BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4187
         (562 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching.................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP002544_1822670 Arabidopsis thaliana genomic DNA, chromosome...    52   8e-06   
gb:AY133558_1581381 Arabidopsis thaliana At5g06230/MBL20_11 mRNA...    52   8e-06   
gb:AK176339_1818327 Arabidopsis thaliana mRNA for hypothetical p...    45   0.001   
gb:AC008153_1536588 Arabidopsis thaliana chromosome 3 BAC F24K9 ...    45   0.001   
gb:AP003252_1826348 Oryza sativa (japonica cultivar-group) genom...    35   0.62    
gb:AC135429_1742390 Oryza sativa (japonica cultivar-group) chrom...    35   0.62    
pir|T31067|T31067 BIR repeat containing ubiquitin-conjugating en...    33   3.1     Mus musculus [mouse]
sp|Q9NR09|BIR6_HUMAN|BIR6_HUMAN Baculoviral IAP repeat-containing protein 6...    33   3.1     Homo sapiens [man]
gb:AK033758_1163510 Mus musculus adult male epididymis cDNA, RIK...    33   4.0     
gb:AY059837_1564681 Arabidopsis thaliana unknown protein (F24F17...    32   8.9     
gb:AC068073_1540338 Arabidopsis thaliana chromosome 3 BAC F24F17...    32   8.9     


>gb:AP002544_1822670 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBL20.
          Length = 413

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +2

Query: 209 KEDYNVLPGDPAGKCTKEIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWNDE 364
           +  + V+ G P  K  KEI+   R++  +W +  WVGS VL+F++G+WWN++
Sbjct: 196 RSPFLVVIGRPPDKSPKEIKTTVRVDEFNWQSKRWVGSDVLVFNSGHWWNED 247



>gb:AY133558_1581381 Arabidopsis thaliana At5g06230/MBL20_11 mRNA,
           complete cds.>gb:AF361591_1791337 Arabidopsis thaliana
           AT5g06230/MBL20_11 mRNA, complete cds.
          Length = 372

 Score = 51.6 bits (122), Expect = 8e-06
 Identities = 20/52 (38%), Positives = 34/52 (65%)
 Frame = +2

Query: 209 KEDYNVLPGDPAGKCTKEIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWNDE 364
           +  + V+ G P  K  KEI+   R++  +W +  WVGS VL+F++G+WWN++
Sbjct: 155 RSPFLVVIGRPPDKSPKEIKTTVRVDEFNWQSKRWVGSDVLVFNSGHWWNED 206



>gb:AK176339_1818327 Arabidopsis thaliana mRNA for hypothetical
           protein, partial cds, clone:
           RAFL24-02-E17.>gb:AK176371_1818359 Arabidopsis thaliana
           mRNA for hypothetical protein, partial cds, clone:
           RAFL24-07-L24.>gb:AK176559_1818547 Arabidopsis thaliana
           mRNA for hypothetical protein, partial cds, clone:
           RAFL25-08-H24.
          Length = 417

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +2

Query: 224 VLPGDPAGKCTKEIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWNDE 364
           V+ G P      +++   R++  +W +  WVGS VL+F+ G+WWN++
Sbjct: 205 VVVGRPPENSPVDVKMTVRVDEFNWQSKKWVGSDVLVFNTGHWWNED 251



>gb:AC008153_1536588 Arabidopsis thaliana chromosome 3 BAC F24K9
           genomic sequence, complete sequence.
          Length = 427

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +2

Query: 224 VLPGDPAGKCTKEIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWNDE 364
           V+ G P      +++   R++  +W +  WVGS VL+F+ G+WWN++
Sbjct: 215 VVVGRPPENSPVDVKMTVRVDEFNWQSKKWVGSDVLVFNTGHWWNED 261



>gb:AP003252_1826348 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0446G04.
          Length = 522

 Score = 35.4 bits (80), Expect = 0.62
 Identities = 17/58 (29%), Positives = 29/58 (50%)
 Frame = +2

Query: 302 ADNWVGSFVLIFSAGYWWNDEVQNQSIGKKIAQTW*EYETLVRWSVSVTMLVNITNWI 475
           A NW G   L+F+   WW + + N  I +   Q+W E++ +VR      +L    +W+
Sbjct: 324 AQNWRGVDYLVFNTYIWWMNTL-NMKIMRPGGQSWEEHDEVVRIEAYRKVLTTWASWV 380



>gb:AC135429_1742390 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0636F09, complete sequence.
          Length = 281

 Score = 35.4 bits (80), Expect = 0.62
 Identities = 14/39 (35%), Positives = 22/39 (56%)
 Frame = +2

Query: 239 PAGKCTKEIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWW 355
           P     K ++   RL+R+   +  WV S VL+F+ G+WW
Sbjct: 235 PPRHAPKRVKSTLRLDRLDNISRKWVNSDVLVFNTGHWW 273



>pir|T31067|T31067 BIR repeat containing ubiquitin-conjugating enzyme
            BRUCE - mouse>gb:MMY17267_2124580 Mus musculus mRNA for
            ubiquitin conjugating enzyme.
          Length = 4845

 Score = 33.1 bits (74), Expect = 3.1
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 254  CIYLQDHQE-AHCNPLWLVFSLEVSGH 177
            C +L+DH+E   C P+WL   L++SGH
Sbjct: 1147 CPFLEDHKEDILCGPVWLASGLDLSGH 1173



>sp|Q9NR09|BIR6_HUMAN Baculoviral IAP repeat-containing protein 6
            (Ubiquitin-conjugating BIR-domain enzyme
            apollon).>gb:AF265555_1893782 Homo sapiens
            ubiquitin-conjugating BIR-domain enzyme APOLLON mRNA,
            complete cds.
          Length = 4829

 Score = 33.1 bits (74), Expect = 3.1
 Identities = 13/27 (48%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 254  CIYLQDHQE-AHCNPLWLVFSLEVSGH 177
            C +L+DH+E   C P+WL   L++SGH
Sbjct: 1143 CPFLEDHKEDILCGPVWLASGLDLSGH 1169



>gb:AK033758_1163510 Mus musculus adult male epididymis cDNA, RIKEN
           full-length enriched library, clone:9230104O11
           product:hypothetical protein, full insert sequence.
          Length = 168

 Score = 32.7 bits (73), Expect = 4.0
 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 1/85 (1%)
 Frame = -2

Query: 498 CVYVCFIVIQFVMLTSIVTETLHLTKVSYSHHV*AIFLPIDWFCTSSFHQYPALNIRTND 319
           C +V F+ +  ++L   ++    L + S S+++ A F P+ W  T S   YP  + + + 
Sbjct: 43  CCFVLFLFVLLIILFIYISNYFSLHRGSNSYNLYASFFPLSWMLTPS---YPTSDTKHSP 99

Query: 318 PTQLSAYQWILLSRNHFS-ISLVHL 247
              +S     +   +H S +S ++L
Sbjct: 100 FIFISCLSSFICENHHQSCLSCIYL 124



>gb:AY059837_1564681 Arabidopsis thaliana unknown protein (F24F17.6)
           mRNA, complete cds.>gb:BT008735_1639931 Arabidopsis
           thaliana At3g06080 gene, complete cds.
          Length = 346

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 9/34 (26%), Positives = 21/34 (61%)
 Frame = +2

Query: 260 EIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWND 361
           +++   +L+ + W +  W  + VL+ + G+WWN+
Sbjct: 248 KVKTSLKLDTMDWTSSKWRDADVLVLNTGHWWNE 281



>gb:AC068073_1540338 Arabidopsis thaliana chromosome 3 BAC F24F17
           genomic sequence, complete
           sequence.>gb:ATAC018907_1543696 Arabidopsis thaliana
           chromosome III BAC F28L1 genomic sequence, complete
           sequence.
          Length = 469

 Score = 31.6 bits (70), Expect = 8.9
 Identities = 9/34 (26%), Positives = 21/34 (61%)
 Frame = +2

Query: 260 EIEKWFRLNRIHW*ADNWVGSFVLIFSAGYWWND 361
           +++   +L+ + W +  W  + VL+ + G+WWN+
Sbjct: 248 KVKTSLKLDTMDWTSSKWRDADVLVLNTGHWWNE 281


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 580,948,718
Number of Sequences: 1806583
Number of extensions: 11964841
Number of successful extensions: 21808
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 21393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21802
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 25567795716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)