565 disease resistance protein homolog At2g32660
           [imported] - Arabidopsis thaliana>gb:AC003974_1531263
           Arabidopsis thaliana chromosome 2 clone F24L7 map TEn5,
           complete sequence.>gb:AC004681_1532039 Arabidopsis
           thaliana chromosome 2 clone T26B15 map TEn5, complete
           sequence.
          Length = 771

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 23/63 (36%), Positives = 39/63 (61%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           ++ID + + + G +PE +GLL  L   ++++N F G IP  F N+  L  LD+S N+ +G
Sbjct: 592 SAIDFSGNKLEGEIPESIGLLKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSG 651

Query: 672 KFP 680
           + P
Sbjct: 652 EIP 654



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 17/67 (25%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++T+ +++L+++   G++P     + +L    ++ N+  G IP++   L  L  +D+S+N
Sbjct: 612 LKTLIALNLSNNSFTGHIPMSFANVTELESLDLSGNKLSGEIPQELGRLSYLAYIDVSDN 671

Query: 660 RFAGKFP 680
           +  GK P
Sbjct: 672 QLTGKIP 678



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 21/63 (33%), Positives = 32/63 (50%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  ++L H+ + G LP  +  L  L    ++ N+F GTIP  F  +  L  LD+S N   
Sbjct: 138 LTQLNLPHNKLTGDLPSLVQNLTKLLALDLSYNQFSGTIPSSFFTMPFLSYLDLSENHLT 197

Query: 669 GKF 677
           G F
Sbjct: 198 GSF 200



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ +   G +P  +  L  L   ++  N+  G +P   +NL  L  LD+S N+F+G  P
Sbjct: 119 LSSNGFTGQVPSSIRNLTKLTQLNLPHNKLTGDLPSLVQNLTKLLALDLSYNQFSGTIP 177



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 14/44 (31%), Positives = 28/44 (63%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+DL+ + ++G +P+ELG L+ L    ++ N+  G IP+
Sbjct: 636 VTELESLDLSGNKLSGEIPQELGRLSYLAYIDVSDNQLTGKIPQ 679



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +3

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           P  L  L  L    ++SNR  G +P    +L +L  LD+SNN F G
Sbjct: 297 PRFLKSLKKLWYLDLSSNRIKGNVPDWIWSLPLLVSLDLSNNSFTG 342



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 25/114 (21%), Positives = 43/114 (37%), Gaps = 5/114 (4%)
 Frame = +3

Query: 354 IALQAWKQAIISDP-----RNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD 518
           I L AW  +   D        T+ D +     N+TG         P +     ++L  + 
Sbjct: 378 INLSAWNNSFTGDIPLSVCNRTSLDVLDLSYNNFTGSI------PPCMGNFTIVNLRKNK 431

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P+E    A      +  N+  G +P+   N   +  L + +NR    FP
Sbjct: 432 LEGNIPDEFYSGALTQTLDVGYNQLTGELPRSLLNCSFIRFLSVDHNRINDSFP 485



>pir|T48210|T48210 hypothetical protein T20L15.160 - Arabidopsis
           thaliana>gb:ATT20L15_1555042 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA
           project).>gb:BT004520_1637554 Arabidopsis thaliana
           At5g01890/T20L15_160 gene, complete
           cds.>gb:AF424563_1798902 Arabidopsis thaliana
           AT5g01890/T20L15_160 mRNA, complete cds.
          Length = 967

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 14/108 (12%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTG-------------VFCAPAPDNPK-IRTVASIDLNHDDIAGYLP 536
           N + +W   DV +  G              F    PD+ K + + +SI L  + + G +P
Sbjct: 219 NLSRNWFSGDVPSDIGRCSSLKSLDLSENYFSGNLPDSMKSLGSCSSIRLRGNSLIGEIP 278

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + +G +A L +  +++N F GT+P    NL+ L +L++S N  AG+ P
Sbjct: 279 DWIGDIATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELP 326



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++++ S+D +H+ + G +P+ LG L DL   +++ N F G +P        L  LD+S N
Sbjct: 188 LKSLKSLDFSHNFLQGDIPDGLGGLYDLRHINLSRNWFSGDVPSDIGRCSSLKSLDLSEN 247

Query: 660 RFAGKFP 680
            F+G  P
Sbjct: 248 YFSGNLP 254



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELG 548
           +A + DP +  S W   D   CN+ G  C PA +      V+ + L+   ++G++   L 
Sbjct: 35  KAGLDDPLSKLSSWNSEDYDPCNWVGCTCDPATNR-----VSELRLDAFSLSGHIGRGLL 89

Query: 549 LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            L  L    +++N   GT+  +F +L  L  +D S N  +G+ P
Sbjct: 90  RLQFLHTLVLSNNNLTGTLNPEFPHLGSLQVVDFSGNNLSGRIP 133



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/67 (31%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++    +DL+ + + G LP E+G    L   H++ NR  G IP K  N   L  +++S N
Sbjct: 432 LKVAEILDLSSNLLNGTLPSEIGGAVSLKQLHLHRNRLSGQIPAKISNCSALNTINLSEN 491

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 492 ELSGAIP 498



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/64 (31%), Positives = 34/64 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I T+  +DL+ ++  G +P  LG L  L   ++++N   G +P+   N   L  +D+S N
Sbjct: 284 IATLEILDLSANNFTGTVPFSLGNLEFLKDLNLSANMLAGELPQTLSNCSNLISIDVSKN 343

Query: 660 RFAG 671
            F G
Sbjct: 344 SFTG 347



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 19/61 (31%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +   G LP  + +L  L   ++++N   G+IP     LK+   LD+S+N   G  
Sbjct: 390 LDLSSNGFTGELPSNIWILTSLLQLNMSTNSLFGSIPTGIGGLKVAEILDLSSNLLNGTL 449

Query: 678 P 680
           P
Sbjct: 450 P 450



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 14/37 (37%), Positives = 25/37 (67%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
           IDL+ ++++G LP+E+  L+ L  F+I+ N   G +P
Sbjct: 510 IDLSRNNLSGSLPKEIEKLSHLLTFNISHNNITGELP 546



>pir|B85440|B85440 receptor kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATAP21_1543972 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV87_1547680 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 87.
          Length = 766

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 30/111 (27%), Positives = 57/111 (51%), Gaps = 2/111 (1%)
 Frame = +3

Query: 354 IALQAWKQAIISDPRNTTSDW--VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAG 527
           + L  +K +++ DP +    W       C++ G+ C    ++ K+ T++   L +  + G
Sbjct: 25  LVLMKFKSSVLVDPLSLLQTWNYKHESPCSWRGISCN---NDSKVLTLS---LPNSQLLG 78

Query: 528 YLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +P +LG L  L    +++N F G +P  F N + L  LD+S+N  +G+ P
Sbjct: 79  SIPSDLGSLLTLQSLDLSNNSFNGPLPVSFFNARELRFLDLSSNMISGEIP 129



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/66 (28%), Positives = 37/66 (56%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R +  +DL+ + I+G +P  +G L +L   +++ N   G +P    +L+ L  + + NN 
Sbjct: 112 RELRFLDLSSNMISGEIPSAIGDLHNLLTLNLSDNALAGKLPTNLASLRNLTVVSLENNY 171

Query: 663 FAGKFP 680
           F+G+ P
Sbjct: 172 FSGEIP 177



>sp|Q9ZVR7|PSKR_ARATH Putative phytosulfokine receptor precursor (EC
           2.7.1.37) (Phytosulfokine LRR receptor
           kinase).>pir|D84434|D84434 probable receptor-like
           protein kinase [imported] - Arabidopsis thaliana
          Length = 1008

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query: 414 WVGS----DVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHIN 581
           W+ S    D CN+TG+ C    ++     V  ++L +  ++G L E LG L ++ V +++
Sbjct: 53  WINSSSSTDCCNWTGITC----NSNNTGRVIRLELGNKKLSGKLSESLGKLDEIRVLNLS 108

Query: 582 SNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            N    +IP    NLK L  LD+S+N  +G  P
Sbjct: 109 RNFIKDSIPLSIFNLKNLQTLDLSSNDLSGGIP 141



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 24/62 (38%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I+L H++++G + EE G L  L VF +  N   G+IP     +  L  LD+SNNR +G 
Sbjct: 527 TIELGHNNLSGPIWEEFGNLKKLHVFDLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGS 586

Query: 675 FP 680
            P
Sbjct: 587 IP 588



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 22/59 (37%), Positives = 35/59 (59%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +D+ G +PE+L  L  L +  I  NR  G++ ++ +NL  L  LD+S N F+G+ P
Sbjct: 203 LGMNDLTGNIPEDLFHLKRLNLLGIQENRLSGSLSREIRNLSSLVRLDVSWNLFSGEIP 261



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P  L    +L +  ++ NR  G IP    + K LF LD+SNN F G+ P
Sbjct: 427 LTGSMPRWLSSSNELQLLDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIP 480



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL  + ++G +P  L  +  L    +++NR  G+IP   + L  L +  ++ N  +G  P
Sbjct: 553 DLKWNALSGSIPSSLSGMTSLEALDLSNNRLSGSIPVSLQQLSFLSKFSVAYNNLSGVIP 612



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/58 (34%), Positives = 29/58 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           S+DL  +   G LPE L     L   ++  N F G +P+ FKN + L    +SN+  A
Sbjct: 320 SLDLGTNRFNGRLPENLPDCKRLKNVNLARNTFHGQVPESFKNFESLSYFSLSNSSLA 377



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ + + G +P  +G    L    +++N F G IPK    L+ L   +IS N  +  F
Sbjct: 444 LDLSWNRLTGAIPSWIGDFKALFYLDLSNNSFTGEIPKSLTKLESLTSRNISVNEPSPDF 503

Query: 678 P 680
           P
Sbjct: 504 P 504



>gb:AP004262_1839356 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0022B05.>gb:AP005165_1848560 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0057M23.
          Length = 1016

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 1/109 (0%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDW-VGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYL 533
           +L  +K+AI +DP    S W   + +C + GV C     + +   V ++DL    + G +
Sbjct: 41  SLLDFKRAITNDPFGAMSSWNTNTHLCRWKGVTC-----DQRAHRVVALDLVGQTLTGQI 95

Query: 534 PEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
              LG ++ L    +  N   G +P +  NL+ L  LD+S N   G  P
Sbjct: 96  SHSLGNMSYLTSLSLPDNLLSGRVPPQLGNLRKLVFLDLSGNSLQGIIP 144



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/62 (32%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +I++  + ++G +P  LG L+ L +F+++ N   G+IP     L+ L +LD+S+N   G+
Sbjct: 547 TINMGQNFLSGSIPTSLGNLSILTLFNLSHNNLTGSIPIALSKLQFLTQLDLSDNHLEGQ 606

Query: 675 FP 680
            P
Sbjct: 607 VP 608



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    ++ ++ +DL+ +++ G +P  LG    L   ++  N   G+IP    NL IL   
Sbjct: 513 PSLSSLQQLSYLDLSSNNLTGEIPPTLGTCQQLETINMGQNFLSGSIPTSLGNLSILTLF 572

Query: 645 DISNNRFAGKFP 680
           ++S+N   G  P
Sbjct: 573 NLSHNNLTGSIP 584



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 24/82 (29%), Positives = 41/82 (50%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N TG+     P+   I ++ ++ L  + + G +PEELG L+++    +  NR  G IP+ 
Sbjct: 186 NLTGII---PPEIGNITSLNTVILQGNMLEGSIPEELGKLSNMSYLLLGGNRLSGRIPEV 242

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             NL  + E+ +  N   G  P
Sbjct: 243 LFNLSHIQEIALPLNMLHGPLP 264



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/67 (28%), Positives = 33/67 (49%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  +    L+ +   G +   +G + +L   +++SN F G IP    N   + EL +SNN
Sbjct: 399 LHRLTKFGLDFNSFTGPIEGWIGSMVNLQALYLDSNNFTGNIPDAIGNTSQMSELFLSNN 458

Query: 660 RFAGKFP 680
           +F G  P
Sbjct: 459 QFHGLIP 465



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 17/59 (28%), Positives = 32/59 (54%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ ++  G +P+ +G  + +    +++N+F G IP     L+ L +LD+S N   G  P
Sbjct: 431 LDSNNFTGNIPDAIGNTSQMSELFLSNNQFHGLIPSSLGKLRQLSKLDLSYNNLEGNIP 489



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 19/68 (27%), Positives = 40/68 (58%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+R ++ +DL+++++ G +P+E+  +  +    ++ N   G IP    +L+ L  LD+S+
Sbjct: 470 KLRQLSKLDLSYNNLEGNIPKEVFTVPTIVQCGLSHNNLQGLIP-SLSSLQQLSYLDLSS 528

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 529 NNLTGEIP 536



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + ++ L+ +++ G +P E+G +  L    +  N   G+IP++   L  +  L
Sbjct: 169 PNIALLSNLRNMRLHSNNLTGIIPPEIGNITSLNTVILQGNMLEGSIPEELGKLSNMSYL 228

Query: 645 DISNNRFAGKFP 680
            +  NR +G+ P
Sbjct: 229 LLGGNRLSGRIP 240



>gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0538C01.>gb:AP000559_1820304 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6,
           clone:P0493C11.
          Length = 980

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/67 (37%), Positives = 41/67 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R+V  ID+++++++G LPEELG L +L    +N+N   G IP +  N   L  L++S N
Sbjct: 481 LRSVQVIDMSNNNLSGSLPEELGQLQNLDSLILNNNNLVGEIPAQLANCFSLNNLNLSYN 540

Query: 660 RFAGKFP 680
             +G  P
Sbjct: 541 NLSGHVP 547



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 22/59 (37%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + + G +P ELG ++ L    +N N   GTIP +   L+ LFEL+++NN   G  P
Sbjct: 321 LHGNKLTGVIPPELGNMSKLSYLQLNDNELVGTIPAELGKLEELFELNLANNNLQGPIP 379



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 20/114 (17%)
 Frame = +3

Query: 399 NTTSDWVG-SDVCNYTGVFCAPA-------------------PDNPKIRTVASIDLNHDD 518
           N   DW G +D C + GV C  A                   P   +++ +  +DL  + 
Sbjct: 51  NALVDWDGGADHCAWRGVTCDNASFAVLALNLSNLNLGGEISPAIGELKNLQFVDLKGNK 110

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P+E+G    L    ++ N   G IP     LK L EL + NN+  G  P
Sbjct: 111 LTGQIPDEIGDCISLKYLDLSGNLLYGDIPFSISKLKQLEELILKNNQLTGPIP 164



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ ++  ++L+ ++  G +P ELG + +L    ++ N F G +P    +L+ L EL++S 
Sbjct: 408 KLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVPATIGDLEHLLELNLSK 467

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 468 NHLDGPVP 475



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/62 (30%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++DL++++ +G +P  +G L  L   +++ N   G +P +F NL+ +  +D+SNN  +G 
Sbjct: 438 TLDLSYNEFSGPVPATIGDLEHLLELNLSKNHLDGPVPAEFGNLRSVQVIDMSNNNLSGS 497

Query: 675 FP 680
            P
Sbjct: 498 LP 499



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 19/68 (27%), Positives = 38/68 (55%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  +  ++L ++++ G +P  +     L  F++  N+  G+IP  F+ L+ L  L++S+
Sbjct: 360 KLEELFELNLANNNLQGPIPANISSCTALNKFNVYGNKLNGSIPAGFQKLESLTYLNLSS 419

Query: 657 NRFAGKFP 680
           N F G  P
Sbjct: 420 NNFKGNIP 427



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFE 641
           +PD  ++  +   D+  +++ G +PE +G      +  I+ N+  G IP     L++   
Sbjct: 212 SPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDISYNQISGEIPYNIGFLQVA-T 270

Query: 642 LDISNNRFAGKFP 680
           L +  NR  GK P
Sbjct: 271 LSLQGNRLTGKIP 283



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L  + + G L  ++  L  L  F +  N   GTIP+   N      LDIS N+ +G+ 
Sbjct: 200 LGLRGNSLTGTLSPDMCQLTGLWYFDVRGNNLTGTIPESIGNCTSFEILDISYNQISGEI 259

Query: 678 P 680
           P
Sbjct: 260 P 260



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 18/52 (34%), Positives = 27/52 (51%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G +P     L  L   +++SN F G IP +  ++  L  LD+S N F+G  P
Sbjct: 400 GSIPAGFQKLESLTYLNLSSNNFKGNIPSELGHIINLDTLDLSYNEFSGPVP 451



>gb:AJ863559_1814979 Coffea canephora partial mRNA for somatic
           embryogenesis receptor-like kinase (serk gene).
          Length = 258

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAP-DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           Y+     P P D   +  + S+DL  +   G +P+ LG L+ L    +N+N   G IP  
Sbjct: 5   YSNNISGPIPSDLGNLTNLVSLDLYLNSFNGPIPDTLGKLSKLRFLRLNNNSLTGPIPLS 64

Query: 615 FKNLKILFELDISNNRFAGKFP 680
             N+  L  LD+SNNR +G  P
Sbjct: 65  LTNISSLQVLDLSNNRLSGAVP 86



 Score = 35.8 bits (81), Expect = 0.71
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++I+G +P +LG L +L    +  N F G IP     L  L  L ++NN   G  
Sbjct: 2   LELYSNNISGPIPSDLGNLTNLVSLDLYLNSFNGPIPDTLGKLSKLRFLRLNNNSLTGPI 61

Query: 678 P 680
           P
Sbjct: 62  P 62



>gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 3 (SERK3) mRNA, complete cds.
          Length = 615

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL A K ++ +DP      W  + V   T        DN    +V  +DL + +++G L 
Sbjct: 31  ALSALKNSL-ADPNKVLQSWDATLVTPCTWFHVTCNSDN----SVTRVDLGNANLSGQLV 85

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +LG L +L    + SN   GTIP++  NL  L  LD+  N  +G  P
Sbjct: 86  MQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIP 133



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/64 (34%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL  ++++G +P  LG L  L    +N+N   G IP+    +  L  LD+SNN   
Sbjct: 118 LVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLT 177

Query: 669 GKFP 680
           G  P
Sbjct: 178 GDIP 181



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++I G +PE+LG L +L    +  N   G IP     LK L  L ++NN  +G+ 
Sbjct: 97  LELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEI 156

Query: 678 P 680
           P
Sbjct: 157 P 157



>gb:F15P11_1677567 Arabidopsis thaliana BAC F15P11.
          Length = 957

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+++   G  P  +G L+ L    + SN+F G IP    NL  L  LD+SNN F+G+ 
Sbjct: 198 LDLSYNRFFGQFPSSIGGLSHLTTLSLFSNKFSGQIPSSIGNLSNLTTLDLSNNNFSGQI 257

Query: 678 P 680
           P
Sbjct: 258 P 258



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  + ++DL++++ +G +P  +G L+ L    + SN F G IP  F NL  L  L + +N
Sbjct: 240 LSNLTTLDLSNNNFSGQIPSFIGNLSQLTFLGLFSNNFVGEIPSSFGNLNQLTRLYVDDN 299

Query: 660 RFAGKFP 680
           + +G FP
Sbjct: 300 KLSGNFP 306



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 21/62 (33%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++D + +   G +P+ +GLL +L V  +++N F G +P    NL  L  LD+S N+  G+
Sbjct: 770 AVDFSGNRFEGEIPKSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDVSKNKLTGE 829

Query: 675 FP 680
            P
Sbjct: 830 IP 831



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 34/120 (28%), Positives = 51/120 (42%), Gaps = 21/120 (17%)
 Frame = +3

Query: 384 ISDPRNTTSDWVGSDVCNYTGVFCAPAP------------------DNPKIRTV---ASI 500
           I  PR T S    SD CN+ GV C                       N  IR +    ++
Sbjct: 67  IESPRKTDSWGNNSDCCNWEGVTCNAKSGEVIELDLSCSSLHGRFHSNSSIRNLHFLTTL 126

Query: 501 DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           DL+ +D  G +   +  L+ L    ++SN F G I     NL  L  L++ +N+F+G+ P
Sbjct: 127 DLSFNDFKGQITSSIENLSHLTYLDLSSNHFSGQILNSIGNLSRLTYLNLFDNQFSGQAP 186



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ +  +G +   +G L+ L   ++  N+F G  P    NL  L  LD+S NRF G+F
Sbjct: 150 LDLSSNHFSGQILNSIGNLSRLTYLNLFDNQFSGQAPSSICNLSHLTFLDLSYNRFFGQF 209

Query: 678 P 680
           P
Sbjct: 210 P 210



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           ++ + ++G  P  L  L  L +  +++N+F GT+P    +L  L + D S+N F G FP
Sbjct: 296 VDDNKLSGNFPNVLLNLTGLSLLSLSNNKFTGTLPPNITSLSNLMDFDASDNAFTGTFP 354



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + ++ L  +  +G +P  +G L++L    +++N F G IP    NL  L  L + +N F 
Sbjct: 219 LTTLSLFSNKFSGQIPSSIGNLSNLTTLDLSNNNFSGQIPSFIGNLSQLTFLGLFSNNFV 278

Query: 669 GKFP 680
           G+ P
Sbjct: 279 GEIP 282



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 20/59 (33%), Positives = 30/59 (50%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           S+D+ H+ + G LP  L   + L V ++ SNR   T P    +L  L  L + +N F G
Sbjct: 632 SLDVGHNQLVGKLPRSLSFFSTLEVLNVESNRINDTFPFWLSSLPKLQVLVLRSNAFHG 690



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 3/75 (4%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI---L 635
           P+   +  +   D + +   G  P  L  +  L    +N N+  GT+  +F N+     L
Sbjct: 331 PNITSLSNLMDFDASDNAFTGTFPSFLFTIPSLTYIRLNGNQLKGTL--EFGNISSPSNL 388

Query: 636 FELDISNNRFAGKFP 680
           +ELDI NN F G  P
Sbjct: 389 YELDIGNNNFIGPIP 403



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/52 (38%), Positives = 25/52 (48%)
 Frame = +3

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G   E + +L        + NRF G IPK    LK L  L +SNN F+G  P
Sbjct: 756 GVAMELVRILTIYTAVDFSGNRFEGEIPKSIGLLKELLVLSLSNNAFSGHMP 807



 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/61 (27%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  +  +G  P  +  L+ L    ++ NRF G  P     L  L  L + +N+F+G+ 
Sbjct: 174 LNLFDNQFSGQAPSSICNLSHLTFLDLSYNRFFGQFPSSIGGLSHLTTLSLFSNKFSGQI 233

Query: 678 P 680
           P
Sbjct: 234 P 234



>gb:BT000466_1634744 Arabidopsis thaliana putative disease
           resistance protein (At4g13900) mRNA, complete cds.
          Length = 751

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 24/62 (38%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE + LL +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 577 TIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 636

Query: 675 FP 680
            P
Sbjct: 637 IP 638



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 23/80 (28%), Positives = 47/80 (58%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           + +F  P P  P + ++  +  +++  +G +P+ +  L +L +  +++N F G+IP+ F+
Sbjct: 352 SNIFQDPFPLLP-VDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFE 410

Query: 621 NLKILFELDISNNRFAGKFP 680
           NL  L+ L + NN  +G FP
Sbjct: 411 NLH-LYVLHLRNNNLSGIFP 429



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 31/118 (26%), Positives = 41/118 (34%), Gaps = 32/118 (27%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLN------------------------------- 509
           +D C++ GV C P   N     +A  DLN                               
Sbjct: 61  TDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSY 120

Query: 510 HDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +D +  G L + +G L  L V  +      G IP    NL  L  LD+S N F G  P
Sbjct: 121 NDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIP 178



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L +++++G  PEE  +   L    +  N F G +PK   N   L  L + +NR +  F
Sbjct: 417 LHLRNNNLSGIFPEE-AISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTF 475

Query: 678 P 680
           P
Sbjct: 476 P 476



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           P    +  + S+DL+ + ++G +P ELG L  L   + + NR  G IP+
Sbjct: 615 PSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQ 663



>gb:AB025629_1516537 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOE17.>gb:AY063922_1565869 Arabidopsis
           thaliana unknown protein (At3g20820) mRNA, complete
           cds.>gb:AY117334_1579375 Arabidopsis thaliana unknown
           protein (At3g20820) mRNA, complete cds.
          Length = 365

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 27/69 (39%), Positives = 39/69 (56%)
 Frame = +3

Query: 474 PKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDIS 653
           P +RT   +DL  + I+G +P ++G L  L V ++  NR  G+IPK   NL  L  LD+ 
Sbjct: 127 PFLRT---LDLIGNQISGGIPYDIGRLNRLAVLNVADNRISGSIPKSLTNLSSLMHLDLR 183

Query: 654 NNRFAGKFP 680
           NN  +G  P
Sbjct: 184 NNLISGVIP 192



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  +DL ++ I+G +P ++G L  L    ++ NR  G IP+   N+  L ++D+S N
Sbjct: 174 LSSLMHLDLRNNLISGVIPSDVGRLKMLSRALLSGNRITGRIPESLTNIYRLADVDLSGN 233

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 234 QLYGTIP 240



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/67 (28%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I  +A +DL+ + + G +P  LG ++ L   +++ N+  G IP+      ++  L++S N
Sbjct: 222 IYRLADVDLSGNQLYGTIPPSLGRMSVLATLNLDGNKISGEIPQTLMTSSVM-NLNLSRN 280

Query: 660 RFAGKFP 680
              GK P
Sbjct: 281 LLQGKIP 287



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/72 (25%), Positives = 34/72 (47%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P      +V +++L+ + + G +PE  G  +   V  ++ N   G IP+       +  L
Sbjct: 264 PQTLMTSSVMNLNLSRNLLQGKIPEGFGPRSYFTVLDLSYNNLKGPIPRSISGASFIGHL 323

Query: 645 DISNNRFAGKFP 680
           D+S+N   G+ P
Sbjct: 324 DLSHNHLCGRIP 335



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 18/71 (25%), Positives = 37/71 (52%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D  +++ ++   L+ + I G +PE L  +  L    ++ N+  GTIP     + +L  L+
Sbjct: 194 DVGRLKMLSRALLSGNRITGRIPESLTNIYRLADVDLSGNQLYGTIPPSLGRMSVLATLN 253

Query: 648 ISNNRFAGKFP 680
           +  N+ +G+ P
Sbjct: 254 LDGNKISGEIP 264



>gb:AX120065_1461712 Sequence 48 from Patent WO0129240.
          Length = 591

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL A K ++ +DP      W  + V   T        DN    +V  +DL + +++G L 
Sbjct: 31  ALSALKNSL-ADPNKVLQSWDATLVTPCTWFHVTCNSDN----SVTRVDLGNANLSGQLV 85

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +LG L +L    + SN   GTIP++  NL  L  LD+  N  +G  P
Sbjct: 86  MQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIP 133



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++I G +PE+LG L +L    +  N   G IP     LK L  L ++NN  +G+ 
Sbjct: 97  LELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEI 156

Query: 678 P 680
           P
Sbjct: 157 P 157



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK---NLKILF 638
           + S+DL  ++++G +P  LG L  L    +N+N   G IP+       L++LF
Sbjct: 118 LVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLF 170



>gb:AC084329_1205439 Leishmania major strain Friedlin chromosome 35
            clone L2289, complete sequence.
          Length = 1325

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/82 (30%), Positives = 44/82 (53%)
 Frame = +3

Query: 435  NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
            +YTGV      D   +  +  ++L H+ ++G LP E   +  +   ++N N+F G +P +
Sbjct: 1220 SYTGVSGGAPSDWSALVNLKKLNLGHNKLSGELPAEWSGMVAMEELYLNDNKFSGKLPFE 1279

Query: 615  FKNLKILFELDISNNRFAGKFP 680
            + N++ L  LD+SNN   G  P
Sbjct: 1280 WFNMENLKILDLSNNELGGSVP 1301



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L + +++G LP     L  L   H  +N   GT+P  + +LK LF+L +  N+F G  
Sbjct: 247 LNLTNLNLSGTLPASWASLQRLEQLHAANNLLTGTLPASWGSLKKLFDLQLIGNKFTGTI 306

Query: 678 P 680
           P
Sbjct: 307 P 307



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 15/68 (22%), Positives = 39/68 (57%)
 Frame = +3

Query: 477  KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
            ++ ++  +D ++  ++G  P +   L +L   ++  N+  G +P ++  +  + EL +++
Sbjct: 1210 RLLSLIELDFSYTGVSGGAPSDWSALVNLKKLNLGHNKLSGELPAEWSGMVAMEELYLND 1269

Query: 657  NRFAGKFP 680
            N+F+GK P
Sbjct: 1270 NKFSGKLP 1277



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           TG      P    +  +  + L+++++   LP E   L  L   H++ N+  GTIP+ + 
Sbjct: 551 TGASGTLPPSWGALTNLEILSLSNNNLDATLPGEWSSLTQLRTLHLHDNQLSGTIPETYN 610

Query: 621 NLKILFELDISNNRFAGKFP 680
            +  L  + +  NRF G  P
Sbjct: 611 AMITLTRVSLEVNRFCGCLP 630



 Score = 38.9 bits (89), Expect = 0.084
 Identities = 18/67 (26%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R +  +DL+    +G LP   G L +L +  +++N    T+P ++ +L  L  L + +N
Sbjct: 540 MRALQELDLDSTGASGTLPPSWGALTNLEILSLSNNNLDATLPGEWSSLTQLRTLHLHDN 599

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 600 QLSGTIP 606



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 1/75 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDD-IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKIL 635
           PA  NP    V  +D +H + + G  P    LL  L           GT+P ++ ++  L
Sbjct: 436 PADVNPSEVVVTKLDFSHSEWVEGDYPSSWALLTSLENVSFAYTSMWGTLPSRWSSMSAL 495

Query: 636 FELDISNNRFAGKFP 680
             LD+S     G+FP
Sbjct: 496 KYLDLSFTWTDGRFP 510



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +3

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LPEE G L ++ V ++ +    GT+P  + +L+ L +L  +NN   G  P
Sbjct: 234 LPEEWGNLINIKVLNLTNLNLSGTLPASWASLQRLEQLHAANNLLTGTLP 283



>gb:AE016959_1023024 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC022457_1538989
           Oryza sativa chromosome 10 BAC OSJNBa0006L06 genomic
           sequence, complete sequence.>gb:AE017103_1752843 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 535

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 19/127 (14%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIR----------------- 485
           AL AWK A ++D    ++    + VC + GV C  A    ++R                 
Sbjct: 34  ALLAWK-ASLTDVAALSAWTRAAPVCGWRGVACDAAGLVARLRLPSLGLRGGLDELDFAA 92

Query: 486 --TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
              +  +DLN ++  G +P  +  L  L    + +N F G+IP +  +L  L EL + NN
Sbjct: 93  LPALTELDLNGNNFTGAIPASISRLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNN 152

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 153 NFVGNIP 159



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 1/82 (1%)
 Frame = +3

Query: 438 YTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGL-LADLGVFHINSNRFCGTIPKK 614
           +TGVF +        +T+ S+D  ++   G +P  +G     + +  + SN F G IP +
Sbjct: 433 FTGVFPSTLEG---CKTLVSLDFGNNKFFGNIPPWIGKGFPSMRILILKSNNFTGEIPSE 489

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  L  LD+SNN   G  P
Sbjct: 490 LSQLSQLQLLDMSNNGLTGSIP 511



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG   A      ++ ++AS+DL ++   G +P ++G L+ L    + +N F G IP +
Sbjct: 105 NFTGAIPASIS---RLVSLASLDLGNNGFVGSIPSQIGDLSGLVELRLYNNNFVGNIPHQ 161

Query: 615 FKNLKILFELDISNN 659
              L  +   D+ NN
Sbjct: 162 LSWLPKITHFDLGNN 176



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +   G +P ELG    L +  +  NR  G+IP    +L  L  LD+S N   G  P
Sbjct: 259 LRSNMFTGNIPPELGKARKLNMLSMYDNRLSGSIPPALGSLTSLKYLDLSANNLTGGIP 317



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           L  ++  G +P EL  L+ L +  +++N   G+IP+ F NL
Sbjct: 477 LKSNNFTGEIPSELSQLSQLQLLDMSNNGLTGSIPRSFSNL 517



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 25/111 (22%), Positives = 42/111 (37%), Gaps = 25/111 (22%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPE--------------------E 542
           S  C+    FC       ++ ++ ++DL+++ + G LP+                    E
Sbjct: 359 SSNCSSGSAFC-------RLLSLENLDLSNNKLTGKLPDCWWNLQNLQFMDLSHNDFSGE 411

Query: 543 LGLL-----ADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +  L       L   ++  N F G  P   +  K L  LD  NN+F G  P
Sbjct: 412 ISALGTSYNCSLHSVYLAGNGFTGVFPSTLEGCKTLVSLDFGNNKFFGNIP 462



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 24/85 (28%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTI------------------------ 605
           +DL+ +++ G +P ELG L++L   +++ N   G I                        
Sbjct: 305 LDLSANNLTGGIPYELGHLSNLQFLNLSHNSISGPIMGNLGNNFKLQGVGSSGNSSNCSS 364

Query: 606 PKKFKNLKILFELDISNNRFAGKFP 680
              F  L  L  LD+SNN+  GK P
Sbjct: 365 GSAFCRLLSLENLDLSNNKLTGKLP 389



>gb:AE016959_1020712 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079179_1732383
           Oryza sativa chromosome 10 clone OSJNBa0079B05, complete
           sequence.>gb:AC116601_1739309 Oryza sativa chromosome 10
           clone OSJNAa0079B05, complete
           sequence.>gb:AE017051_1750531 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 5 of 77 of the
           complete sequence.
          Length = 1098

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/68 (36%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL-KILFELDISN 656
           +R +  +D++ + ++G +PEELG    L +  IN+N F G +P    NL  I   LD+SN
Sbjct: 589 LRDLEYLDVSRNSLSGPIPEELGRCTKLQLLRINNNHFSGNLPATIGNLASIQIMLDVSN 648

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 649 NKLDGLLP 656



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 35/116 (30%), Positives = 49/116 (42%), Gaps = 2/116 (1%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPRNTTSDWVGS-DVCNYTGVFCAPAPDNPKIRTVASIDLNHD 515
           +R+  +AL  WK  + S      S W  S   CN+TG+ C  A        + +I L   
Sbjct: 13  LRSQQMALLHWKSTLQSTGPQMRSSWQASTSPCNWTGITCR-AAHQAMSWVITNISLPDA 71

Query: 516 DIAGYLPE-ELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            I G L E     L  L    ++SN   G IP    +L  L  LD+  N+  G+ P
Sbjct: 72  GIHGQLGELNFSSLPFLTYIDLSSNSVYGPIPSSISSLSALTYLDLQLNQLTGRMP 127



 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 22/72 (30%), Positives = 40/72 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   K+  +  + L+ + + G +P E+G L +L   +++ N+  G+IP +  NL+ L  L
Sbjct: 536 PALSKLPNLVELKLSSNHVNGVIPPEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYL 595

Query: 645 DISNNRFAGKFP 680
           D+S N  +G  P
Sbjct: 596 DVSRNSLSGPIP 607



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + S++L+ + ++G +P +LG L DL    ++ N   G IP++      L  L
Sbjct: 560 PEIGNLINLYSLNLSFNKLSGSIPSQLGNLRDLEYLDVSRNSLSGPIPEELGRCTKLQLL 619

Query: 645 DISNNRFAGKFP 680
            I+NN F+G  P
Sbjct: 620 RINNNHFSGNLP 631



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/59 (35%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L+ + I G +P  LG++++L    ++SN+  G+IP    NL  L  LD+S N+  G  P
Sbjct: 309 LHENQITGSIPPGLGIISNLQNLILHSNQISGSIPGTLANLTKLIALDLSKNQINGSIP 367



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 20/68 (29%), Positives = 39/68 (57%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ +  +DL+++++ G++P  +G L  +    I+ N   G IPK+   L  L  L +SN
Sbjct: 132 ELQRLTMLDLSYNNLTGHIPASVGNLTMITELSIHRNMVSGPIPKEIGMLANLQLLQLSN 191

Query: 657 NRFAGKFP 680
           N  +G+ P
Sbjct: 192 NTLSGEIP 199



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 18/62 (29%), Positives = 35/62 (56%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           ++DL+ + I G +P+E G L +L +  +  N+  G+IPK   N + +  L+  +N+ +  
Sbjct: 354 ALDLSKNQINGSIPQEFGNLVNLQLLSLEENQISGSIPKSLGNFQNMQNLNFRSNQLSNS 413

Query: 675 FP 680
            P
Sbjct: 414 LP 415



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 19/61 (31%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D++++ + G LP++ G +  L   +++ N+F G IP  F ++  L  LD S N   G  
Sbjct: 644 LDVSNNKLDGLLPQDFGRMQMLVFLNLSHNQFTGRIPTSFASMVSLSTLDASYNNLEGPL 703

Query: 678 P 680
           P
Sbjct: 704 P 704



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 17/64 (26%), Positives = 35/64 (54%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +  + ++ + ++G +P+E+G+LA+L +  +++N   G IP    NL  L    +  N  +
Sbjct: 160 ITELSIHRNMVSGPIPKEIGMLANLQLLQLSNNTLSGEIPTTLANLTNLDTFYLDGNELS 219

Query: 669 GKFP 680
           G  P
Sbjct: 220 GPVP 223



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 20/59 (33%), Positives = 31/59 (52%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  + I G +P E+G LA L    +N N+  G++P +  NL +L  L +  N+  G  P
Sbjct: 261 LFRNQIIGSIPPEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIP 319



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +  + LN + + G LP ELG L  L    ++ N+  G+IP     +  L  L
Sbjct: 272 PEIGNLAMLTDLVLNENKLKGSLPTELGNLTMLNNLFLHENQITGSIPPGLGIISNLQNL 331

Query: 645 DISNNRFAGKFP 680
            + +N+ +G  P
Sbjct: 332 ILHSNQISGSIP 343



 Score = 33.1 bits (74), Expect = 4.6
 Identities = 16/64 (25%), Positives = 29/64 (45%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I  +  +DL  + ++G LP  +     L +  ++ N F G +P+  K    L  L +  N
Sbjct: 421 ITNMVELDLASNSLSGQLPANICAGTSLKLLFLSLNMFNGPVPRSLKTCTSLVRLFLDGN 480

Query: 660 RFAG 671
           +  G
Sbjct: 481 QLTG 484



>pir|T05259|T05259 probable disease resistance protein F18A5.290 -
           Arabidopsis thaliana>gb:ATCHRIV37_1545154 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           37.>gb:ATF18A5_1549075 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F18A5 (ESSA project).
          Length = 835

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 24/62 (38%), Positives = 38/62 (61%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +ID++ + + G +PE + LL +L V ++++N F G IP    NL  L  LD+S NR +G 
Sbjct: 661 TIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGS 720

Query: 675 FP 680
            P
Sbjct: 721 IP 722



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 22/64 (34%), Positives = 34/64 (53%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+ ++  IDL  + + G LP  +  L+ L  F+I  N F G+IP     +  L ELD+  
Sbjct: 232 KLNSLTDIDLGSNQLKGMLPSNMSSLSKLEYFYIGGNSFSGSIPSSLFMIPSLVELDLQR 291

Query: 657 NRFA 668
           N F+
Sbjct: 292 NHFS 295



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 23/80 (28%), Positives = 47/80 (58%)
 Frame = +3

Query: 441 TGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFK 620
           + +F  P P  P + ++  +  +++  +G +P+ +  L +L +  +++N F G+IP+ F+
Sbjct: 436 SNIFQDPFPLLP-VDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFE 494

Query: 621 NLKILFELDISNNRFAGKFP 680
           NL  L+ L + NN  +G FP
Sbjct: 495 NLH-LYVLHLRNNNLSGIFP 513



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 31/118 (26%), Positives = 41/118 (34%), Gaps = 32/118 (27%)
 Frame = +3

Query: 423 SDVCNYTGVFCAPAPDNPKIRTVASIDLN------------------------------- 509
           +D C++ GV C P   N     +A  DLN                               
Sbjct: 52  TDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSY 111

Query: 510 HDDI-AGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +D +  G L + +G L  L V  +      G IP    NL  L  LD+S N F G  P
Sbjct: 112 NDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIP 169



 Score = 32.7 bits (73), Expect = 6.0
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + L +++++G  PEE  +   L    +  N F G +PK   N   L  L + +NR +  F
Sbjct: 501 LHLRNNNLSGIFPEE-AISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTF 559

Query: 678 P 680
           P
Sbjct: 560 P 560



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 16/49 (32%), Positives = 27/49 (55%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           P    +  + S+DL+ + ++G +P ELG L  L   + + NR  G IP+
Sbjct: 699 PSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQ 747



>pir|T17460|T17460 disease resistance protein -
           tomato>gb:AF119040_1769646 Lycopersicon esculentum
           haplotype Northern Lights Hcr9 gene cluster, complete
           sequence.
          Length = 855

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS---IDLNHDDIAGY 530
           LQA K+    D    T +++     NY         D   +R   S   I+L+ +   G 
Sbjct: 619 LQAMKKI---DESTRTPEYISDIYYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGR 675

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +P  +G L  L   +++ N   G IP  F+NL +L  LD+S+N+ +G  P
Sbjct: 676 IPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIP 725



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           IDL+ + + G  P  +  L +L   +++SN   G+IP    +L  L ELD+SNN F+GK
Sbjct: 360 IDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGK 418



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 11/105 (10%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVA-----------SIDLNHDDIAGYLPEEL 545
           N  S  + S +CN   +       N    T+            S+DL+++ ++G +    
Sbjct: 458 NNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTF 517

Query: 546 GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +   L V  ++ N+  G +P+   N K L  LD+ NN+    FP
Sbjct: 518 SIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFP 562



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 1/72 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK-IL 635
           P P++   +++  + L+H++I+G++   +  L  + +  + SN   GTIP+    +K  L
Sbjct: 440 PIPNSLLNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENL 499

Query: 636 FELDISNNRFAG 671
           + LD+SNNR +G
Sbjct: 500 WSLDLSNNRLSG 511



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 18/62 (29%), Positives = 36/62 (58%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+H+ + G++P     L+ L    ++SN+  G IP++  +L  L  L++S+N   G 
Sbjct: 688 TLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGC 747

Query: 675 FP 680
            P
Sbjct: 748 IP 749



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 15/44 (34%), Positives = 27/44 (61%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+DL+ + I+G +P++L  L  L V +++ N   G IPK
Sbjct: 707 LSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPK 750



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 5/66 (7%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-----FKNLKILFELDISNNR 662
           +DL ++ +    P  LG L+ L + ++ SN+  G I        F  L+I   LD+S+N 
Sbjct: 550 LDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSSGNTNLFTRLQI---LDLSSNG 606

Query: 663 FAGKFP 680
           F+G  P
Sbjct: 607 FSGNLP 612



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 19/68 (27%), Positives = 31/68 (45%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K +T++ + L  + + G +P  L L   L    ++ N   G I     NLK +  LD+ +
Sbjct: 423 KSKTLSVVSLRQNQLEGPIPNSL-LNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGS 481

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 482 NNLEGTIP 489



>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
           receptor kinase 1 precursor (EC 2.7.1.37)
           (BRI1-associated receptor kinase 1) (Somatic
           embryogenesis receptor-like kinase
           3).>gb:CQ768561_1451798 Sequence 56 from Patent
           WO2004007712.
          Length = 615

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/108 (31%), Positives = 51/108 (47%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLP 536
           AL A K ++ +DP      W  + V   T        DN    +V  +DL + +++G L 
Sbjct: 31  ALSALKNSL-ADPNKVLQSWDATLVTPCTWFHVTCNSDN----SVTRVDLGNANLSGQLV 85

Query: 537 EELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +LG L +L    + SN   GTIP++  NL  L  LD+  N  +G  P
Sbjct: 86  MQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIP 133



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/64 (34%), Positives = 34/64 (53%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           + S+DL  ++++G +P  LG L  L    +N+N   G IP+    +  L  LD+SNN   
Sbjct: 118 LVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLT 177

Query: 669 GKFP 680
           G  P
Sbjct: 178 GDIP 181



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 21/61 (34%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L  ++I G +PE+LG L +L    +  N   G IP     LK L  L ++NN  +G+ 
Sbjct: 97  LELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEI 156

Query: 678 P 680
           P
Sbjct: 157 P 157



>gb:AP005896_1859825 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBb0032C09.>gb:AP007224_1863298 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0463E12.
          Length = 1051

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/68 (32%), Positives = 41/68 (60%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++ + +++++ + I+G +P+ L  L DL V  +++N   GTIP    NL  L +L++SN
Sbjct: 579 QLKMLRTLNISFNSISGEIPQPLCNLTDLQVLDLSNNHLIGTIPSALNNLHFLSKLNVSN 638

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 639 NDLEGSIP 646



 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/63 (36%), Positives = 35/63 (55%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           A+++L  + + G +P+E+G L  L   +I+ N   G IP+   NL  L  LD+SNN   G
Sbjct: 560 ATLNLARNHLMGAIPQEIGQLKMLRTLNISFNSISGEIPQPLCNLTDLQVLDLSNNHLIG 619

Query: 672 KFP 680
             P
Sbjct: 620 TIP 622



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 22/76 (28%), Positives = 42/76 (55%), Gaps = 3/76 (3%)
 Frame = +3

Query: 462 APDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL---KI 632
           +P    + ++  ++L+H+ ++GYLP EL   + + V  ++ NR  G +      +   + 
Sbjct: 98  SPSLGNLTSLLRLNLSHNSLSGYLPWELVSSSSISVLDVSFNRLRGELQDPLSPMTAVRP 157

Query: 633 LFELDISNNRFAGKFP 680
           L  L+IS+N F G+FP
Sbjct: 158 LQVLNISSNSFTGQFP 173



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 30/121 (24%), Positives = 52/121 (42%)
 Frame = +3

Query: 318 LTFENDRIRNAYIALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS 497
           L+  N+ + N    LQ     I+ + R+ ++  +G    N+ G              +  
Sbjct: 405 LSISNNSLTNITDTLQ-----ILKNSRSLSTLLMG---VNFNGELMPEDETIDGFENLQF 456

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           + ++   + G +P  L  L +L +  +++N+  G IP     L  LF LDISNN   G  
Sbjct: 457 VSIDDCSLIGNIPFWLSKLTNLQMLDLSNNQLTGQIPAWINRLNFLFYLDISNNSLTGGI 516

Query: 678 P 680
           P
Sbjct: 517 P 517



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/66 (28%), Positives = 33/66 (50%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  + ++DL  ++  G +PE +G L  L    +  N   G +P    N   L  +DI +
Sbjct: 277 KLSNLVTLDLGGNNFNGRIPESIGELKKLEELLLGHNNMYGEVPSTLSNCTNLKTIDIKS 336

Query: 657 NRFAGK 674
           N F+G+
Sbjct: 337 NSFSGE 342



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++DL  ++  G +P+ +   ++L    ++SN+F G +PK   NLK L  L ISNN
Sbjct: 356 TLDLLLNNFNGTIPQNIYSCSNLIALRMSSNKFHGQLPKGIGNLKSLSFLSISNN 410



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 20/74 (27%), Positives = 35/74 (47%)
 Frame = +3

Query: 450 FCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK 629
           FC+ +P      ++  +DL ++  +G +P  +G  + L V  +  N   GT+P +  N  
Sbjct: 201 FCSSSP------SLMVLDLCYNLFSGGIPPGIGACSRLNVLKVGQNNLSGTLPDELFNAT 254

Query: 630 ILFELDISNNRFAG 671
            L  L + NN   G
Sbjct: 255 SLEHLSVPNNGLNG 268



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPE-ELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           +ID+  +  +G L +     L +L    +  N F GTIP+   +   L  L +S+N+F G
Sbjct: 331 TIDIKSNSFSGELSKINFSTLPNLQTLDLLLNNFNGTIPQNIYSCSNLIALRMSSNKFHG 390

Query: 672 KFP 680
           + P
Sbjct: 391 QLP 393



>gb:AP005420_1851511 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0418B08.>gb:AP005579_1854425 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 1080

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 37/124 (29%), Positives = 55/124 (44%), Gaps = 9/124 (7%)
 Frame = +3

Query: 336 RIRNAYIALQAWKQAIISDPRNTT-------SDWVGS--DVCNYTGVFCAPAPDNPKIRT 488
           R R    AL   K  +++  R  T       +DW  S  DVC +TGV C     + + + 
Sbjct: 40  RQRRRLQALMQEKATLLALKRGLTLLSPKLLADWNDSNTDVCGFTGVAC-----DRRRQH 94

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           V  + L++  I G +P  L  L  L    ++ N   G +P    NL  L  LD+S N+ +
Sbjct: 95  VVGLQLSNMSINGSIPLALAQLPHLRYLDLSDNHISGAVPSFLSNLTQLLMLDMSENQLS 154

Query: 669 GKFP 680
           G  P
Sbjct: 155 GAIP 158



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           +++    IDL+ +++ G +  ELG  A+L V  ++ N   G +P     L+ +  LD+S+
Sbjct: 560 RLQMAEVIDLSWNNLTGAIFPELGACAELQVLDLSHNSLTGVLPSSLDGLESIERLDVSD 619

Query: 657 NRFAGKFP 680
           N   G+ P
Sbjct: 620 NSLTGEIP 627



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/72 (29%), Positives = 35/72 (48%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P    +  +  +D++ + + G +PEEL  +  L   ++  N   G+IP  F  LK LF L
Sbjct: 183 PSFGNLTNLEILDMSINVLTGRIPEELSNIGKLEGLNLGQNNLVGSIPASFTQLKNLFYL 242

Query: 645 DISNNRFAGKFP 680
            +  N  +G  P
Sbjct: 243 SLEKNSLSGSIP 254



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+H+ + G LP  L  L  +    ++ N   G IP+       L  L++S N  AG  
Sbjct: 591 LDLSHNSLTGVLPSSLDGLESIERLDVSDNSLTGEIPQTLTKCTTLTYLNLSYNDLAGVV 650

Query: 678 P 680
           P
Sbjct: 651 P 651



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 19/64 (29%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           ++ ++L  + I G +P ++G + ++ + +++SN   GTIP     L  L +LD+S N   
Sbjct: 398 MSHLNLELNAIEGPIPADIGDVINITLMNLSSNLLNGTIPTSICWLPNLQQLDLSRNSLT 457

Query: 669 GKFP 680
           G  P
Sbjct: 458 GAVP 461



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           ++  +DL+ + ++G +P  +G L  L    ++ N+  G IP        +  LD+S+NR 
Sbjct: 469 SLGELDLSSNALSGSIPSSIGSLK-LSYLSLHRNQLSGEIPASLGQHLGIVRLDLSSNRL 527

Query: 666 AGKFP 680
            G+ P
Sbjct: 528 TGEIP 532



 Score = 36.6 bits (83), Expect = 0.42
 Identities = 17/61 (27%), Positives = 33/61 (54%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +DL+ + + G +P  +     LG   ++SN   G+IP    +LK+ + L +  N+ +G+ 
Sbjct: 449 LDLSRNSLTGAVPACISNATSLGELDLSSNALSGSIPSSIGSLKLSY-LSLHRNQLSGEI 507

Query: 678 P 680
           P
Sbjct: 508 P 508



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = +3

Query: 501 DLNHDDIAGYLPEELG--LLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           DL  ++I G +P +    L     V ++ SN   G +P+   N  IL+ LD+ NN  A  
Sbjct: 268 DLGDNNITGEIPGDASDSLSDRFAVLNLYSNSLTGRLPRWLANCTILYLLDVENNSLADD 327

Query: 675 FP 680
            P
Sbjct: 328 LP 329



>gb:AP003489_1829914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0568D10.
          Length = 1026

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 22/136 (16%)
 Frame = +3

Query: 339 IRNAYIALQAWKQAIISDPRNTT-SDWVGS-DVCNYTGVFC------------------- 455
           + + + AL A+   + +D      +DW  S + CN+TGV C                   
Sbjct: 33  VADDWSALLAFLSNVSADSGGVALADWGRSPEFCNWTGVVCGGGERRRVTQLVLAGRGLR 92

Query: 456 -APAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKI 632
              +P   ++  V  +DL+++  +G +P EL  L+ L    +  NR  G IP     L+ 
Sbjct: 93  GVVSPALGRLEFVTVLDLSNNGFSGEIPAELASLSRLTQLSLTGNRLEGAIPAGIGLLRR 152

Query: 633 LFELDISNNRFAGKFP 680
           L+ LD+S NR +G  P
Sbjct: 153 LYFLDLSGNRLSGGIP 168



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 23/72 (31%), Positives = 41/72 (56%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+  ++R +  + L+++ +AG +P  +G +  LG+  ++ NR  GTIP  F NL  L  L
Sbjct: 349 PEMSRLRRLERLYLSNNLLAGEIPRSIGEMPHLGLVDLSGNRLAGTIPDTFSNLTQLRRL 408

Query: 645 DISNNRFAGKFP 680
            + +N  +G  P
Sbjct: 409 MLHHNHLSGDVP 420



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 22/68 (32%), Positives = 37/68 (54%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K+  V ++DL+ + +AG +P +LG    L   +++ N   G +P     L  L  LD+S 
Sbjct: 474 KMDMVLALDLSENALAGAVPAQLGGCVALEYLNLSGNALRGALPAPVAALPFLQVLDVSR 533

Query: 657 NRFAGKFP 680
           NR +G+ P
Sbjct: 534 NRLSGELP 541



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 21/66 (31%), Positives = 34/66 (51%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           R    I L  + I G +P  +  L +L   ++++N   G+IP +   L+ L  L +SNN 
Sbjct: 307 REFRQIHLEDNAITGAIPPSIAGLVNLTYLNLSNNMLNGSIPPEMSRLRRLERLYLSNNL 366

Query: 663 FAGKFP 680
            AG+ P
Sbjct: 367 LAGEIP 372



 Score = 37.7 bits (86), Expect = 0.19
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           ++L+++ + G +P E+  L  L   ++++N   G IP+    +  L  +D+S NR AG  
Sbjct: 336 LNLSNNMLNGSIPPEMSRLRRLERLYLSNNLLAGEIPRSIGEMPHLGLVDLSGNRLAGTI 395

Query: 678 P 680
           P
Sbjct: 396 P 396



>gb:AP003278_1827099 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0518F01.>gb:AP003330_1828010 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1085F01.
          Length = 1128

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 24/64 (37%), Positives = 41/64 (64%)
 Frame = +3

Query: 489  VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
            V ++D + + + G++PEE+ LL  L   +++SN+F GTI  +  +LK L  LD+S N  +
Sbjct: 933  VVNLDFSCNKLTGHIPEEIHLLIGLTNLNLSSNQFSGTIHDQIGDLKQLESLDLSYNELS 992

Query: 669  GKFP 680
            G+ P
Sbjct: 993  GEIP 996



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 42/134 (31%), Positives = 61/134 (45%), Gaps = 13/134 (9%)
 Frame = +3

Query: 318  LTFENDRIRNAYIALQAWKQAIISDPRNTTS-DWVGSDVCNY-------TGVFCAPAPDN 473
            L    ++I      +Q WKQ   SD  NT S D  GS + +        +G+F       
Sbjct: 766  LDLSGNKITGDLEQMQCWKQ---SDMTNTNSADKFGSSMLSLALNHNELSGIF------- 815

Query: 474  PKIRTVAS----IDLNHDDIAGYLPEELG-LLADLGVFHINSNRFCGTIPKKFKNLKILF 638
            P+    AS    +DL+H+   G LP+ L   + +L +  + SN F G IPK    L  L 
Sbjct: 816  PQFLQNASQLLFLDLSHNRFFGSLPKWLPERMPNLQILRLRSNIFHGHIPKNIIYLGKLH 875

Query: 639  ELDISNNRFAGKFP 680
             LDI++N  +G  P
Sbjct: 876  FLDIAHNNISGSIP 889



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 23/78 (29%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +3

Query: 450 FCAPAPD-NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNL 626
           F  PAP     +  +  +DL++++++G +P E+G + +L + ++N+N+F G +P     +
Sbjct: 466 FSGPAPSWIGTLGNLTILDLSYNNLSGPVPLEIGAV-NLKILYLNNNKFSGFVPLGIGAV 524

Query: 627 KILFELDISNNRFAGKFP 680
             L  L +S N F+G  P
Sbjct: 525 SHLKVLYLSYNNFSGPAP 542



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           L++++ +G  P  +G L +L +  ++ N F G +P    +L  L  LD+S NRF G
Sbjct: 532 LSYNNFSGPAPSWVGALGNLQILDLSHNSFSGPVPPGIGSLSNLTTLDLSYNRFQG 587



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 20/59 (33%), Positives = 34/59 (57%)
 Frame = +3

Query: 504 LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           LN++  +G++P  +G ++ L V +++ N F G  P     L  L  LD+S+N F+G  P
Sbjct: 508 LNNNKFSGFVPLGIGAVSHLKVLYLSYNNFSGPAPSWVGALGNLQILDLSHNSFSGPVP 566



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 3/70 (4%)
 Frame = +3

Query: 480 IRTVASID---LNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDI 650
           + TV+S+D   LN++   G++P E+G +++L    +  N F G  P     L  L  LD+
Sbjct: 426 LETVSSLDTLYLNNNKFNGFVPLEVGAVSNLKKLFLAYNTFSGPAPSWIGTLGNLTILDL 485

Query: 651 SNNRFAGKFP 680
           S N  +G  P
Sbjct: 486 SYNNLSGPVP 495



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
 Frame = +3

Query: 450 FCAPAPD-NPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK-KFKN 623
           F  PAP     +  +  +DL+H+  +G +P  +G L++L    ++ NRF G I K   ++
Sbjct: 537 FSGPAPSWVGALGNLQILDLSHNSFSGPVPPGIGSLSNLTTLDLSYNRFQGVISKDHVEH 596

Query: 624 LKILFELDISNN 659
           L  L  LD+S+N
Sbjct: 597 LSRLKYLDLSDN 608



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 13/43 (30%), Positives = 27/43 (62%)
 Frame = +3

Query: 480  IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIP 608
            ++ + S+DL++++++G +P  L  L  L   +++ N   GTIP
Sbjct: 978  LKQLESLDLSYNELSGEIPPSLSALTSLSHLNLSYNNLSGTIP 1020



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 23/131 (17%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVASIDLNHDD------ 518
           AL ++K +++ DP    S W G D C + GV C+    N     + +++L + +      
Sbjct: 39  ALLSFKASLL-DPSGRLSSWQGDDCCQWKGVRCSNRTGN-----IVALNLRNTNNFWYDF 92

Query: 519 ----------------IAGYLPEELGLLADLGVFHINSNRFCGT-IPKKFKNLKILFELD 647
                           + G L   L  L  L    ++ N F GT IP    + K L  L+
Sbjct: 93  YDADGLNLLRGGDLSLLGGELSSSLIALHHLRHLDLSCNFFNGTSIPVFMGSFKNLRYLN 152

Query: 648 ISNNRFAGKFP 680
           +S   F GK P
Sbjct: 153 LSWAGFGGKIP 163



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  ++L + +++G  P  +  +++L V  +  N+  G +P     L  L  L +SNN
Sbjct: 359 LNSLEELNLEYTNMSGTFPTFIHKMSNLSVLLLFGNKLVGELPAGVGALGNLKILALSNN 418

Query: 660 RFAGKFP 680
            F G  P
Sbjct: 419 NFRGLVP 425



>gb:AK118516_1816488 Arabidopsis thaliana At1g17230 mRNA for
           putative leucine-rich receptor protein kinase, complete
           cds, clone: RAFL19-74-O14.
          Length = 702

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/62 (35%), Positives = 37/62 (59%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           S++++H++++G +P+ LG L  L + ++N N+  G IP    NL  L   +ISNN   G 
Sbjct: 340 SLNISHNNLSGTIPDSLGNLQMLEILYLNDNKLSGEIPASIGNLMSLLICNISNNNLVGT 399

Query: 675 FP 680
            P
Sbjct: 400 VP 401



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 22/63 (34%), Positives = 37/63 (58%)
 Frame = +3

Query: 492 ASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAG 671
           A ID + + + G++P+E G + +L + H+  N   G IP++   L +L +LD+S NR  G
Sbjct: 26  AEIDFSENQLTGFIPKEFGHILNLKLLHLFENILLGPIPRELGELTLLEKLDLSINRLNG 85

Query: 672 KFP 680
             P
Sbjct: 86  TIP 88



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 22/65 (33%), Positives = 35/65 (53%)
 Frame = +3

Query: 486 TVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRF 665
           T+  +DL+ +  +GY+ +ELG L  L +  ++ NR  G IP  F +L  L EL +  N  
Sbjct: 264 TIQRLDLSGNKFSGYIAQELGQLVYLEILRLSDNRLTGEIPHSFGDLTRLMELQLGGNLL 323

Query: 666 AGKFP 680
           +   P
Sbjct: 324 SENIP 328



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 22/68 (32%), Positives = 41/68 (60%)
 Frame = +3

Query: 468 DNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELD 647
           D  K++ +  + L +++  G +P E+G L  +  F+I+SN+  G IPK+  +   +  LD
Sbjct: 210 DLGKLKNLERLRLANNNFTGEIPPEIGNLTKIVGFNISSNQLTGHIPKELGSCVTIQRLD 269

Query: 648 ISNNRFAG 671
           +S N+F+G
Sbjct: 270 LSGNKFSG 277



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 21/82 (25%), Positives = 42/82 (51%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG      P+   +  +   +++ + + G++P+ELG    +    ++ N+F G I ++
Sbjct: 226 NFTGEI---PPEIGNLTKIVGFNISSNQLTGHIPKELGSCVTIQRLDLSGNKFSGYIAQE 282

Query: 615 FKNLKILFELDISNNRFAGKFP 680
              L  L  L +S+NR  G+ P
Sbjct: 283 LGQLVYLEILRLSDNRLTGEIP 304



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 18/67 (26%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ + +++L+ + ++G +  +LG L +L    + +N F G IP +  NL  +   +IS+N
Sbjct: 190 LQNLTALELHQNWLSGNISADLGKLKNLERLRLANNNFTGEIPPEIGNLTKIVGFNISSN 249

Query: 660 RFAGKFP 680
           +  G  P
Sbjct: 250 QLTGHIP 256



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/54 (37%), Positives = 31/54 (57%)
 Frame = +3

Query: 519 IAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + G +P ELG L  L    ++ NR  GTIP++ + L  L +L + +N+  GK P
Sbjct: 59  LLGPIPRELGELTLLEKLDLSINRLNGTIPQELQFLPYLVDLQLFDNQLEGKIP 112



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 20/66 (30%), Positives = 32/66 (48%)
 Frame = +3

Query: 483 RTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNR 662
           +++  + L  + + G LP EL  L +L    ++ N   G I      LK L  L ++NN 
Sbjct: 167 KSLTKLMLGDNQLTGSLPIELFNLQNLTALELHQNWLSGNISADLGKLKNLERLRLANNN 226

Query: 663 FAGKFP 680
           F G+ P
Sbjct: 227 FTGEIP 232



 Score = 36.2 bits (82), Expect = 0.55
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           +D++ + ++G +P        L +  + SN+  G IP+  K  K L +L + +N+  G  
Sbjct: 124 LDMSANSLSGPIPAHFCRFQTLILLSLGSNKLSGNIPRDLKTCKSLTKLMLGDNQLTGSL 183

Query: 678 P 680
           P
Sbjct: 184 P 184



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 17/56 (30%), Positives = 27/56 (48%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + + G +P E+G L D      + N+  G IPK+F ++  L  L +  N   G  P
Sbjct: 9   NQLTGEIPREIGNLIDAAEIDFSENQLTGFIPKEFGHILNLKLLHLFENILLGPIP 64



>gb:AC087553_1734111 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 685

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 13/115 (11%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWV-------------GSDVCNYTGVFCAPAPDNPKIRTVASIDLNHD 515
           +A + D  N  +DW              G   CN++ V C+      K   V+ +DL H 
Sbjct: 101 KAALHDTANVLADWNAGSGGVVVAGGGGGGGPCNWSMVTCS------KTGHVSVLDLAHR 154

Query: 516 DIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +++G L   +G L  L +  +  N   G IP     LK+L  LD++ N F G  P
Sbjct: 155 NLSGTLSPAIGKLRRLRLLFLQHNAISGPIPDTIGRLKVLQTLDLAYNHFTGTIP 209



>gb:ZMA400870_1731518 Zea mays partial mRNA for somatic
           embryogenesis receptor-like kinase 3, (serk3 gene).
          Length = 541

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 2/110 (1%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWVGSDV--CNYTGVFCAPAPDNPKIRTVASIDLNHDDIAGY 530
           AL + +Q++I D  N    W  + V  C +  V C    DN  IR    +DL +  ++G 
Sbjct: 10  ALYSLRQSLI-DTNNVLQSWDSTLVNPCTWFHVTCNS--DNSVIR----VDLGNAQLSGV 62

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           L  +LG L +L    + SN+  G IP +  NL  L  LD+  + F+G  P
Sbjct: 63  LVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMDNFSGNIP 112



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/69 (33%), Positives = 37/69 (53%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  + S+DL  D+ +G +P+ LG L  L    +N+N   G IP    N+  L  L
Sbjct: 89  PELGNLTNLVSLDLYMDNFSGNIPDSLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVL 148

Query: 645 DISNNRFAG 671
           D+S+N  +G
Sbjct: 149 DLSSNNLSG 157



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P   +++ +  ++L  + I+G +P ELG L +L    +  + F G IP    NL  L  L
Sbjct: 65  PQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVSLDLYMDNFSGNIPDSLGNLLKLRFL 124

Query: 645 DISNNRFAGKFP 680
            ++NN   G  P
Sbjct: 125 RLNNNSLVGPIP 136



>gb:U42445_1726335 Lycopersicon pimpinellifolium leucine rich repeat
           protein Cf-2.2 gene, complete cds.
          Length = 1112

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/67 (32%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ ++L ++ ++G +PEE+G L  L V  ++ N   G+IP  F NL  L  L++ NN
Sbjct: 502 LNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNN 561

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 562 QLSGSIP 568



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +3

Query: 465 PDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFEL 644
           P+   +  +  +DLN++ I+G +P ++GLLA L +  I  N+  G IPK+   L+ L +L
Sbjct: 113 PEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKL 172

Query: 645 DISNNRFAGKFP 680
            +  N  +G  P
Sbjct: 173 SLGINFLSGSIP 184



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/64 (35%), Positives = 36/64 (56%)
 Frame = +3

Query: 489 VASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFA 668
           +A + L  + +A  +PEE+G L  L V  ++ N   G+IP  F NL  L  L++ NN+ +
Sbjct: 457 LAFLFLYENQLASSVPEEIGYLRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLS 516

Query: 669 GKFP 680
           G  P
Sbjct: 517 GSIP 520



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L  + ++G +PEE+G L  L V  ++ N   G+IP    NLK L  L++ NN
Sbjct: 286 LNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNN 345

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 346 QLSGSIP 352



 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/67 (29%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  + L  + ++G +P  +G L +L   ++ +N+  G+IP++   L+ L ELD+S+N
Sbjct: 166 LRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDN 225

Query: 660 RFAGKFP 680
              G  P
Sbjct: 226 ALNGSIP 232



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 10/112 (8%)
 Frame = +3

Query: 375 QAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNP----------KIRTVASIDLNHDDIA 524
           QA+I +  N   + + S VCN T +     P N            I  +  + ++ +  +
Sbjct: 650 QALILNDNNLIGE-IPSSVCNLTSLEVLYMPRNNLKGKVPQCLGNISNLQVLSMSSNSFS 708

Query: 525 GYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           G LP  +  L  L +     N   G IP+ F N+  L   D+ NN+ +G  P
Sbjct: 709 GELPSSISNLTSLQILDFGRNNLEGAIPQCFGNISSLEVFDMQNNKLSGTLP 760



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 19/67 (28%), Positives = 40/67 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           ++ ++ ++L ++ ++G +P  LG L +L + ++ +N+  G+IP    NL  L  L + NN
Sbjct: 334 LKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNN 393

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 394 QLSGSIP 400



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L ++ ++G +PEE+G L+ L    + +N   G IP  F N++ L  L +++N
Sbjct: 598 LNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNNSLNGLIPASFGNMRNLQALILNDN 657

Query: 660 RFAGKFP 680
              G+ P
Sbjct: 658 NLIGEIP 664



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 20/67 (29%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ ++L ++ ++G +PEE+G L  L    ++ N   G+IP    NL  L  L + NN
Sbjct: 550 LNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNN 609

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 610 QLSGSIP 616



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 20/67 (29%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P  LG + +L    +  N+  G+IP++   L+ L  LD+S N
Sbjct: 214 LRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGNQLSGSIPEEICYLRSLTYLDLSEN 273

Query: 660 RFAGKFP 680
              G  P
Sbjct: 274 ALNGSIP 280



 Score = 42.4 bits (98), Expect = 0.008
 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 20/128 (15%)
 Frame = +3

Query: 357 ALQAWKQAIISDPRNTTSDWV-GSDVC-NYTGVFCAPAPDNPKIRTVASI---------- 500
           AL  WK    +   +  + W+  S+ C ++ GV C     N    T AS+          
Sbjct: 33  ALLKWKATFKNQNNSFLASWIPSSNACKDWYGVVCFNGRVNTLNITNASVIGTLYAFPFS 92

Query: 501 --------DLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
                   DL+ ++I G +P E+G L +L    +N+N+  GTIP +   L  L  + I +
Sbjct: 93  SLPSLENLDLSKNNIYGTIPPEIGNLTNLVYLDLNNNQISGTIPPQIGLLAKLQIIRIFH 152

Query: 657 NRFAGKFP 680
           N+  G  P
Sbjct: 153 NQLNGFIP 160



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L ++ ++G +P  LG L +L + ++ +N+  G+IP    NL  L  L + NN
Sbjct: 358 LNNLSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNN 417

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 418 QLSGSIP 424



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 36/61 (59%)
 Frame = +3

Query: 498  IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
            ++++H+ + GY+P  LG L+ L    ++ N+  G IP++  +L  L  L++S+N   G  
Sbjct: 933  LNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCI 992

Query: 678  P 680
            P
Sbjct: 993  P 993



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 17/67 (25%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           + ++  +DL+++ I G++P   G +++L    +  N+   ++P++   L+ L  LD+S N
Sbjct: 430 LSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYLRSLNVLDLSEN 489

Query: 660 RFAGKFP 680
              G  P
Sbjct: 490 ALNGSIP 496



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P   G L +L   ++ +N+  G+IP++   L+ L  LD+S N
Sbjct: 478 LRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNVLDLSEN 537

Query: 660 RFAGKFP 680
              G  P
Sbjct: 538 ALNGSIP 544



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 20/67 (29%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L ++ ++G +P  LG L +L   ++ +N+  G+IP++   L  L  LD+SNN
Sbjct: 382 LNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNN 441

Query: 660 RFAGKFP 680
              G  P
Sbjct: 442 SINGFIP 448



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 20/67 (29%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P  LG L +L    +  N+  G+IP++   L+ L  L +S N
Sbjct: 262 LRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIPEEIGYLRSLNVLGLSEN 321

Query: 660 RFAGKFP 680
              G  P
Sbjct: 322 ALNGSIP 328



 Score = 40.4 bits (93), Expect = 0.029
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKF 677
           I + H+ + G++P+E+G L  L    +  N   G+IP    NL  L  L + NN+ +G  
Sbjct: 148 IRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLSGSIPASVGNLNNLSFLYLYNNQLSGSI 207

Query: 678 P 680
           P
Sbjct: 208 P 208



 Score = 40.0 bits (92), Expect = 0.038
 Identities = 19/67 (28%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  + L+ + + G +P  LG L +L + ++ +N+  G+IP++   L  L  L + NN
Sbjct: 574 LRSLNDLGLSENALNGSIPASLGNLNNLSMLYLYNNQLSGSIPEEIGYLSSLTYLSLGNN 633

Query: 660 RFAGKFP 680
              G  P
Sbjct: 634 SLNGLIP 640



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 19/67 (28%), Positives = 38/67 (56%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  +DL+ + + G +P   G L +L   ++ +N+  G+IP++   L+ L +L +S N
Sbjct: 526 LRSLNVLDLSENALNGSIPASFGNLNNLSRLNLVNNQLSGSIPEEIGYLRSLNDLGLSEN 585

Query: 660 RFAGKFP 680
              G  P
Sbjct: 586 ALNGSIP 592



 Score = 39.7 bits (91), Expect = 0.049
 Identities = 20/67 (29%), Positives = 37/67 (55%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +R++  + L+ + + G +P  LG L +L   ++ +N+  G+IP    NL  L  L + NN
Sbjct: 310 LRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNNLSMLYLYNN 369

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 370 QLSGSIP 376



 Score = 39.3 bits (90), Expect = 0.065
 Identities = 19/67 (28%), Positives = 36/67 (53%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L ++ ++G +PEE+G L+ L    +++N   G IP  F N+  L  L +  N
Sbjct: 406 LNNLSRLYLYNNQLSGSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYEN 465

Query: 660 RFAGKFP 680
           + A   P
Sbjct: 466 QLASSVP 472



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           +  ++ + L ++ ++G +PEE+  L  L    ++ N   G+IP    N+  L  L +  N
Sbjct: 190 LNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNNLSFLFLYGN 249

Query: 660 RFAGKFP 680
           + +G  P
Sbjct: 250 QLSGSIP 256



 Score = 33.9 bits (76), Expect = 2.7
 Identities = 17/56 (30%), Positives = 28/56 (50%)
 Frame = +3

Query: 513 DDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           + ++G +PEE+  L  L    ++ N   G+IP    NL  L  L +  N+ +G  P
Sbjct: 249 NQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLSGSIP 304



 Score = 33.5 bits (75), Expect = 3.5
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNN 659
           I ++   D+ ++ ++G LP    +   L   +++ N     IP+   N K L  LD+ +N
Sbjct: 742 ISSLEVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPRSLDNCKKLQVLDLGDN 801

Query: 660 RFAGKFP 680
           +    FP
Sbjct: 802 QLNDTFP 808



>gb:LPJ002236_1685271 Lycopersicon pimpinellifolium Cf-9 resistance
           gene cluster.
          Length = 862

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)
 Frame = +3

Query: 360 LQAWKQAIISDPRNTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVAS---IDLNHDDIAGY 530
           LQA K+    D    T +++     NY         D   +R + S   I+L+ +   G+
Sbjct: 626 LQAMKKI---DESTRTPEYISDIYYNYLTTITTKGQDYDFVRILDSNMIINLSKNRFEGH 682

Query: 531 LPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
           +P  +G L  L   +++ N   G IP  F+NL +L  LD+S N+ +G+ P
Sbjct: 683 IPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSFNKISGEIP 732



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/59 (35%), Positives = 35/59 (59%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +D + + + G +P  +  L +L   +++SN   G+IP    +L  L ELD+SNN F+GK
Sbjct: 367 LDFSSNSLTGPIPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGK 425



 Score = 37.4 bits (85), Expect = 0.25
 Identities = 23/105 (21%), Positives = 42/105 (40%), Gaps = 11/105 (10%)
 Frame = +3

Query: 399 NTTSDWVGSDVCNYTGVFCAPAPDNPKIRTVA-----------SIDLNHDDIAGYLPEEL 545
           N  S  + S +CN   +       N    T+            S+DL+++ ++G +    
Sbjct: 465 NNISGRISSSICNLKMLILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSLSGTINTTF 524

Query: 546 GLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGKFP 680
            +        ++ N+  G +P+   N K L  LD+ NN+    FP
Sbjct: 525 SIGNSFRAISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFP 569



 Score = 37.0 bits (84), Expect = 0.32
 Identities = 17/62 (27%), Positives = 35/62 (56%)
 Frame = +3

Query: 495 SIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISNNRFAGK 674
           +++L+H+ + G++P     L+ L    ++ N+  G IP++  +L  L  L++S+N   G 
Sbjct: 695 TLNLSHNALEGHIPASFQNLSVLESLDLSFNKISGEIPQQLASLTFLEFLNLSHNHLVGC 754

Query: 675 FP 680
            P
Sbjct: 755 IP 756



 Score = 35.4 bits (80), Expect = 0.93
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +3

Query: 477 KIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLKILFELDISN 656
           K +T++ + L  + + G +P+ L L   L    ++ N   G I     NLK+L  LD+ +
Sbjct: 430 KSKTLSVVSLQQNQLEGPIPKSL-LNQSLFYLLLSHNNISGRISSSICNLKMLILLDLGS 488

Query: 657 NRFAGKFP 680
           N   G  P
Sbjct: 489 NNLEGTIP 496



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 459 PAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKKFKNLK-IL 635
           P P +   +++  + L+H++I+G +   +  L  L +  + SN   GTIP+    +K  L
Sbjct: 447 PIPKSLLNQSLFYLLLSHNNISGRISSSICNLKMLILLDLGSNNLEGTIPQCVGEMKENL 506

Query: 636 FELDISNNRFAG 671
           + LD+SNN  +G
Sbjct: 507 WSLDLSNNSLSG 518



 Score = 34.3 bits (77), Expect = 2.1
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +3

Query: 498 IDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK-----FKNLKILFELDISNNR 662
           +DL ++ +    P  LG L+ L +  + SN+  G I        F  L+I   LD+S+N 
Sbjct: 557 LDLGNNQLNDTFPNWLGYLSQLKILSLRSNKLHGPIKSSGNTNLFTRLQI---LDLSSNG 613

Query: 663 FAGKFP 680
           F+G  P
Sbjct: 614 FSGNLP 619



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 14/44 (31%), Positives = 26/44 (59%)
 Frame = +3

Query: 480 IRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPK 611
           +  + S+DL+ + I+G +P++L  L  L   +++ N   G IPK
Sbjct: 714 LSVLESLDLSFNKISGEIPQQLASLTFLEFLNLSHNHLVGCIPK 757



 Score = 32.3 bits (72), Expect = 7.9
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 4/86 (4%)
 Frame = +3

Query: 435 NYTGVFCAPAPDNPKIRTVASIDLNHDDIAGYLPEELGLLADLGVFHINSNRFCGTIPKK 614
           N+TG   +P     +  ++  +DL+H    G +P E+  L+ L V  I         P  
Sbjct: 127 NFTGSLISPKLG--EFSSLTHLDLSHSSFTGLIPSEISHLSKLHVLRIGDLNELSLGPHN 184

Query: 615 F----KNLKILFELDISNNRFAGKFP 680
           F    +NL  L EL++++   +   P
Sbjct: 185 FELLLENLTQLRELNLNSVNISSTIP 210


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 564,089,368
Number of Sequences: 1806583
Number of extensions: 9899263
Number of successful extensions: 37609
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 29468
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36431
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 38703569590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)