BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4154
         (1139 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T02131|T02131 hypothetical protein F8K4.6 - Arabidopsis thal...   583   e-165   Arabidopsis thaliana [mouse-ear cress]
gb:AP003930_1835406 Oryza sativa (japonica cultivar-group) genom...   449   e-125   
gb:AY738591_1433588 Oryctolagus cuniculus group VIB calcium-inde...   126   7e-28   
gb:AB044139_2045960 Mus musculus mRNA for iPLA2-2, complete cds.      126   9e-28   
gb:AK004621_1152462 Mus musculus adult male lung cDNA, RIKEN ful...   126   9e-28   
gb:AC005058_1874813 Homo sapiens BAC clone CTB-54D4 from 7q31, c...   124   4e-27   
gb:AX883913_1479531 Sequence 18818 from Patent EP1074617.>gb:AK0...   124   4e-27   
pir|JC7284|JC7284 phospholipase A2 (EC 3.1.1.4) 2, calcium-indep...   124   4e-27   Homo sapiens [man]
gb:AC084197_1205407 Caenorhabditis elegans cosmid Y73B6BL, compl...   120   4e-26   
gb:AY534337_1333929 Dictyocaulus viviparus isolate L3i75 putativ...   107   3e-22   
gb:AY534336_1333928 Dictyocaulus viviparus isolate L3i75 putativ...   107   3e-22   
gb:HSM805371_1187484 Homo sapiens mRNA; cDNA DKFZp761P18121 (fro...    92   1e-17   
gb:PFMAL13_1191628 Plasmodium falciparum 3D7 chromosome 13, *** ...    80   6e-14   
gb:BC077558_2560264 Xenopus laevis MGC83523 protein, mRNA (cDNA ...    79   2e-13   
gb:AY744674_1433637 Oryctolagus cuniculus group VIA2 phospholipa...    70   8e-11   
gb:BC081916_2108160 Rattus norvegicus phospholipase A2, group VI...    69   2e-10   
gb:BC052845_2101303 Mus musculus phospholipase A2, group VI, mRN...    69   2e-10   
gb:AF259401_2060778 Mus musculus Ca2+-independent phospholipase ...    69   2e-10   
sp|P97570|PA26_RAT|PA26_RAT 85 kDa calcium-independent phospholipase A2 (...    69   2e-10   Rattus norvegicus [brown rat]
sp|P97819|PA26_MOUSE|PA26_MOUSE 85 kDa calcium-independent phospholipase A2...    69   2e-10   Mus musculus [mouse]
gb:BC019364_2092861 Mus musculus RIKEN cDNA 1200006O19 gene, mRN...    68   4e-10   
pir|AG2093|AG2093 patatin-like protein [imported] - Nostoc sp. (...    67   5e-10   Nostoc sp. PCC 7120
gb:HSCIPLA17_2011488 Homo sapiens calcium-independent phospholip...    67   7e-10   
gb:AY122192_1301554 Drosophila melanogaster LD44515 full insert ...    67   9e-10   
gb:AE014296_1135642 Drosophila melanogaster chromosome 3L, compl...    67   9e-10   
gb:AE014296_1135641 Drosophila melanogaster chromosome 3L, compl...    67   9e-10   
gb:ASP269505_582802 Anabaena sp. ORF4 (partial), ORF3, ORF2, ORF...    66   1e-09   
gb:BC067375_2554708 Danio rerio zgc:77476, mRNA (cDNA clone MGC:...    65   2e-09   
gb:AX878200_1477342 Sequence 13105 from Patent EP1074617.>gb:AK0...    65   2e-09   
gb:BC051904_1984744 Homo sapiens phospholipase A2, group VI (cyt...    65   3e-09   
gb:AF102989_1883160 Homo sapiens Ca2+-independent phospholipase ...    65   3e-09   
gb:AF102988_1883159 Homo sapiens Ca2+-independent phospholipase ...    65   3e-09   
gb:AF064594_1880382 Homo sapiens calcium-independent phospholipa...    65   3e-09   
pir|T12503|T12503 hypothetical protein DKFZp434A102.1 - human (f...    65   3e-09   Homo sapiens [man]
sp|O60733|PA26_HUMAN|PA26_HUMAN 85 kDa calcium-independent phospholipase A2...    65   3e-09   Homo sapiens [man]
gb:AF106592_1241763 Caenorhabditis elegans cosmid D1037, complet...    62   2e-08   
pir|T33857|T33857 hypothetical protein D1037.5 - Caenorhabditis ...    62   2e-08   Caenorhabditis elegans [roundworm]
gb:AX876424_1476524 Sequence 11329 from Patent EP1074617.              62   3e-08   
gb:BX842627_1643877 Neurospora crassa DNA linkage group I BAC cl...    60   6e-08   
gb:AC006618_1203369 Caenorhabditis elegans cosmid C45B2, complet...    57   7e-08   
gb:BX321865_774847 Nitrosomonas europaea ATCC 19718, complete ge...    60   8e-08   
gb:NCX4G11_1690731 Neurospora crassa DNA linkage group V Cosmid ...    60   1e-07   
gb:AE017258_418324 Wolbachia endosymbiont of Drosophila melanoga...    59   1e-07   
pir|E82354|E82354 patatin-related protein VC0178 [imported] - Vi...    56   2e-06   Vibrio cholerae
gb:AY233333_600967 Escherichia coli strain ECOR31 high pathogeni...    55   3e-06   
gb:AY233333_600964 Escherichia coli strain ECOR31 high pathogeni...    53   1e-05   
gb:CP000011_868851 Burkholderia mallei ATCC 23344 chromosome 2, ...    53   1e-05   
gb:BX571966_794914 Burkholderia pseudomallei strain K96243, chro...    53   1e-05   
gb:CR925677_117438 Ehrlichia ruminantium str. Gardel, complete g...    52   2e-05   
gb:AC006662_1203591 Caenorhabditis elegans fosmid H23L24, comple...    52   2e-05   
pir|T22327|T22327 hypothetical protein F47A4.5 - Caenorhabditis ...    51   4e-05   Caenorhabditis elegans [roundworm]
gb:AC097279_1736583 Oryza sativa chromosome 3 BAC OSJNBa0093I13 ...    49   1e-04   
pir|G71615|G71615 phospholipase A2-like a/b fold hydrolase PFB04...    49   2e-04   Plasmodium falciparum 3D7
pir|T24442|T24442 hypothetical protein T04B2.5 - Caenorhabditis ...    49   2e-04   Caenorhabditis elegans [roundworm]
gb:AP003917_1835192 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
gb:AF061282_1765195 Sorghum bicolor 22 kDa kafirin cluster.            48   3e-04   
sp|P15478|PAT5_SOLTU|PAT5_SOLTU Patatin T5 precursor (Potato tuber protein)...    47   7e-04   Solanum tuberosum [potatoes]
gb:AY886543_1632010 Pichia pastoris Vac8 (VAC8) gene, complete cds.    47   0.001   
gb:AE017197_402560 Rickettsia typhi str. Wilmington complete gen...    47   0.001   
pir|B97815|B97815 patatin b1 precursor [imported] - Rickettsia c...    47   0.001   Rickettsia conorii
gb:AP004154_1838292 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:AP003349_1828520 Oryza sativa (japonica cultivar-group) genom...    46   0.002   
gb:AY087005_1572041 Arabidopsis thaliana clone 30438 mRNA, compl...    46   0.002   
gb:AY085946_1571008 Arabidopsis thaliana clone 1999 mRNA, comple...    46   0.002   
gb:ATAJ2596_1543885 Arabidopsis thaliana mRNA for patatin-like p...    46   0.002   
gb:AX298155_1465336 Sequence 1 from Patent WO0183788.>gb:AF15802...    46   0.002   
gb:AX146907_1462502 Sequence 7 from Patent WO0136468.                  46   0.002   
pir|T00989|T00989 hypothetical protein At2g26560 [imported] - Ar...    46   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T52294|T52294 patatin-like protein [imported] - Arabidopsis ...    46   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|H85437|H85437 patatin-like protein [imported] - Arabidopsis ...    46   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AJ617735_1812166 Hevea brasiliensis partial mRNA for putative...    45   0.002   
gb:AF113546_1769147 Hevea brasiliensis latex protein allergen He...    45   0.002   
pir|T10763|T10763 patatin-like latex allergen 1 - Para rubber tr...    45   0.002   Hevea brasiliensis [jebe]
pir|T10770|T10770 patatin-like latex allergen - Para rubber tree...    45   0.002   Hevea brasiliensis [jebe]
pir|T10765|T10765 patatin-like latex allergen 2 - Para rubber tr...    45   0.002   Hevea brasiliensis [jebe]
pir|G85437|G85437 patatin-like protein [imported] - Arabidopsis ...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:CEW07A8_1369009 Caenorhabditis elegans cosmid W07A8, complete...    45   0.003   
pir|T26261|T26261 hypothetical protein W07A8.2 - Caenorhabditis ...    45   0.003   Caenorhabditis elegans [roundworm]
gb:AF193067_1775543 Vigna unguiculata patatin-like protein mRNA,...    45   0.004   
gb:NTU68483_1691890 Nicotiana tabacum patatin homolog gene, part...    45   0.004   
gb:AB016875_1512962 Arabidopsis thaliana genomic DNA, chromosome...    45   0.004   
pir|S51596|S51596 patatin precursor, non-sucrose-inducible - Sol...    45   0.004   Solanum tuberosum [potatoes]
pir|T03841|T03841 patatin homolog - common tobacco>gb:NTU68484_1...    45   0.004   Nicotiana tabacum [American tobacco]
gb:AF158254_1773166 Nicotiana tabacum patatin-like protein 2 (PA...    44   0.005   
gb:AF061282_1765197 Sorghum bicolor 22 kDa kafirin cluster.            44   0.005   
gb:AX298157_1465337 Sequence 3 from Patent WO0183788.                  44   0.005   
gb:AX146911_1462503 Sequence 11 from Patent WO0136468.                 44   0.005   
pir|D71665|D71665 patatin b1 precursor (pat1) RP602 - Rickettsia...    44   0.005   Rickettsia prowazekii
gb:AP006849_1863089 Oryza sativa (japonica cultivar-group) genom...    44   0.006   
gb:AP003962_1835752 Oryza sativa (japonica cultivar-group) genom...    44   0.006   
gb:AF498099_1805905 Solanum chacoense patatin storage protein mR...    44   0.006   
gb:AF061282_1765193 Sorghum bicolor 22 kDa kafirin cluster.            44   0.006   
gb:POTPATATB_1701122 Potato patatin mRNA, complete cds, clone pP...    44   0.006   
gb:CR382131_1664035 Yarrowia lipolytica chromosome E of strain C...    44   0.006   
pir|A24142|A24142 patatin precursor - potato                           44   0.006   Solanum tuberosum [potatoes]
pir|S05593|S05593 patatin precursor (clone pPATB1) - potato (fra...    44   0.006   Solanum tuberosum [potatoes]
pir|B26017|B26017 patatin T58 precursor - potato                       44   0.006   Solanum tuberosum [potatoes]
sp|P11768|PAT3_SOLTU|PAT3_SOLTU Patatin class I precursor (Potato tuber pro...    44   0.006   Solanum tuberosum [potatoes]
sp|P15477|PAT2_SOLTU|PAT2_SOLTU Patatin B2 precursor (Potato tuber protein)...    44   0.006   Solanum tuberosum [potatoes]
sp|P15476|PAT1_SOLTU|PAT1_SOLTU Patatin B1 precursor (Potato tuber protein)...    44   0.006   Solanum tuberosum [potatoes]
sp|P07745|PAT0_SOLTU|PAT0_SOLTU Patatin precursor (Potato tuber protein).>g...    44   0.006   Solanum tuberosum [potatoes]
gb:AE016818_1748101 Ashbya gossypii (= Eremothecium gossypii) AT...    44   0.008   
gb:AP004154_1838288 Oryza sativa (japonica cultivar-group) genom...    43   0.010   
gb:CR380959_1653795 Candida glabrata strain CBS138 chromosome M ...    43   0.010   
gb:AY033231_1559430 Solanum cardiophyllum patatin mRNA, complete...    43   0.010   
pir|F85437|F85437 patatin-like protein [imported] - Arabidopsis ...    43   0.010   Arabidopsis thaliana [mouse-ear cress]
sp|P39968|VAC8_YEAST|VAC8_YEAST Vacuolar protein 8.>pir|S50446|S50446 VAC8 ...    43   0.010   Saccharomyces cerevisiae [brewer's yeast]
gb:CSPATATLP_1674081 Cucumis sativus mRNA for patatin-like prote...    43   0.014   
gb:AX298159_1465338 Sequence 5 from Patent WO0183788.>gb:AF15825...    43   0.014   
pir|T10260|T10260 patatin-like protein - cucumber (fragment)           43   0.014   Cucumis sativus [cucumbers]
gb:AE017341_1754182 Cryptococcus neoformans var. neoformans JEC2...    42   0.023   
gb:AP003816_1833765 Oryza sativa (japonica cultivar-group) genom...    42   0.030   
gb:BX842627_1643878 Neurospora crassa DNA linkage group I BAC cl...    42   0.030   
gb:BX842620_1643725 Neurospora crassa DNA linkage group V BAC co...    42   0.030   
gb:AE014296_1134939 Drosophila melanogaster chromosome 3L, compl...    42   0.030   
pir|T07592|T07592 class I patatin - potato>gb:STPOTAX_1722874 S....    42   0.030   Solanum tuberosum [potatoes]
gb:BC079724_2561262 Xenopus laevis cDNA clone MGC:83011 IMAGE:55...    41   0.051   
gb:BC076400_2559238 Danio rerio unc-45 (C. elegans) related, mRN...    40   0.067   
gb:AF330001_2487933 Danio rerio UNC45-related protein mRNA, comp...    40   0.067   
gb:AP003728_1832552 Oryza sativa (japonica cultivar-group) genom...    40   0.067   
gb:ATF28P10_1550409 Arabidopsis thaliana DNA chromosome 3, BAC c...    40   0.067   
pir|T06733|T06733 kinesin homolog F28P10.150 - Arabidopsis thaliana    40   0.067   Arabidopsis thaliana [mouse-ear cress]
gb:CR382135_1668395 Debaryomyces hansenii chromosome C of strain...    40   0.088   
gb:AK041744_1166095 Mus musculus 3 days neonate thymus cDNA, RIK...    39   0.15    
gb:AP003526_1830456 Oryza sativa (japonica cultivar-group) genom...    39   0.20    
gb:BT000869_1635124 Arabidopsis thaliana clone C103467 unknown p...    39   0.20    
pir|T08541|T08541 hypothetical protein F27B13.40 - Arabidopsis t...    39   0.20    Arabidopsis thaliana [mouse-ear cress]
gb:CR382121_1654751 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.26    
gb:AJ620477_527392 Angiococcus disciformis partial ORF16, ORF15,...    39   0.26    
gb:CR555306_107700 Azoarcus sp. EbN1 complete genome.                  39   0.26    
gb:AP004994_1846913 Oryza sativa (japonica cultivar-group) genom...    38   0.33    
gb:BX908798_831195 Parachlamydia-related symbiont UWE25, complet...    38   0.33    
gb:AJ620477_527391 Angiococcus disciformis partial ORF16, ORF15,...    38   0.33    
gb:AY056391_1563699 Arabidopsis thaliana AT3g63200/F16M2_50 mRNA...    38   0.44    
gb:AE016911_355402 Chromobacterium violaceum ATCC 12472 section ...    38   0.44    
gb:AE011613_274848 Leptospira interrogans serovar lai str. 56601...    38   0.44    
pir|T48109|T48109 hypothetical protein F16M2.50 - Arabidopsis th...    38   0.44    Arabidopsis thaliana [mouse-ear cress]
gb:SPBC354_1719976 S.pombe chromosome II cosmid c354.                  37   0.57    
pir|T40294|T40294 hypothetical protein SPBC354.14c - fission yea...    37   0.57    Schizosaccharomyces pombe
gb:BC039312_1982540 Homo sapiens armadillo repeat containing 3, ...    37   0.74    
gb:AL139815_1920815 Human DNA sequence from clone RP11-300B11 on...    37   0.74    
gb:AL139815_1920814 Human DNA sequence from clone RP11-300B11 on...    37   0.74    
gb:AK057389_1912014 Homo sapiens cDNA FLJ32827 fis, clone TESTI2...    37   0.74    
gb:AK004793_1152599 Mus musculus adult male lung cDNA, RIKEN ful...    37   0.74    
gb:AY596297_633777 Haloarcula marismortui ATCC 43049 chromosome ...    37   0.74    
gb:CR378672_96256 Photobacterium profundum SS9; segment 10/12.         37   0.74    
gb:AK024430_1909995 Homo sapiens mRNA for FLJ00019 protein, part...    36   1.3     
gb:AY217348_1939458 Homo sapiens FLJ00019-like protein mRNA, com...    36   1.7     
gb:AX877739_1477138 Sequence 12644 from Patent EP1074617.>gb:AK0...    36   1.7     
gb:CP000030_83309 Anaplasma marginale str. St. Maries, complete ...    36   1.7     
gb:BC041699_1983111 Homo sapiens armadillo repeat containing 8, ...    35   2.2     
gb:BC032661_1980602 Homo sapiens armadillo repeat containing 8, ...    35   2.2     
gb:AB070084_1870955 Macaca fascicularis testis cDNA clone:QtsA-1...    35   2.2     
gb:AP004667_1842958 Oryza sativa (japonica cultivar-group) genom...    35   2.2     
gb:CR860412_1184482 Pongo pygmaeus mRNA; cDNA DKFZp459B111 (from...    35   2.2     
gb:AE017250_416487 Treponema denticola ATCC 35405, section 5 of ...    35   2.2     
gb:AE016919_357676 Chromobacterium violaceum ATCC 12472 section ...    35   2.2     
pir|T12513|T12513 hypothetical protein DKFZp434A043.1 - human>gb...    35   2.2     Homo sapiens [man]
pir|F86373|F86373 protein T23E23.12 [imported] - Arabidopsis tha...    35   2.8     Arabidopsis thaliana [mouse-ear cress]
gb:BC080884_2561799 Xenopus tropicalis MGC79473 protein, mRNA (c...    35   3.7     
gb:BC076810_2559553 Xenopus laevis MGC83766 protein, mRNA (cDNA ...    35   3.7     
gb:AC004812_1874681 Homo sapiens PAC clone 267D11 from 12, compl...    35   3.7     
gb:BX294137_766397 Pirellula sp. strain 1 complete genome; segme...    35   3.7     
gb:AE017279_426100 Bacillus cereus ATCC 10987, section 16 of 18 ...    35   3.7     
gb:D86973_1995190 Human mRNA for KIAA0219 gene, partial cds.           34   4.8     
gb:AC091123_1734627 Oryza sativa chromosome 3 BAC OSJNBb0093E13 ...    34   4.8     
gb:AY596293_630857 Haloarcula marismortui ATCC 43049 plasmid pNG...    34   4.8     
gb:AE016921_358155 Chromobacterium violaceum ATCC 12472 section ...    34   4.8     
gb:BC014945_1974847 Homo sapiens armadillo repeat containing 5, ...    34   6.3     
gb:AY099742_1576767 Arabidopsis thaliana putative protein (At3g5...    34   6.3     
gb:AX880179_1478161 Sequence 15084 from Patent EP1074617.>gb:AK0...    34   6.3     
gb:AE017178_398005 Porphyromonas gingivalis W83 section 7 of 8 o...    34   6.3     
pir|T45896|T45896 hypothetical protein F4P12.260 - Arabidopsis t...    34   6.3     Arabidopsis thaliana [mouse-ear cress]
pir|T06725|T06725 hypothetical protein F28P10.70 - Arabidopsis t...    34   6.3     Arabidopsis thaliana [mouse-ear cress]
gb:AF466017_2496350 Xenopus laevis amadillo repeat-containing pr...    33   8.2     
gb:AY271826_1941553 Homo sapiens ZYG-11A early embryogenesis pro...    33   8.2     
gb:AF539794_1906426 Homo sapiens striated muscle UNC45 (UNC45) m...    33   8.2     
gb:AP005609_1854849 Oryza sativa (japonica cultivar-group) genom...    33   8.2     
gb:AY273870_605025 Pseudomonas aeruginosa PA14 pathogenicity isl...    33   8.2     
gb:CR378673_96475 Photobacterium profundum SS9; segment 11/12.         33   8.2     


>pir|T02131|T02131 hypothetical protein F8K4.6 - Arabidopsis
            thaliana>gb:AE005173_893856 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:F8K4_1678592 Arabidopsis thaliana chromosome
            1 BAC F8K4 sequence, complete sequence.
          Length = 1265

 Score =  583 bits (1502), Expect = e-165
 Identities = 297/387 (76%), Positives = 332/387 (85%), Gaps = 9/387 (2%)
 Frame = +2

Query: 2    ENQHVVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALA 181
            +NQHVVEQAC AL+SLA DV VAMQLMK DIM+P E VL+SS P+EVISVLQV+  LA  
Sbjct: 293  DNQHVVEQACVALSSLARDVGVAMQLMKCDIMKPTETVLKSSSPDEVISVLQVVVTLAFV 352

Query: 182  SDTVSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLL 361
            SD+VSQKMLTKD+LK+LK LCAHKNPEVQR AL AVGNLAFC ENR +L+  ESLRELL+
Sbjct: 353  SDSVSQKMLTKDMLKALKSLCAHKNPEVQRQALLAVGNLAFCLENRRILITSESLRELLM 412

Query: 362  RLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRIL 541
            RL  + EPRV+KAAARALAILGENE+LRR+I+ RQVPKQGLRIL+MDGGGMKGLATV+IL
Sbjct: 413  RLIVTPEPRVNKAAARALAILGENEILRRSIKGRQVPKQGLRILTMDGGGMKGLATVQIL 472

Query: 542  KEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLVFAEPVPKD 721
            KEIEKG+GK IHELFDLICGTSTGGMLA+ALG+KLM+LE+CEE+YK+LGKLVFAE VPKD
Sbjct: 473  KEIEKGSGKPIHELFDLICGTSTGGMLAIALGVKLMTLEQCEEIYKNLGKLVFAESVPKD 532

Query: 722  NEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIP 901
            NEAASWREKLDQLYKSSSQSFRVV+HGSKHSA++FERLL+E+C DEDGDLLIESAVK +P
Sbjct: 533  NEAASWREKLDQLYKSSSQSFRVVIHGSKHSANEFERLLKEMCADEDGDLLIESAVKNVP 592

Query: 902  KVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPX---------XXXXXXXXXXXXXXLKRNA 1054
            KVFVVSTLVSV PAQPFIFRNYQYP GTPE                          K++A
Sbjct: 593  KVFVVSTLVSVMPAQPFIFRNYQYPVGTPEMSYAFSDHSGGSTLTSSTASDQAGYYKQSA 652

Query: 1055 FIGSCKHHVWQAIRASSAAPYYLDDFS 1135
            F+GSCKH VWQAIRASSAAPYYLDDFS
Sbjct: 653  FMGSCKHQVWQAIRASSAAPYYLDDFS 679



>gb:AP003930_1835406 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1657_A07.
          Length = 1409

 Score =  449 bits (1154), Expect = e-125
 Identities = 253/407 (62%), Positives = 294/407 (72%), Gaps = 28/407 (6%)
 Frame = +2

Query: 2    ENQHVVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALA 181
            +N+HVVEQAC AL+SL SD+S AM L+K DIM+PIE VL+S   EE+ SVLQV+  L   
Sbjct: 455  DNRHVVEQACLALSSLGSDISSAMLLIKCDIMKPIEAVLKSFNEEELESVLQVVVTLTFV 514

Query: 182  SDTVSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLL 361
            SD V+QKMLTKDV               QRL+LFAVGNLAFC E R  L+  ESLR+LL+
Sbjct: 515  SDHVAQKMLTKDV---------------QRLSLFAVGNLAFCLETRRTLMHSESLRDLLI 559

Query: 362  RLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRIL 541
            RLT S E RVSKAAARALAILGENE LRRAIR R V K+GLRILSMDGGGMKGLATV+IL
Sbjct: 560  RLTLSQEKRVSKAAARALAILGENENLRRAIRGRPVAKKGLRILSMDGGGMKGLATVQIL 619

Query: 542  KEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDL------------ 685
            K+IE+GTGKRIHE+FDLICGTSTGGMLA+ALG+K M+L++CEE+Y  L            
Sbjct: 620  KQIEQGTGKRIHEMFDLICGTSTGGMLAMALGVKQMTLDQCEEIYTKLGECLLALTFHIF 679

Query: 686  ------------GKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFE 829
                        GKLVFAEP PKD EAA+W+EK+DQL+KSSSQSFRVVVHGSKHSADQFE
Sbjct: 680  LIVLPSELLVSPGKLVFAEPAPKD-EAATWKEKIDQLFKSSSQSFRVVVHGSKHSADQFE 738

Query: 830  RLLRELCTDEDGDLLIESAVKGIPK----VFVVSTLVSVSPAQPFIFRNYQYPPGTPEPX 997
            RLL+E+C DEDGDLLIESAVKGIPK       VS++++ SP+           P   +P 
Sbjct: 739  RLLKEMCADEDGDLLIESAVKGIPKYPPGTVEVSSVMTESPSIGSAGTPVSGAPVGIKP- 797

Query: 998  XXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFSD 1138
                          +KR AF+GSCKH +W+AIRASSAAPYYLDDFSD
Sbjct: 798  INTVGTAVSGAPVGIKRGAFMGSCKHRIWEAIRASSAAPYYLDDFSD 844



>gb:AY738591_1433588 Oryctolagus cuniculus group VIB
            calcium-independent phospholipase A2 mRNA, complete cds.
          Length = 786

 Score =  126 bits (317), Expect = 7e-28
 Identities = 87/268 (32%), Positives = 141/268 (52%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E L   LLRL    +  +  A    LA++G          V  V  +G+RIL++DGGG +
Sbjct: 407  ERLIPCLLRLRQMKDETLQAAVREILALIGY---------VDPVKGRGIRILTIDGGGTR 457

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K +H+LFD ICG STG +LA  LG+  + L++CEE+Y+ LG  +
Sbjct: 458  GVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHLPLDECEELYRKLGSDI 517

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F++ V       SW           S +F        + +  +E++L+E        L+I
Sbjct: 518  FSQNVIVGTVKMSW-----------SHAF--------YDSQTWEKILKERM---GSALMI 555

Query: 878  ESAVKGI-PKVFVVSTLVS-VSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
            E+A   + PKV  VST+V+  S  + F+FRNY + PG+                    ++
Sbjct: 556  ETARNPMCPKVAAVSTIVNRGSTPKAFVFRNYGHFPGS--------------------QS 595

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 596  HYLGGCQYKMWQAIRASSAAPGYFAEYA 623



>gb:AB044139_2045960 Mus musculus mRNA for iPLA2-2, complete cds.
          Length = 776

 Score =  126 bits (316), Expect = 9e-28
 Identities = 87/268 (32%), Positives = 138/268 (51%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E +   LLRL    +  +  A    LA++G          V  V  +G+RIL++DGGG +
Sbjct: 397  EKIIPYLLRLRQVKDETLQAAVREILALIGY---------VDPVKGRGIRILTIDGGGTR 447

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K IH+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 448  GVVALQTLRKLVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 507

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F + V       SW           S +F        + ++ +E++L++        L+I
Sbjct: 508  FTQNVIVGTVKMSW-----------SHAF--------YDSNTWEKILKDRI---GSALMI 545

Query: 878  ESAVK-GIPKVFVVSTLVSVSPA-QPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
            E+A     PKV  +ST+V+     + F+FRNY + PGT                     +
Sbjct: 546  ETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT--------------------NS 585

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 586  HYLGGCQYKMWQAIRASSAAPGYFAEYA 613



>gb:AK004621_1152462 Mus musculus adult male lung cDNA, RIKEN
            full-length enriched library, clone:1200006O19
            product:similar to CALCIUM-INDEPENDENT PHOSPHOLIPASE A2
            (MEMBRANE-ASSOCIATED CALCIUM- INDEPENDENT PHOSPHOLIPASE
            A2 GAMMA) [Homo sapiens], full insert sequence.
          Length = 803

 Score =  126 bits (316), Expect = 9e-28
 Identities = 87/268 (32%), Positives = 138/268 (51%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E +   LLRL    +  +  A    LA++G          V  V  +G+RIL++DGGG +
Sbjct: 397  EKIIPYLLRLRQVKDETLQAAVREILALIGY---------VDPVKGRGIRILTIDGGGTR 447

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K IH+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 448  GVVALQTLRKLVELTQKPIHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 507

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F + V       SW           S +F        + ++ +E++L++        L+I
Sbjct: 508  FTQNVIVGTVKMSW-----------SHAF--------YDSNTWEKILKDRI---GSALMI 545

Query: 878  ESAVK-GIPKVFVVSTLVSVSPA-QPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
            E+A     PKV  +ST+V+     + F+FRNY + PGT                     +
Sbjct: 546  ETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT--------------------NS 585

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 586  HYLGGCQYKMWQAIRASSAAPGYFAEYA 613



>gb:AC005058_1874813 Homo sapiens BAC clone CTB-54D4 from 7q31,
            complete sequence.
          Length = 380

 Score =  124 bits (311), Expect = 4e-27
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E +   LLRL    +  +  A    LA++G          V  V  +G+RILS+DGGG +
Sbjct: 1    ERIIPYLLRLRQIKDETLQAAVREILALIGY---------VDPVKGRGIRILSIDGGGTR 51

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K +H+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 52   GVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 111

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F++ V       SW           SQ++  ++     SA   E      C         
Sbjct: 112  FSQNVIVGTVKMSWSHAF-----YDSQTWENILKDRMGSALMIETARNPTC--------- 157

Query: 878  ESAVKGIPKVFVVSTLVS--VSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
                   PKV  VST+V+  ++P + F+FRNY + PG                      +
Sbjct: 158  -------PKVAAVSTIVNRGITP-KAFVFRNYGHFPGI--------------------NS 189

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 190  HYLGGCQYKMWQAIRASSAAPGYFAEYA 217



>gb:AX883913_1479531 Sequence 18818 from Patent
            EP1074617.>gb:AK024335_1909957 Homo sapiens cDNA FLJ14273
            fis, clone PLACE1004913.
          Length = 639

 Score =  124 bits (311), Expect = 4e-27
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E +   LLRL    +  +  A    LA++G          V  V  +G+RILS+DGGG +
Sbjct: 303  ERIIPYLLRLRQIKDETLQAAVREILALIGY---------VDPVKGRGIRILSIDGGGTR 353

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K +H+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 354  GVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 413

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F++ V       SW           SQ++  ++     SA   E      C         
Sbjct: 414  FSQNVIVGTVKMSWSHAF-----YDSQTWENILKDRMGSALMIETARNPTC--------- 459

Query: 878  ESAVKGIPKVFVVSTLVS--VSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
                   PKV  VST+V+  ++P + F+FRNY + PG                      +
Sbjct: 460  -------PKVAAVSTIVNRGITP-KAFVFRNYGHFPGI--------------------NS 491

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 492  HYLGGCQYKMWQAIRASSAAPGYFAEYA 519



>pir|JC7284|JC7284 phospholipase A2 (EC 3.1.1.4) 2,
            calcium-independent - human>gb:AB041261_1866918 Homo
            sapiens iPLA2 mRNA for calcium-independent phospholipase
            A2, complete cds.>gb:AF263613_1893722 Homo sapiens
            membrane-associated calcium-independent phospholipase A2
            gamma mRNA, complete cds.>gb:BC032999_1980746 Homo
            sapiens intracellular membrane-associated
            calcium-independent phospholipase A2 gamma, mRNA (cDNA
            clone MGC:26092 IMAGE:4829433), complete cds.
          Length = 782

 Score =  124 bits (311), Expect = 4e-27
 Identities = 86/268 (32%), Positives = 132/268 (49%), Gaps = 2/268 (0%)
 Frame = +2

Query: 338  ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
            E +   LLRL    +  +  A    LA++G          V  V  +G+RILS+DGGG +
Sbjct: 403  ERIIPYLLRLRQIKDETLQAAVREILALIGY---------VDPVKGRGIRILSIDGGGTR 453

Query: 518  GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
            G+  ++ L+++ + T K +H+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 454  GVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 513

Query: 698  FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELCTDEDGDLLI 877
            F++ V       SW           SQ++  ++     SA   E      C         
Sbjct: 514  FSQNVIVGTVKMSWSHAF-----YDSQTWENILKDRMGSALMIETARNPTC--------- 559

Query: 878  ESAVKGIPKVFVVSTLVS--VSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXXXXXXLKRN 1051
                   PKV  VST+V+  ++P + F+FRNY + PG                      +
Sbjct: 560  -------PKVAAVSTIVNRGITP-KAFVFRNYGHFPGI--------------------NS 591

Query: 1052 AFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
             ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 592  HYLGGCQYKMWQAIRASSAAPGYFAEYA 619



>gb:AC084197_1205407 Caenorhabditis elegans cosmid Y73B6BL, complete
            sequence.
          Length = 546

 Score =  120 bits (302), Expect = 4e-26
 Identities = 94/348 (27%), Positives = 168/348 (48%), Gaps = 13/348 (3%)
 Frame = +2

Query: 125  SRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAF 304
            S+ E  ++ L V     +  DTV  +  T+ + KS +   +      +  AL     ++ 
Sbjct: 78   SKVENPLNYLSVGTSKTIVGDTVKVESKTQIIQKSNENRVSRSEVTAKTRALVKKILISE 137

Query: 305  CSENRCVLVAPESLRELLL-----RLTASSEPRVSKAAARALAILGENEVLRRAIR---- 457
             S +R   +    L E ++     R+ A+ E ++  A    + I G N+ L+   R    
Sbjct: 138  TSTSRLTRI--RDLSEHIMQFPPTRMIAAQEQKLI-AELLEMVIYGSNDNLKEEARQCLT 194

Query: 458  ---VRQVPK-QGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLA 625
               V   PK +G+ +LS+DGGG +G+  + +L++IEK +GK+I ELFD+ICG STG ++A
Sbjct: 195  LIGVHPSPKGKGVHVLSIDGGGTRGMMGLEVLEKIEKLSGKKICELFDMICGVSTGSIIA 254

Query: 626  VALGIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGS 805
              L  K  S+++C EVY D+ K +F++                        S  +++  S
Sbjct: 255  ALLTAKGYSVKECREVYMDVSKRLFSQ-------------------GKFQGSMGLILKHS 295

Query: 806  KHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGT 985
             ++ + +  +L+++   ED  ++  S     P++ +VS++V++   QP+IFRNY +P G 
Sbjct: 296  YYNTNLWISILKQM-IGEDITMINTSRKLHTPRLAIVSSIVNLPTIQPYIFRNYDHPAG- 353

Query: 986  PEPXXXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDD 1129
                               + + + G   H +W AI+AS+AAP Y  +
Sbjct: 354  -------------------RDSHYRGGADHCLWTAIQASAAAPLYFSE 382



>gb:AY534337_1333929 Dictyocaulus viviparus isolate L3i75 putative
            calcium-independent phospholipase A2 isoform b mRNA,
            complete cds.
          Length = 459

 Score =  107 bits (268), Expect = 3e-22
 Identities = 65/221 (29%), Positives = 119/221 (53%)
 Frame = +2

Query: 467  VPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKL 646
            V  +G+ +LS+DGGG +GL  + +L+++EK +GK+I ELFD + G STG ++A  L  K 
Sbjct: 193  VKSRGINLLSIDGGGTRGLMGLEVLEQLEKISGKKICELFDHVVGVSTGSIIASLLIGKG 252

Query: 647  MSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQF 826
             ++E C  +Y D+ K +F++                      S    VV++ S +   ++
Sbjct: 253  YTVEDCRTIYVDVSKRLFSQ-------------------NRLSGVSGVVLNHSYYDTKKW 293

Query: 827  ERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXX 1006
             ++L+E   +E    LI+++ + +P++ +V+ +V+    QP+ FRNY+ P G        
Sbjct: 294  VKMLKETIGEE--LTLIDTSKESVPRLSIVAAIVNFPVIQPYAFRNYEPPAG-------- 343

Query: 1007 XXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDD 1129
                        + + + GS  H++W+AI+AS+AAP Y ++
Sbjct: 344  ------------RDSHYRGSTGHYLWKAIQASAAAPLYFEE 372



>gb:AY534336_1333928 Dictyocaulus viviparus isolate L3i75 putative
            calcium-independent phospholipase A2 isoform a mRNA,
            complete cds.
          Length = 552

 Score =  107 bits (268), Expect = 3e-22
 Identities = 65/221 (29%), Positives = 119/221 (53%)
 Frame = +2

Query: 467  VPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKL 646
            V  +G+ +LS+DGGG +GL  + +L+++EK +GK+I ELFD + G STG ++A  L  K 
Sbjct: 193  VKSRGINLLSIDGGGTRGLMGLEVLEQLEKISGKKICELFDHVVGVSTGSIIASLLIGKG 252

Query: 647  MSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQF 826
             ++E C  +Y D+ K +F++                      S    VV++ S +   ++
Sbjct: 253  YTVEDCRTIYVDVSKRLFSQ-------------------NRLSGVSGVVLNHSYYDTKKW 293

Query: 827  ERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXX 1006
             ++L+E   +E    LI+++ + +P++ +V+ +V+    QP+ FRNY+ P G        
Sbjct: 294  VKMLKETIGEE--LTLIDTSKESVPRLSIVAAIVNFPVIQPYAFRNYEPPAG-------- 343

Query: 1007 XXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDD 1129
                        + + + GS  H++W+AI+AS+AAP Y ++
Sbjct: 344  ------------RDSHYRGSTGHYLWKAIQASAAAPLYFEE 372



>gb:HSM805371_1187484 Homo sapiens mRNA; cDNA DKFZp761P18121 (from
           clone DKFZp761P18121).
          Length = 720

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 61/184 (33%), Positives = 93/184 (50%), Gaps = 2/184 (1%)
 Frame = +2

Query: 338 ESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMK 517
           E +   LLRL    +  +  A    LA++G          V  V  +G+RILS+DGGG +
Sbjct: 403 ERIIPYLLRLRQIKDETLQAAVREILALIGY---------VDPVKGRGIRILSIDGGGTR 453

Query: 518 GLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGKLV 697
           G+  ++ L+++ + T K +H+LFD ICG STG +LA  LG+  M L++CEE+Y+ LG  V
Sbjct: 454 GVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDV 513

Query: 698 FAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRELC--TDEDGDL 871
           F++ V       SW           SQ++  ++     SA   E      C     DG L
Sbjct: 514 FSQNVIVGTVKMSWSHAF-----YDSQTWENILKDRMGSALMIETARNPTCPKVAADGGL 568

Query: 872 LIES 883
           L+ +
Sbjct: 569 LLNN 572



>gb:PFMAL13_1191628 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2012

 Score = 80.5 bits (197), Expect = 6e-14
 Identities = 52/172 (30%), Positives = 90/172 (52%)
 Frame = +2

Query: 452  IRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVA 631
            I +++  K+ LRIL +DGGG++GL ++ ILK I     K I E FD+ICGTSTG ++++ 
Sbjct: 1117 IDLKKKKKRKLRILCLDGGGIRGLLSIEILKYINSNLNKNIFEYFDIICGTSTGAIISIL 1176

Query: 632  LGIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKH 811
            +G++   L + E +Y  L   +F     KD  A               ++ R ++  S +
Sbjct: 1177 IGLEKAHLNEIEFLYNLLINKIF----QKDTYAV--------------RNTRYLLKHSYY 1218

Query: 812  SADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNY 967
             ++    +L      ++  +   ++    P VF VST ++++P QP I +NY
Sbjct: 1219 DSNILNNILNSFF--KNIKMFHYNSDFYTPYVFTVSTQMNITPLQPVILKNY 1268



>gb:BC077558_2560264 Xenopus laevis MGC83523 protein, mRNA (cDNA clone
            MGC:83523 IMAGE:4757544), complete cds.
          Length = 756

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 66/214 (30%), Positives = 93/214 (43%), Gaps = 1/214 (0%)
 Frame = +2

Query: 485  RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
            R+L +DGGG++GL  +++L  IEK  G+ I ELFD + GTSTGG+LA+A+ +  M +E  
Sbjct: 429  RLLCLDGGGIRGLVLMQLLIAIEKAAGRPIRELFDWVSGTSTGGILALAI-VHGMPMESV 487

Query: 665  EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSK-HSADQFERLLR 841
              +Y  +   VF                                HGS+ + +   E  L+
Sbjct: 488  RCLYFRMKNEVF--------------------------------HGSRPYESGPLEEFLK 515

Query: 842  ELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXX 1021
            +    E G+    S V+  PKV V  TL    PA+  +FRNY  P    EP         
Sbjct: 516  K----EFGENTKMSDVRN-PKVIVTGTLSDRHPAELHLFRNYDPPETDHEPPYKSVASFR 570

Query: 1022 XXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYL 1123
                            +  VW A R+S AAP YL
Sbjct: 571  PVTT----------PAEQLVWHAARSSGAAPTYL 594



>gb:AY744674_1433637 Oryctolagus cuniculus group VIA2 phospholipase A2
            mRNA, complete cds.
          Length = 666

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 340  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 398

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 399  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 423

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 424  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPESVREP----------R 472

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 473  FSPNINLKPLTQPSDQLVWRAARSSGAAPTY 503



>gb:BC081916_2108160 Rattus norvegicus phospholipase A2, group VI,
            mRNA (cDNA clone MGC:93880 IMAGE:7112407), complete cds.
          Length = 807

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 481  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 539

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 540  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 564

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 565  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPEAVREP----------R 613

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 614  CTPNINLKPPTQPADQLVWRAARSSGAAPTY 644



>gb:BC052845_2101303 Mus musculus phospholipase A2, group VI, mRNA
            (cDNA clone MGC:60515 IMAGE:30054573), complete cds.
          Length = 752

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 426  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 484

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 485  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 509

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 510  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPEAVREP----------R 558

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 559  CNQNINLKPPTQPADQLVWRAARSSGAAPTY 589



>gb:AF259401_2060778 Mus musculus Ca2+-independent phospholipase A2
            long form mRNA, complete cds.>gb:BC057209_2102681 Mus
            musculus phospholipase A2, group VI, mRNA (cDNA clone
            MGC:68011 IMAGE:5329147), complete cds.
          Length = 807

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 481  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 539

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 540  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 564

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 565  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPEAVREP----------R 613

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 614  CNQNINLKPPTQPADQLVWRAARSSGAAPTY 644



>sp|P97570|PA26_RAT 85 kDa calcium-independent phospholipase A2 (EC
            3.1.1.4) (iPLA2) (CaI- PLA2) (Group VI phospholipase A2)
            (GVI PLA2).>gb:RNU51898_2137408 Rattus norvegicus
            Ca2+-independent phospholipase A2 mRNA, complete cds.
          Length = 751

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 425  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 483

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 484  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 508

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 509  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPEAVREP----------R 557

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 558  CTPNINLKPPTQPADQLVWRAARSSGAAPTY 588



>sp|P97819|PA26_MOUSE 85 kDa calcium-independent phospholipase A2 (EC
            3.1.1.4) (iPLA2) (CaI- PLA2) (Group VI phospholipase A2)
            (GVI PLA2).>gb:BC003487_2089254 Mus musculus
            phospholipase A2, group VI, mRNA (cDNA clone MGC:6311
            IMAGE:2811357), complete cds.>gb:MMU88624_2123798 Mus
            musculus 85 kDa calcium-independent phospholipase A2
            mRNA, complete cds.
          Length = 752

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/211 (29%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 426  LLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 484

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             VY  +   VF    P               Y+S                      L E 
Sbjct: 485  GVYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 509

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + VK  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 510  LKREFGEHTKMTDVKK-PKVMLTGTLSDRQPAELHLFRNYDAPEAVREP----------R 558

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 559  CNQNINLKPPTQPADQLVWRAARSSGAAPTY 589



>gb:BC019364_2092861 Mus musculus RIKEN cDNA 1200006O19 gene, mRNA
            (cDNA clone IMAGE:4010629), complete cds.
          Length = 292

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/170 (30%), Positives = 83/170 (48%), Gaps = 2/170 (1%)
 Frame = +2

Query: 632  LGIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKH 811
            LG+  M L++CEE+Y+ LG  VF + V       SW           S +F        +
Sbjct: 2    LGLFHMPLDECEELYRKLGSDVFTQNVIVGTVKMSW-----------SHAF--------Y 42

Query: 812  SADQFERLLRELCTDEDGDLLIESAVK-GIPKVFVVSTLVSVSPA-QPFIFRNYQYPPGT 985
             ++ +E++L++        L+IE+A     PKV  +ST+V+     + F+FRNY + PGT
Sbjct: 43   DSNTWEKILKDRIGSA---LMIETARNPACPKVAAISTIVNRGQTPKAFVFRNYGHFPGT 99

Query: 986  PEPXXXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
                                 + ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 100  --------------------NSHYLGGCQYKMWQAIRASSAAPGYFAEYA 129



>pir|AG2093|AG2093 patatin-like protein [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_683291 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 390

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGT----GKRIHELFDLICGTSTGGMLAVALGIKLMS 652
           +ILS+DGGG++G+ T RIL+E+E+      GK +HE FDLI GTSTG +L   +  K  S
Sbjct: 4   KILSLDGGGIRGVITARILQEVERQIQQQQGKSLHEYFDLIAGTSTGSILTAGIAAKKNS 63

Query: 653 LEKCEEVYKDLGKLVF 700
            E   ++Y++ GK +F
Sbjct: 64  SE-LVQLYQEQGKQIF 78



>gb:HSCIPLA17_2011488 Homo sapiens calcium-independent phospholipase
            A2 (PLA2G6) gene, exon 17 and complete cds.
          Length = 806

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 61/211 (28%), Positives = 87/211 (41%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 480  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 538

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 539  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 563

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+ IPKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 564  LKREFGEHTKMTDVR-IPKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 612

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 613  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 643



>gb:AY122192_1301554 Drosophila melanogaster LD44515 full insert cDNA.
          Length = 386

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 58/216 (26%), Positives = 91/216 (42%)
 Frame = +2

Query: 485  RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
            R+L +DGGG++GL  V++L EIEK +   I  +FD I GTSTGG+LA+ALG    ++ +C
Sbjct: 61   RLLCLDGGGIRGLVLVQMLLEIEKLSRTPIIHMFDWIAGTSTGGILALALGCG-KTMRQC 119

Query: 665  EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRE 844
              +Y  + +  F    P                               ++++ FE +L+ 
Sbjct: 120  MGLYLRMKEQCFVGSRP-------------------------------YNSEFFESILK- 147

Query: 845  LCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXX 1024
               D  G+  + + +K  PK+ V   +    P    +FRNY                   
Sbjct: 148  ---DNLGEFNVMTDIKH-PKIMVTGVMADRKPVDLHLFRNY----------TSASDILGI 193

Query: 1025 XXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDF 1132
                  +R       +  VW+A RA+ AAP Y   F
Sbjct: 194  VTPINNRRIPPPQPSEQLVWRAARATGAAPSYFRAF 229



>gb:AE014296_1135642 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE014296_1135643 Drosophila melanogaster
            chromosome 3L, complete sequence.>gb:AE014296_1135644
            Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003550_1215055 Drosophila melanogaster
            chromosome 3L, section 35 of 83 of the complete
            sequence.>gb:AE003550_1215056 Drosophila melanogaster
            chromosome 3L, section 35 of 83 of the complete
            sequence.>gb:AE003550_1215057 Drosophila melanogaster
            chromosome 3L, section 35 of 83 of the complete sequence.
          Length = 887

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 58/216 (26%), Positives = 91/216 (42%)
 Frame = +2

Query: 485  RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
            R+L +DGGG++GL  V++L EIEK +   I  +FD I GTSTGG+LA+ALG    ++ +C
Sbjct: 562  RLLCLDGGGIRGLVLVQMLLEIEKLSRTPIIHMFDWIAGTSTGGILALALGCG-KTMRQC 620

Query: 665  EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRE 844
              +Y  + +  F    P                               ++++ FE +L+ 
Sbjct: 621  MGLYLRMKEQCFVGSRP-------------------------------YNSEFFESILK- 648

Query: 845  LCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXX 1024
               D  G+  + + +K  PK+ V   +    P    +FRNY                   
Sbjct: 649  ---DNLGEFNVMTDIKH-PKIMVTGVMADRKPVDLHLFRNY----------TSASDILGI 694

Query: 1025 XXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDF 1132
                  +R       +  VW+A RA+ AAP Y   F
Sbjct: 695  VTPINNRRIPPPQPSEQLVWRAARATGAAPSYFRAF 730



>gb:AE014296_1135641 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003550_1215054 Drosophila melanogaster
            chromosome 3L, section 35 of 83 of the complete sequence.
          Length = 877

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 58/216 (26%), Positives = 91/216 (42%)
 Frame = +2

Query: 485  RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
            R+L +DGGG++GL  V++L EIEK +   I  +FD I GTSTGG+LA+ALG    ++ +C
Sbjct: 552  RLLCLDGGGIRGLVLVQMLLEIEKLSRTPIIHMFDWIAGTSTGGILALALGCG-KTMRQC 610

Query: 665  EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRE 844
              +Y  + +  F    P                               ++++ FE +L+ 
Sbjct: 611  MGLYLRMKEQCFVGSRP-------------------------------YNSEFFESILK- 638

Query: 845  LCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXX 1024
               D  G+  + + +K  PK+ V   +    P    +FRNY                   
Sbjct: 639  ---DNLGEFNVMTDIKH-PKIMVTGVMADRKPVDLHLFRNY----------TSASDILGI 684

Query: 1025 XXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDF 1132
                  +R       +  VW+A RA+ AAP Y   F
Sbjct: 685  VTPINNRRIPPPQPSEQLVWRAARATGAAPSYFRAF 720



>gb:ASP269505_582802 Anabaena sp. ORF4 (partial), ORF3, ORF2, ORF1,
           adpA gene, adpB gene, adpC gene, adpD gene, adpE gene
           and adpF gene.
          Length = 577

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 54/173 (31%), Positives = 84/173 (48%), Gaps = 13/173 (7%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL---------- 634
           +IL++DGGG++G+    IL EIEK T K+I  LFDLI G+S+GG+LA+ L          
Sbjct: 233 KILAIDGGGIRGIIPAIILTEIEKRTQKQIFSLFDLIAGSSSGGILALGLTKPRLDLAGS 292

Query: 635 ---GIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGS 805
               +   S E+  ++Y + G  +F EP         W + L QL     Q         
Sbjct: 293 DSPPVAQYSAEELLQIYLEYGAEIFYEPF--------WEQLLGQLEDIFVQ--------P 336

Query: 806 KHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
           K+S++  E ++++      GD  +E+ +K   +VFV S    +    P  F N
Sbjct: 337 KYSSEGREEIIKQYF----GDSPLENNLK---EVFVTS--YDIEQRIPIFFTN 380



>gb:BC067375_2554708 Danio rerio zgc:77476, mRNA (cDNA clone MGC:77476
            IMAGE:6523928), complete cds.
          Length = 818

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 61/227 (26%), Positives = 92/227 (40%), Gaps = 15/227 (6%)
 Frame = +2

Query: 485  RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
            R+L +DGGG+KGL  +++L  +EK  G+ I ELFD + GTSTGG+LA+A+ +   S+E  
Sbjct: 466  RLLCLDGGGIKGLVLIQLLIALEKEAGRPIRELFDWVSGTSTGGILALAI-VHGKSMEYL 524

Query: 665  EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLRE 844
              +Y  + + VF    P               Y+S                      L E
Sbjct: 525  RCLYFRMKEQVFKGSRP---------------YESGP--------------------LEE 549

Query: 845  LCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXX--- 1015
               +E G+    + V   P+V V S L    P +  +FRNY  P    +P          
Sbjct: 550  FLKNEFGENTKMTDVTH-PRVMVTSVLADRHPGELHLFRNYDPPALQRDPPYKSTATFQP 608

Query: 1016 ------------XXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                                 ++   +   +  VW+A R+S AAP Y
Sbjct: 609  LTVPQGWEDEDLLLVGYTRPPRKRRKVTDEEQLVWRAARSSGAAPTY 655



>gb:AX878200_1477342 Sequence 13105 from Patent
            EP1074617.>gb:AK002115_1908837 Homo sapiens cDNA FLJ11253
            fis, clone PLACE1008867.
          Length = 292

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 50/170 (29%), Positives = 77/170 (45%), Gaps = 2/170 (1%)
 Frame = +2

Query: 632  LGIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKH 811
            LG+  M L++CEE+Y+ LG  VF++ V       SW           SQ++  ++     
Sbjct: 2    LGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAF-----YDSQTWENILKDRMG 56

Query: 812  SADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVS--VSPAQPFIFRNYQYPPGT 985
            SA   E      C                PKV  VST+V+  ++P + F+FRNY + PG 
Sbjct: 57   SALMIETARNPTC----------------PKVAAVSTIVNRGITP-KAFVFRNYGHFPGI 99

Query: 986  PEPXXXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
                                 + ++G C++ +WQAIRASSAAP Y  +++
Sbjct: 100  --------------------NSHYLGGCQYKMWQAIRASSAAPGYFAEYA 129



>gb:BC051904_1984744 Homo sapiens phospholipase A2, group VI
            (cytosolic, calcium-independent), transcript variant 2,
            mRNA (cDNA clone MGC:60367 IMAGE:5175768), complete cds.
          Length = 752

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 426  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 484

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 485  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 509

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 510  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 558

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 559  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 589



>gb:AF102989_1883160 Homo sapiens Ca2+-independent phospholipase A2
            long isoform (iPLA2) mRNA, complete cds.
          Length = 806

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 480  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 538

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 539  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 563

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 564  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 612

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 613  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 643



>gb:AF102988_1883159 Homo sapiens Ca2+-independent phospholipase A2
            short isoform (iPLA2) mRNA, complete cds.
          Length = 752

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 426  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 484

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 485  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 509

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 510  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 558

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 559  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 589



>gb:AF064594_1880382 Homo sapiens calcium-independent phospholipase A2
            mRNA, complete cds.
          Length = 806

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 480  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 538

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 539  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 563

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 564  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 612

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 613  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 643



>pir|T12503|T12503 hypothetical protein DKFZp434A102.1 - human
            (fragment)
          Length = 851

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 525  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 583

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 584  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 608

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 609  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 657

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 658  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 688



>sp|O60733|PA26_HUMAN 85 kDa calcium-independent phospholipase A2 (EC
            3.1.1.4) (iPLA2) (CaI- PLA2) (Group VI phospholipase A2)
            (GVI PLA2).>gb:HSM800709_1185921 Homo sapiens mRNA; cDNA
            DKFZp434A102 (from clone
            DKFZp434A102).>gb:AY522921_1956075 Homo sapiens
            phospholipase A2, group VI (cytosolic,
            calcium-independent) (PLA2G6) gene, complete
            cds.>gb:BC036742_1982028 Homo sapiens phospholipase A2,
            group VI (cytosolic, calcium-independent), mRNA (cDNA
            clone MGC:45156 IMAGE:5166749), complete
            cds.>gb:CR456543_1992834 Homo sapiens PLA2G6 full length
            open reading frame (ORF) cDNA clone (cDNA clone
            C22ORF:pGEM.PLA2G6.V4).>gb:F116252S16_1995593 Homo
            sapiens calcium-independent phospholipase A2 gene, exon
            16 and complete cds.>gb:HS228A9_1997640 Human DNA
            sequence from clone CTA-228A9 on chromosome
            22q12.3-13.32, complete sequence.
          Length = 806

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 60/211 (28%), Positives = 86/211 (40%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 480  LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 538

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  +   VF    P               Y+S                      L E 
Sbjct: 539  GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 563

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
               E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP           
Sbjct: 564  LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP----------R 612

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                +            VW+A R+S AAP Y
Sbjct: 613  FNQNVNLRPPAQPSDQLVWRAARSSGAAPTY 643



>gb:AF106592_1241763 Caenorhabditis elegans cosmid D1037, complete
            sequence.
          Length = 525

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/216 (23%), Positives = 95/216 (43%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L++DGGG++ + T+++L  I+   G ++ E  D I GTS GG++ + L     ++E+  
Sbjct: 171  LLALDGGGIRAVITIQMLIHIDYLLGGKLVEKLDDIAGTSCGGVITLLLSTNNRNIEETR 230

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
            ++  D+   VF     K                             K+S++  E + R +
Sbjct: 231  KLLLDMRDRVFIRGADK--------------------------AVPKYSSNGMEYIARHV 264

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
             T ED  +   S++K    +  V+    V P Q  +FR+Y+  P  PE            
Sbjct: 265  TTWEDSKM---SSIKRHRAIVTVADTRMV-PPQLLLFRSYR--PEMPE------------ 306

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
                 +   F+   K  +W+ +R ++AAPY+ + F+
Sbjct: 307  --EACEHYKFLDPTKVELWKTLRCTTAAPYFFESFN 340



>pir|T33857|T33857 hypothetical protein D1037.5 - Caenorhabditis
            elegans
          Length = 468

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 51/216 (23%), Positives = 95/216 (43%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            +L++DGGG++ + T+++L  I+   G ++ E  D I GTS GG++ + L     ++E+  
Sbjct: 195  LLALDGGGIRAVITIQMLIHIDYLLGGKLVEKLDDIAGTSCGGVITLLLSTNNRNIEETR 254

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
            ++  D+   VF     K                             K+S++  E + R +
Sbjct: 255  KLLLDMRDRVFIRGADK--------------------------AVPKYSSNGMEYIARHV 288

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
             T ED  +   S++K    +  V+    V P Q  +FR+Y+  P  PE            
Sbjct: 289  TTWEDSKM---SSIKRHRAIVTVADTRMV-PPQLLLFRSYR--PEMPE------------ 330

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
                 +   F+   K  +W+ +R ++AAPY+ + F+
Sbjct: 331  --EACEHYKFLDPTKVELWKTLRCTTAAPYFFESFN 364



>gb:AX876424_1476524 Sequence 11329 from Patent EP1074617.
          Length = 401

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 51/169 (30%), Positives = 74/169 (43%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
           +L +DGGG+KGL  +++L  IEK +G    +LFD + GTSTGG+LA+A+ +   S+    
Sbjct: 246 LLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI-LHSKSMAYMR 304

Query: 668 EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
            +Y  +   VF    P               Y+S                      L E 
Sbjct: 305 GMYFRMKDEVFRGSRP---------------YESGP--------------------LEEF 329

Query: 848 CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEP 994
              E G+    + V+  PKV +  TL    PA+  +FRNY  P    EP
Sbjct: 330 LKREFGEHTKMTDVRK-PKVMLTGTLSDRQPAELHLFRNYDAPETVREP 377



>gb:BX842627_1643877 Neurospora crassa DNA linkage group I BAC clone
            B8J22.
          Length = 1294

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 9/222 (4%)
 Frame = +2

Query: 482  LRILSMDGGGMKGLATV----RILKEIEKGTG----KRIHELFDLICGTSTGGMLAVALG 637
            + +LS+DGGG++GL+ V    RI+K +++  G     +  E F ++ GTSTGG++A+ LG
Sbjct: 15   VNLLSLDGGGVRGLSEVVMLHRIMKRVQEIEGFKELPKPCEYFHIMGGTSTGGLVAILLG 74

Query: 638  IKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSA 817
               M+ E+    Y DLGK++F     K  E +                       +K+ A
Sbjct: 75   RLRMTTEEALAKYYDLGKVIFHRHNKKRLEIS-----------------------AKYGA 111

Query: 818  DQFERLLRELCTD-EDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEP 994
            +  E ++++L  +    +L+ + + +       V  + S     P  FR+Y         
Sbjct: 112  EALETVVKKLVQERRTSELMYDPSDEPTTCKAFVCAVTSAKIGPPRRFRSYS-------- 163

Query: 995  XXXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                             ++    +CK  +W+A RA+SAAP +
Sbjct: 164  ----------------SKDRKYSNCK--IWEAARATSAAPTF 187



>gb:AC006618_1203369 Caenorhabditis elegans cosmid C45B2, complete
           sequence.
          Length = 762

 Score = 57.4 bits (137), Expect(2) = 7e-08
 Identities = 31/69 (44%), Positives = 42/69 (60%)
 Frame = +2

Query: 428 ENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTS 607
           EN   RR      + K+   ILS+DGGGMKG+  +++LKEIEK  G +    F+ I GTS
Sbjct: 432 ENPSHRRCQNFPPLTKKDSVILSIDGGGMKGILALQLLKEIEKVVGNKFLRWFNHIGGTS 491

Query: 608 TGGMLAVAL 634
           TG M+ + L
Sbjct: 492 TGSMITLGL 500



 Score = 22.7 bits (47), Expect(2) = 7e-08
 Identities = 17/37 (45%), Positives = 19/37 (51%), Gaps = 3/37 (8%)
 Frame = +3

Query: 699 LLNLFRRTMKQHLGEKSWINSTRAHLRVSES---LYM 800
           LLN F R   Q LGEK+ I  +    RV  S   LYM
Sbjct: 536 LLNEFGRDTLQQLGEKNGIRISIPVARVDISPPLLYM 572



>gb:BX321865_774847 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 10/10.
          Length = 315

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 32/68 (47%), Positives = 47/68 (69%), Gaps = 2/68 (2%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLA--VALGIKLMSL 655
           LR+L++DGGG KG  T+ +LKEIE   G  +H+ FDL+ GTSTG ++A  +ALG    S+
Sbjct: 14  LRVLTLDGGGAKGFYTLGVLKEIEAMVGCPLHQKFDLVFGTSTGAIIASLIALG---HSV 70

Query: 656 EKCEEVYK 679
           +   E+Y+
Sbjct: 71  DSILELYR 78



>gb:NCX4G11_1690731 Neurospora crassa DNA linkage group V Cosmid
           contig X4G11.
          Length = 646

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/86 (40%), Positives = 51/86 (59%), Gaps = 13/86 (15%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIE-------KGTGKRIHEL------FDLICGTSTGGML 622
           LRILS+DGGG++G +   I++E+        +G   R  E+      FDLI GT TGG++
Sbjct: 16  LRILSLDGGGVRGYSMFLIIQELMHRTFVEIEGRAPRRSEIPKPCDHFDLIVGTGTGGLI 75

Query: 623 AVALGIKLMSLEKCEEVYKDLGKLVF 700
           A+ LG   + LE C+E+Y  L + VF
Sbjct: 76  AIMLGRLRLDLETCKELYVRLTRKVF 101



>gb:AE017258_418324 Wolbachia endosymbiont of Drosophila
           melanogaster, section 3 of 5 of the complete
           genome.>gb:AE017196_1058961 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 302

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 3/74 (4%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIK---LMSLE 658
           ILS+DGGG++G+    IL EIE+ T K I E+FDL+ GTSTGG++   L  K     S  
Sbjct: 5   ILSVDGGGIRGIIPAIILAEIEQRTRKTIAEIFDLMAGTSTGGIVVAGLCKKDKPQYSAN 64

Query: 659 KCEEVYKDLGKLVF 700
              E Y++ G  +F
Sbjct: 65  DLVEFYREYGPYIF 78



>pir|E82354|E82354 patatin-related protein VC0178 [imported] -
           Vibrio cholerae  (strain N16961 serogroup
           O1)>gb:AE004108_50584 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 16 of 251 of the
           complete chromosome.>gb:AE003852_1051358 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 355

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 33/85 (38%), Positives = 50/85 (58%), Gaps = 7/85 (8%)
 Frame = +2

Query: 473 KQGLRILSMDGGGMKGLATVRILKEIEK-------GTGKRIHELFDLICGTSTGGMLAVA 631
           K  +RILS++GGG +GL T+ +L EIE+         G ++ + FDLI GTS GG+LA+ 
Sbjct: 11  KNQVRILSLNGGGARGLFTISLLAEIERIIEEKQGINGFKVGDYFDLITGTSIGGILALG 70

Query: 632 LGIKLMSLEKCEEVYKDLGKLVFAE 706
           L     S  + E+V++     +F E
Sbjct: 71  LAYG-KSARELEDVFRKQAGYIFPE 94



>gb:AY233333_600967 Escherichia coli strain ECOR31 high
           pathogenicity island, complete sequence.
          Length = 293

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 2/56 (3%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLA--VALGIKL 646
           R+L++DGGG KG  T+ +LKEIE   G  +++ FDL+ GTSTG ++A  +ALG ++
Sbjct: 21  RVLALDGGGAKGFYTLGVLKEIEAMLGCPLYKRFDLVFGTSTGAIIAALIALGYEV 76



>gb:AY233333_600964 Escherichia coli strain ECOR31 high
           pathogenicity island, complete sequence.
          Length = 361

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 33/85 (38%), Positives = 48/85 (56%), Gaps = 7/85 (8%)
 Frame = +2

Query: 467 VPKQGLRILSMDGGGMKGLATVRILKEIEKGTGK-------RIHELFDLICGTSTGGMLA 625
           V   G+R+L ++GGG +G+ T+ +L EIE+           RI + FDLI GTS GG+LA
Sbjct: 11  VNDHGVRLLCLNGGGARGMFTISVLAEIERILASRHPDQEIRIGDYFDLIAGTSIGGILA 70

Query: 626 VALGIKLMSLEKCEEVYKDLGKLVF 700
           + L  K  S  + E V+ D    +F
Sbjct: 71  LGLA-KGKSARELECVFLDKANDIF 94



>gb:CP000011_868851 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 332

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 50/74 (67%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
           +ILS DGGG++GL T  +++++++ +G  I    D   GTSTGG++A+AL  + +S+ + 
Sbjct: 4   KILSCDGGGIRGLITALLIQDLDRRSG--ILAKADGFAGTSTGGLIALALA-RGVSISEV 60

Query: 665 EEVYKDLGKLVFAE 706
            +VY++ G  +F E
Sbjct: 61  VDVYRNRGSEIFQE 74



>gb:BX571966_794914 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 332

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 28/74 (37%), Positives = 50/74 (67%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
           +ILS DGGG++GL T  +++++++ +G  I    D   GTSTGG++A+AL  + +S+ + 
Sbjct: 4   KILSCDGGGIRGLITALLIQDLDRRSG--ILAKADGFAGTSTGGLIALALA-RGVSISEV 60

Query: 665 EEVYKDLGKLVFAE 706
            +VY++ G  +F E
Sbjct: 61  VDVYRNRGSEIFQE 74



>gb:CR925677_117438 Ehrlichia ruminantium str. Gardel, complete
           genome.>gb:CR925678_118393 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 314

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 25/52 (48%), Positives = 35/52 (67%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIK 643
           ILS+DGGG++G+    IL+ I+K   K I  +FDLI G+S G ++  AL IK
Sbjct: 5   ILSIDGGGVRGIIAATILQAIQKKINKPIANIFDLIAGSSVGSLIGAALCIK 56



>gb:AC006662_1203591 Caenorhabditis elegans fosmid H23L24, complete
            sequence.
          Length = 501

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 52/216 (24%), Positives = 91/216 (42%)
 Frame = +2

Query: 488  ILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCE 667
            ILS+DGGG++ +    IL  +E+  G+ +      I GTS GG++A ++G+ +  L    
Sbjct: 145  ILSLDGGGLRVVLQCAILLAVERELGEPLRNRIHWIAGTSCGGIMASSIGVGI-DLADAL 203

Query: 668  EVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLREL 847
             +Y  + K +F                       ++Q F       KHSA   E  L+E+
Sbjct: 204  RLYIIIRKRIFG---------------------GNNQKF------PKHSALGIETCLQEV 236

Query: 848  CTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXXXX 1027
                 G   + S      ++ V +  V+++P Q  +FR+Y     + E            
Sbjct: 237  M----GSKTLMSKCTA-HRLVVTTAKVTLAPPQLVLFRSYAPRIDSKE------------ 279

Query: 1028 XXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDFS 1135
                 ++  +    K  +W+AIR ++AAP Y   F+
Sbjct: 280  ----FEQLGYFNPNKILLWKAIRCTTAAPTYFPSFN 311



>pir|T22327|T22327 hypothetical protein F47A4.5 - Caenorhabditis
            elegans>gb:CEF47A4_1364061 Caenorhabditis elegans cosmid
            F47A4, complete sequence.
          Length = 1071

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 38/128 (29%), Positives = 60/128 (46%)
 Frame = +2

Query: 332  APESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGG 511
            A +   E L ++   +E    K    A   L   + L  +   R+  K  + ++SMDGGG
Sbjct: 698  AEDEYEETLQKIRIGNESDYEKTEFTASEKLNIQDTLDGS---RRGKKAKVNLISMDGGG 754

Query: 512  MKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKCEEVYKDLGK 691
            ++GL  ++ L  IE+  G  I + FD   GTSTG ++   L     SL + ++ Y  L  
Sbjct: 755  IRGLVIIQTLIAIEERLGDDIFKYFDWSAGTSTGSLIMAGLATG-KSLREMQQTYLLLKD 813

Query: 692  LVFAEPVP 715
             VF   +P
Sbjct: 814  RVFDGIMP 821



>gb:AC097279_1736583 Oryza sativa chromosome 3 BAC OSJNBa0093I13
           genomic sequence, complete sequence.
          Length = 432

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 31/91 (34%), Positives = 45/91 (49%), Gaps = 12/91 (13%)
 Frame = +2

Query: 470 PKQGLRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVA 631
           P Q + +L++DGGG++GL    IL  +E       G   R+ + FD I GTSTGG++   
Sbjct: 31  PGQRVTLLAIDGGGIRGLIPGTILAFLEARLQELDGPDARLADYFDCIAGTSTGGLITAM 90

Query: 632 L------GIKLMSLEKCEEVYKDLGKLVFAE 706
           L      G  L +       Y D G L+F +
Sbjct: 91  LAAPGDHGRPLFAASDINRFYLDNGPLIFPQ 121



>pir|G71615|G71615 phospholipase A2-like a/b fold hydrolase PFB0410c
           - malaria parasite (Plasmodium
           falciparum)>gb:AE001362_939324 Plasmodium falciparum 3D7
           chromosome 2 complete sequence.>gb:AE001393_1208635
           Plasmodium falciparum 3D7 chromosome 2 section 30 of 73
           of the complete sequence.
          Length = 679

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 27/83 (32%), Positives = 49/83 (59%), Gaps = 7/83 (8%)
 Frame = +2

Query: 473 KQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIH-------ELFDLICGTSTGGMLAVA 631
           K+ + ILS+DGGG+  ++T+ +L  +E    K I        + FD++CGTS GG++++A
Sbjct: 332 KKPVSILSLDGGGILTISTLLVLNRLEAELRKEIGSDDIKLIDCFDMVCGTSAGGLISLA 391

Query: 632 LGIKLMSLEKCEEVYKDLGKLVF 700
           L ++ + L+    ++    K VF
Sbjct: 392 L-LREIDLQDVSNMWPSTIKKVF 413



>pir|T24442|T24442 hypothetical protein T04B2.5 - Caenorhabditis
            elegans>gb:CET04B2_1367139 Caenorhabditis elegans cosmid
            T04B2, complete sequence.>gb:CEW01B6_1368773
            Caenorhabditis elegans cosmid W01B6, complete sequence.
          Length = 456

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 61/238 (25%), Positives = 96/238 (40%), Gaps = 8/238 (3%)
 Frame = +2

Query: 443  RRAIRVRQVPK-QGLRILSMDGGGMKGLATVRILKEIEKGT--GKRIHELFDLICGTSTG 613
            R  I++ +  K  G+  L +DGGGM+GL +V  L    +     + +  LFD   GTSTG
Sbjct: 109  RTPIQINRSKKVDGVMALCLDGGGMRGLVSVVCLLYASRRLLGDETLPNLFDWFIGTSTG 168

Query: 614  GMLAVALGIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKL--DQLYKSSSQSFR 787
             MLA+++ +  +S+ +C   Y D+   +F           S  ++L  DQ+   +    +
Sbjct: 169  SMLALSM-VNKISISECFFQYWDMKSQIFLR--------GSTVKRLLGDQVAVQTKNIDK 219

Query: 788  VVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTL-VSVSPAQPFIFRN 964
            V+                       GD      ++  P    +  L +S +PA+  +FRN
Sbjct: 220  VL-----------------------GDCFPTQTLQECPTRLTIPALDISTAPARLHVFRN 256

Query: 965  YQY--PPGTPEPXXXXXXXXXXXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYYLDDF 1132
            Y +  P G P                 L R            +A RASSAAP Y + F
Sbjct: 257  YSFTKPFGAP----------LNEDQDVLFR------------EAARASSAAPTYFEPF 292



>gb:AP003917_1835192 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1666_A04.
          Length = 405

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 47/173 (27%), Positives = 76/173 (43%), Gaps = 12/173 (6%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           +LS+DGGG++G+    IL  +EK      G   RI + FD++ GTSTGG+L   L     
Sbjct: 23  VLSIDGGGVRGIIPATILAFLEKELQKLDGPDARIADYFDVVAGTSTGGLLTAMLTAPNE 82

Query: 635 -GIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKH 811
               L + ++  + Y +    +F    P+ N   S   K+    +        +V G K+
Sbjct: 83  NNRPLFAADELAKFYIEHSPSIF----PQKNWVLS---KIAGTLR--------MVSGPKY 127

Query: 812 SADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQ 970
                  LLRE    + GD  ++ A+       VV     ++  QP IF  ++
Sbjct: 128 DGKYLHSLLRE----KLGDTRLDKALTN-----VVIPTFDIANLQPTIFSKFE 171



>gb:AF061282_1765195 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 422

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 12/91 (13%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVALGI- 640
           + ILS+DGGG++GL    I+  +E       G   RI + FD+I GTSTG +L   L   
Sbjct: 24  ITILSIDGGGIRGLIPATIIAHLEAKLQELDGPDARIADYFDVIAGTSTGALLTSMLAAP 83

Query: 641 -----KLMSLEKCEEVYKDLGKLVFAEPVPK 718
                 L S +     Y + G  +F +  PK
Sbjct: 84  DDNNRPLFSAKDLTTFYLENGPKIFPQKKPK 114



>sp|P15478|PAT5_SOLTU Patatin T5 precursor (Potato tuber
           protein).>pir|A26017|A26017 patatin T5 precursor -
           potato>gb:STPATG_1722844 Solanum tuberosum gene for
           patatin.
          Length = 386

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++  T  R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPATILEFLEGQLQEVDNNTDARLADYFDVIGGTSTGGLLTAMI 86



>gb:AY886543_1632010 Pichia pastoris Vac8 (VAC8) gene, complete cds.
          Length = 556

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 42/147 (28%), Positives = 71/147 (48%)
 Frame = +2

Query: 14  VVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTV 193
           V   AC+AL +LA + S  + ++    ++P+ R + S   E   + +  +  LA   D  
Sbjct: 102 VQRAACAALGNLAVNDSNKVLIVNMGGLEPLIRQMMSPNIEVQCNAVGCITNLA-TQDQN 160

Query: 194 SQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTA 373
             K+ T   L  L  L   K+  VQR A  A+ N+    ENR  LV   S+  +L++L +
Sbjct: 161 KSKIATSGALIPLTKLAKSKDLRVQRNATGALLNMTHSLENRQELVNAGSV-PILVQLLS 219

Query: 374 SSEPRVSKAAARALAILGENEVLRRAI 454
           S++P V      AL+ +  +E  R+ +
Sbjct: 220 STDPDVQYYCTTALSNIAVDEGNRKKL 246



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + +T+DVL+ + +L    + EVQR A  A+GNLA    N+ ++
Sbjct: 64  LQRSAALAFAEVTEKDVRPVTRDVLEPILILLQSSDAEVQRAACAALGNLAVNDSNKVLI 123

Query: 329 VAPESLRELLLRL 367
           V    L  L+ ++
Sbjct: 124 VNMGGLEPLIRQM 136



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 38/173 (21%), Positives = 77/173 (44%), Gaps = 1/173 (0%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD +  ++++++  +  +  +L S+    V++ +  +  +++        
Sbjct: 271 QATLALRNLASDANYQLEIVRAGGLPNLVTLLNSTHQPLVLAAVACIRNISI-HPLNEAL 329

Query: 203 MLTKDVLKSL-KLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASS 379
           ++    LK L  LL  + N E+Q  A+  + NLA  SE   + +      E   +L  +S
Sbjct: 330 IIDAGFLKPLVSLLDYNDNVEIQCHAVSTLRNLAASSERNRLALLESGAVEKCEKLVLNS 389

Query: 380 EPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
              V    +   AIL   + L+  +    + +  L + S + G + G A   +
Sbjct: 390 PISVQSEISACFAILALADDLKMKLLDSNIIEVLLPLTSSENGEVCGNAAAAL 442



>gb:AE017197_402560 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 498

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 8/93 (8%)
 Frame = +2

Query: 452 IRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVA 631
           + +    K  L IL  +GGG+KG   +  LK IE+ TGK   ++FD   GTS GG++ + 
Sbjct: 2   VDISNTKKSSLAIL--EGGGVKGEIHLEKLKVIEQITGKPTCKVFDFTGGTSVGGLILIL 59

Query: 632 L--------GIKLMSLEKCEEVYKDLGKLVFAE 706
           L        G  L S E+ +++++ +   +F E
Sbjct: 60  LNLPDPNNPGKPLFSAEQAQKLFEGMVHNIFPE 92



>pir|B97815|B97815 patatin b1 precursor [imported] - Rickettsia
           conorii (strain Malish 7)>gb:AE008646_239286 Rickettsia
           conorii str. Malish 7, section 78 of 114 of the complete
           genome.>gb:AE006914_1121404 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 490

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 8/87 (9%)
 Frame = +2

Query: 464 QVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL--- 634
           ++    + +   +GGG+KG   +  LK +E+ TGK   E+FD   GTS GG++++ L   
Sbjct: 3   EINNNKISLALFEGGGVKGNIHLEKLKIMEQITGKSTCEIFDFTGGTSVGGLISILLNLP 62

Query: 635 -----GIKLMSLEKCEEVYKDLGKLVF 700
                G  L S  + +E+++++   +F
Sbjct: 63  DPNNPGKPLFSAAQAQELFEEMAHNIF 89



>gb:AP004154_1838292 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1111_E05.
          Length = 431

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 21/94 (22%)
 Frame = +2

Query: 416 AILGENEVLRRAIRVRQVPKQG---------------LRILSMDGGGMKGLATVRILKEI 550
           A L  N V++RA+   Q+P                  + +LS+DGGG++G+    IL  +
Sbjct: 12  APLTVNPVVQRAVVGAQLPTTSPCRTPKSPPPSYGSIVTVLSIDGGGVRGIIPGTILASL 71

Query: 551 EK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           E+      G   RI + FD+I GTSTGG++   L
Sbjct: 72  EEKLQKLDGADARIADYFDVIAGTSTGGLVTAML 105



>gb:AP003349_1828520 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0674H09.>gb:AP003418_1829218 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0506A10.
          Length = 411

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/60 (45%), Positives = 35/60 (58%), Gaps = 8/60 (13%)
 Frame = +2

Query: 470 PKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLA 625
           P +G  + ILS+DGGG+KG+    IL  +E       G   RI   FD I GTSTGG++A
Sbjct: 10  PSKGNMITILSIDGGGVKGIIPAVILSFLESKLQELDGKDARIANYFDAIAGTSTGGLIA 69



>gb:AY087005_1572041 Arabidopsis thaliana clone 30438 mRNA, complete
           sequence.
          Length = 383

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           ILS+DGGG++G+    IL  +EK      G   R+ + FD+I GTSTGG++   L     
Sbjct: 21  ILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTVPDE 80

Query: 635 ---------GIKLMSLEKCEEVY-KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSF 784
                     I    LE C +++ +  G L     +PK                      
Sbjct: 81  TGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPK---------------------- 118

Query: 785 RVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
             ++ G K+S      LL +L     G+  +   +  I    V+ T   +   QP IF +
Sbjct: 119 --LLSGPKYSGKYLRNLLSKLL----GETRLHQTLTNI----VIPTF-DIKKLQPTIFSS 167

Query: 965 YQ 970
           YQ
Sbjct: 168 YQ 169



>gb:AY085946_1571008 Arabidopsis thaliana clone 1999 mRNA, complete
           sequence.
          Length = 405

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 14/183 (7%)
 Frame = +2

Query: 464 QVPKQG--LRILSMDGGGMKGLATVRIL----KEIEKGTGK--RIHELFDLICGTSTGGM 619
           Q P  G  + ILS+DGGG++GL    IL     E++K  G+  R+ + FD+I GTSTGG+
Sbjct: 9   QPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEEARLADYFDVIAGTSTGGL 68

Query: 620 LAVAL------GIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQS 781
           +   L      G  L +  + ++ Y +    +F    P+D+   S  +K   L KS    
Sbjct: 69  VTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIF----PQDHFPFSAAKK---LVKS---- 117

Query: 782 FRVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFR 961
               + G K+      + L +L   + GD  +   +       VV     +   QP IF 
Sbjct: 118 ----LTGPKYDG----KYLHQLIHAKLGDTKLSQTLTN-----VVIPTFDIKHLQPTIFS 164

Query: 962 NYQ 970
           +Y+
Sbjct: 165 SYE 167



>gb:ATAJ2596_1543885 Arabidopsis thaliana mRNA for patatin-like
           protein.
          Length = 410

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           ILS+DGGG++G+    IL  +EK      G   R+ + FD+I GTSTGG++   L     
Sbjct: 17  ILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTVPDE 76

Query: 635 ---------GIKLMSLEKCEEVY-KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSF 784
                     I    LE C +++ +  G L     +PK                      
Sbjct: 77  TGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPK---------------------- 114

Query: 785 RVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
             ++ G K+S      LL +L     G+  +   +  I    V+ T   +   QP IF +
Sbjct: 115 --LLSGPKYSGKYLRNLLSKLL----GETRLHQTLTNI----VIPTF-DIKKLQPTIFSS 163

Query: 965 YQ 970
           YQ
Sbjct: 164 YQ 165



>gb:AX298155_1465336 Sequence 1 from Patent
           WO0183788.>gb:AF158027_1773158 Nicotiana tabacum
           patatin-like protein 1 (PAT1) mRNA, complete cds.
          Length = 420

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 8/72 (11%)
 Frame = +2

Query: 443 RRAIRVRQVPKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLIC 598
           R+A ++ Q P  G  + +LS+DGGG++G+    IL  +E       G   R+ + FD+I 
Sbjct: 9   RKASQI-QPPTYGDLITVLSIDGGGIRGIIPATILSFLESQLQELDGNDARLADYFDVIA 67

Query: 599 GTSTGGMLAVAL 634
           GTSTGG++   L
Sbjct: 68  GTSTGGLVTAML 79



>gb:AX146907_1462502 Sequence 7 from Patent WO0136468.
          Length = 410

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 25/63 (39%), Positives = 39/63 (61%), Gaps = 8/63 (12%)
 Frame = +2

Query: 470 PKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLA 625
           P+ G  + +LS+DGGG++G+    IL  +E+      G   RI + FD++ GTSTGG++A
Sbjct: 15  PRHGRLVTVLSIDGGGVRGIIPGTILAFLEQKLQEFDGPDARIADYFDVVAGTSTGGLVA 74

Query: 626 VAL 634
             L
Sbjct: 75  AML 77



>pir|T00989|T00989 hypothetical protein At2g26560 [imported] -
           Arabidopsis thaliana>gb:AC002505_1530765 Arabidopsis
           thaliana chromosome 2 clone T9J22 map B68, complete
           sequence.>gb:AY062644_1565300 Arabidopsis thaliana
           similar to latex allergen (At2g26560; T9J22.23) mRNA,
           complete cds.>gb:AY093305_1575259 Arabidopsis thaliana
           similar to latex allergen (At2g26560) mRNA, complete
           cds.
          Length = 407

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 52/183 (28%), Positives = 83/183 (45%), Gaps = 14/183 (7%)
 Frame = +2

Query: 464 QVPKQG--LRILSMDGGGMKGLATVRIL----KEIEKGTGK--RIHELFDLICGTSTGGM 619
           Q P  G  + ILS+DGGG++GL    IL     E++K  G+  R+ + FD+I GTSTGG+
Sbjct: 11  QPPTYGNLVTILSIDGGGIRGLIPAVILGFLESELQKLDGEEARLADYFDVIAGTSTGGL 70

Query: 620 LAVAL------GIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQS 781
           +   L      G  L +  + ++ Y +    +F    P+D+   S  +K   L KS    
Sbjct: 71  VTAMLTAPNKEGRPLFAASEIKDFYLEQCPKIF----PQDHFPFSAAKK---LVKS---- 119

Query: 782 FRVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFR 961
               + G K+      + L +L   + GD  +   +       VV     +   QP IF 
Sbjct: 120 ----LTGPKYDG----KYLHQLIHAKLGDTKLSQTLTN-----VVIPTFDIKHLQPTIFS 166

Query: 962 NYQ 970
           +Y+
Sbjct: 167 SYE 169



>pir|T52294|T52294 patatin-like protein [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 410

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           ILS+DGGG++G+    IL  +EK      G   R+ + FD+I GTSTGG++   L     
Sbjct: 17  ILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTVPDE 76

Query: 635 ---------GIKLMSLEKCEEVY-KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSF 784
                     I    LE C +++ +  G L     +PK                      
Sbjct: 77  TGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPK---------------------- 114

Query: 785 RVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
             ++ G K+S      LL +L     G+  +   +  I    V+ T   +   QP IF +
Sbjct: 115 --LLSGPKYSGKYLRNLLSKLL----GETRLHQTLTNI----VIPTF-DIKKLQPTIFSS 163

Query: 965 YQ 970
           YQ
Sbjct: 164 YQ 165



>pir|H85437|H85437 patatin-like protein [imported] - Arabidopsis
           thaliana>gb:ATAP21_1543990 Arabidopsis thaliana DNA
           chromosome 4, ESSA I AP2 contig fragment No.
           1.>gb:ATCHRIV86_1547662 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 414

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           ILS+DGGG++G+    IL  +EK      G   R+ + FD+I GTSTGG++   L     
Sbjct: 21  ILSLDGGGVRGIIAGVILAFLEKQLQELDGEEARLADYFDVIAGTSTGGLVTAMLTVPDE 80

Query: 635 ---------GIKLMSLEKCEEVY-KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSF 784
                     I    LE C +++ +  G L     +PK                      
Sbjct: 81  TGRPHFAAKDIVPFYLEHCPKIFPQPTGVLALLPKLPK---------------------- 118

Query: 785 RVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
             ++ G K+S      LL +L     G+  +   +  I    V+ T   +   QP IF +
Sbjct: 119 --LLSGPKYSGKYLRNLLSKLL----GETRLHQTLTNI----VIPTF-DIKKLQPTIFSS 167

Query: 965 YQ 970
           YQ
Sbjct: 168 YQ 169



>gb:AJ617735_1812166 Hevea brasiliensis partial mRNA for putative
           latex allergen hev b 7.02.
          Length = 387

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 20/85 (23%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL--- 634
           + +LS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L   
Sbjct: 13  ITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGTSTGGLITTMLTAP 72

Query: 635 -----------GIKLMSLEKCEEVY 676
                       IK   LE C +++
Sbjct: 73  NEDKKPMYQAKDIKDFYLENCPKIF 97



>gb:AF113546_1769147 Hevea brasiliensis latex protein allergen Hev b
           7 mRNA, complete cds.
          Length = 388

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 20/85 (23%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL--- 634
           + +LS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L   
Sbjct: 14  ITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGTSTGGLITTMLTAP 73

Query: 635 -----------GIKLMSLEKCEEVY 676
                       IK   LE C +++
Sbjct: 74  NEDKKPMYQAKDIKDFYLENCPKIF 98



>pir|T10763|T10763 patatin-like latex allergen 1 - Para rubber
           tree>gb:HBR223038_1681589 Hevea brasiliensis mRNA for
           latex allergen (1444 bp).
          Length = 388

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 20/85 (23%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL--- 634
           + +LS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L   
Sbjct: 14  ITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGTSTGGLITTMLTAP 73

Query: 635 -----------GIKLMSLEKCEEVY 676
                       IK   LE C +++
Sbjct: 74  NEDKKPMYQAKDIKDFYLENCPKIF 98



>pir|T10770|T10770 patatin-like latex allergen - Para rubber
           tree>gb:HBU80598_1681614 Hevea brasiliensis latex
           patatin homolog mRNA, complete cds.
          Length = 388

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 20/85 (23%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL--- 634
           + +LS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L   
Sbjct: 14  ITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGTSTGGLITTMLTAP 73

Query: 635 -----------GIKLMSLEKCEEVY 676
                       IK   LE C +++
Sbjct: 74  NEDKKPMYQAKDIKDFYLENCPKIF 98



>pir|T10765|T10765 patatin-like latex allergen 2 - Para rubber
           tree>gb:HBR223039_1681590 Hevea brasiliensis mRNA for
           latex allergen (1438 bp).
          Length = 388

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 20/85 (23%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL--- 634
           + +LS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L   
Sbjct: 14  ITVLSIDGGGIRGIIPGIILASLESKLQDLDGPDARIADYFDIIAGTSTGGLITTMLTAP 73

Query: 635 -----------GIKLMSLEKCEEVY 676
                       IK   LE C +++
Sbjct: 74  NEDKKPIYQAKDIKDFYLENCPKIF 98



>pir|G85437|G85437 patatin-like protein [imported] - Arabidopsis
           thaliana>gb:ATAP21_1543991 Arabidopsis thaliana DNA
           chromosome 4, ESSA I AP2 contig fragment No.
           1.>gb:ATCHRIV86_1547661 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 414

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 48/182 (26%), Positives = 73/182 (40%), Gaps = 21/182 (11%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           ILS+DGGG++G+    IL  +EK      G   R+ + FD+I GTSTGG++   L     
Sbjct: 21  ILSLDGGGVRGIIAGVILAYLEKQLQELDGEHVRVADYFDVIAGTSTGGLVTAMLTAPDE 80

Query: 635 ---------GIKLMSLEKCEEVY-KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSF 784
                     I    LE C +++ +  G L     +PK                      
Sbjct: 81  NGRPRFAAKEIVPFYLEHCPKIFPQPTGVLALLPKLPK---------------------- 118

Query: 785 RVVVHGSKHSADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRN 964
             ++ G K+S +     L        G LL E+ ++      V+ T   +   QP IF +
Sbjct: 119 --LLSGPKYSGNYLRTTL--------GKLLGETKLRQTLTNVVIPTF-DIKTLQPTIFSS 167

Query: 965 YQ 970
           YQ
Sbjct: 168 YQ 169



>gb:CEW07A8_1369009 Caenorhabditis elegans cosmid W07A8, complete
            sequence.>gb:CEY44A6C_1370055 Caenorhabditis elegans YAC
            Y44A6C, complete sequence.
          Length = 1021

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 54/213 (25%), Positives = 84/213 (39%)
 Frame = +2

Query: 482  LRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEK 661
            + +L +DGGG++GL TV++L  +E    + + + FD I  TSTG  +   + +   SL K
Sbjct: 689  INVLGLDGGGIRGLVTVQMLICLEAFLDRPLIDYFDWIGATSTGCYIMSTM-MTGGSLRK 747

Query: 662  CEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLR 841
             +  Y     L+F     KD    SW    D     + ++F     G+       +RL+ 
Sbjct: 748  AQRYY-----LMF-----KDQLFDSWTRPYD---TKTLETFIQRAFGA-------DRLM- 786

Query: 842  ELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXX 1021
                   GD+         P+ F  +      P Q  + RNY+ P    E          
Sbjct: 787  -------GDI-------KYPRFFCTTVRADTFPVQLELLRNYRLPISEKENNDL------ 826

Query: 1022 XXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                       F    +  +W+A R SSAAP Y
Sbjct: 827  ----------GFTDPNELTIWKATRRSSAAPTY 849



>pir|T26261|T26261 hypothetical protein W07A8.2 - Caenorhabditis
            elegans>gb:CEW07A8_1369010 Caenorhabditis elegans cosmid
            W07A8, complete sequence.>gb:CEY44A6C_1370054
            Caenorhabditis elegans YAC Y44A6C, complete sequence.
          Length = 1023

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 54/213 (25%), Positives = 84/213 (39%)
 Frame = +2

Query: 482  LRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEK 661
            + +L +DGGG++GL TV++L  +E    + + + FD I  TSTG  +   + +   SL K
Sbjct: 691  INVLGLDGGGIRGLVTVQMLICLEAFLDRPLIDYFDWIGATSTGCYIMSTM-MTGGSLRK 749

Query: 662  CEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQFERLLR 841
             +  Y     L+F     KD    SW    D     + ++F     G+       +RL+ 
Sbjct: 750  AQRYY-----LMF-----KDQLFDSWTRPYD---TKTLETFIQRAFGA-------DRLM- 788

Query: 842  ELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQYPPGTPEPXXXXXXXXX 1021
                   GD+         P+ F  +      P Q  + RNY+ P    E          
Sbjct: 789  -------GDI-------KYPRFFCTTVRADTFPVQLELLRNYRLPISEKENNDL------ 828

Query: 1022 XXXXXXLKRNAFIGSCKHHVWQAIRASSAAPYY 1120
                       F    +  +W+A R SSAAP Y
Sbjct: 829  ----------GFTDPNELTIWKATRRSSAAPTY 851



>gb:AF193067_1775543 Vigna unguiculata patatin-like protein mRNA,
           complete cds.>gb:AF318315_1785606 Vigna unguiculata
           patatin-like protein gene, complete cds.
          Length = 400

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 46/172 (26%), Positives = 78/172 (45%), Gaps = 9/172 (5%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVALGIK 643
           + +LS+DGGG++G+    +L  +E       G   R+ + FD+I GTSTGG++   L   
Sbjct: 16  ITVLSIDGGGIRGIIPGILLAFLESELQKLDGADARLADYFDVIAGTSTGGLVTAML--- 72

Query: 644 LMSLEKCEEVY--KDLGKLVFAEPVPK-DNEAASWREKLDQLYKSSSQSFRVVVHGSKHS 814
               E    +Y  KD+ K  + E  PK   +++SW      + K  S      + G ++ 
Sbjct: 73  TAPNENNRPLYAAKDI-KDFYLEHTPKIFPQSSSWNLIATAMKKGRS------LMGPQYD 125

Query: 815 ADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQ 970
                +L+RE    + G+  +E  +       VV     +   QP IF ++Q
Sbjct: 126 GKYLHKLVRE----KLGNTKLEHTLTN-----VVIPAFDIKNLQPAIFSSFQ 168



>gb:NTU68483_1691890 Nicotiana tabacum patatin homolog gene, partial
           cds.
          Length = 263

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRIL-------KEIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    +L       +E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPATVLSFLESQLQELDNNEDARLADYFDVIAGTSTGGILTTMI 86



>gb:AB016875_1512962 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9D7.
          Length = 401

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 9/64 (14%)
 Frame = +2

Query: 470 PKQG--LRILSMDGGGMKGLATVRIL-------KEIEKGTGKRIHELFDLICGTSTGGML 622
           PK G  + ILS+DGGG++G+    IL       +EI+     R+ + FD+I GTSTGG++
Sbjct: 8   PKYGNLVTILSLDGGGVRGIIGGVILANLEKHLQEIDNDESVRLADYFDVIAGTSTGGLM 67

Query: 623 AVAL 634
              L
Sbjct: 68  TAML 71



>pir|S51596|S51596 patatin precursor, non-sucrose-inducible -
           Solanum brevidens>gb:SBU09331_1704900 Solanum brevidens
           non-sucrose-inducible patatin precursor mRNA, complete
           cds.>gb:STRNA01_1722904 Potato mRNA for major tuber
           protein patatin.
          Length = 386

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPATILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>pir|T03841|T03841 patatin homolog - common
           tobacco>gb:NTU68484_1691891 Nicotiana tabacum patatin
           homolog mRNA, complete cds.
          Length = 390

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRIL-------KEIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    +L       +E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPATVLSFLESQLQELDNNEDARLADYFDVIAGTSTGGILTTMI 86



>gb:AF158254_1773166 Nicotiana tabacum patatin-like protein 2 (PAT2)
           mRNA, partial cds.
          Length = 207

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 12/85 (14%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           +LS+DGGG++G+    +L  +E       G   RI + FD++ GTSTGG+++  L     
Sbjct: 9   VLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGGLISTMLTAPNK 68

Query: 635 -GIKLMSLEKCEEVYKDLGKLVFAE 706
               L + +     Y + G  +F E
Sbjct: 69  DNRPLYAAKNITNFYMEHGSKIFPE 93



>gb:AF061282_1765197 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 438

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 8/63 (12%)
 Frame = +2

Query: 470 PKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLA 625
           P QG  + +LS+DGGG++GL    I+  +E       G   RI + FD+I GTSTG +L 
Sbjct: 19  PSQGRLITVLSIDGGGIRGLIPATIITCLETKLQELDGPDARIADYFDVIAGTSTGALLT 78

Query: 626 VAL 634
             L
Sbjct: 79  SML 81



>gb:AX298157_1465337 Sequence 3 from Patent WO0183788.
          Length = 206

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 12/85 (14%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           +LS+DGGG++G+    +L  +E       G   RI + FD++ GTSTGG+++  L     
Sbjct: 9   VLSIDGGGIRGIIPGTLLAFLESKLQDIDGPNARIADYFDVVAGTSTGGLISTMLTAPNK 68

Query: 635 -GIKLMSLEKCEEVYKDLGKLVFAE 706
               L + +     Y + G  +F E
Sbjct: 69  DNRPLYAAKNITNFYMEHGSKIFPE 93



>gb:AX146911_1462503 Sequence 11 from Patent WO0136468.
          Length = 224

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 49/169 (28%), Positives = 78/169 (46%), Gaps = 8/169 (4%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRIL----KEIEK--GTGKRIHELFDLICGTSTGGMLAVALGIKLM 649
           +LS+DGGG++G+    IL     E++K  G   R+ + FD+I GTSTGG++   L     
Sbjct: 21  VLSIDGGGIRGIIPGIILGFLESELQKLDGDHVRLADYFDVIAGTSTGGLVTAML---TA 77

Query: 650 SLEKCEEVY--KDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSADQ 823
             E    +Y  KD+ K  + E  PK       + K   L+ SS   F   + G +++   
Sbjct: 78  PNENNRPLYAAKDI-KNFYLEHTPK----IFPQNKCWNLF-SSMVKFTRTLFGPQYNGKY 131

Query: 824 FERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNYQ 970
             RL+RE    + G+  +   +       VV     +   QP IF ++Q
Sbjct: 132 LHRLIRE----KLGETKLHQTLTN-----VVIPAFDIKRLQPTIFSSFQ 171



>pir|D71665|D71665 patatin b1 precursor (pat1) RP602 - Rickettsia
           prowazekii>gb:RPXX03_167380 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 3/4.
          Length = 494

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 8/78 (10%)
 Frame = +2

Query: 497 MDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL--------GIKLMS 652
           ++GGG+KG   +  LK IE+ TGK   ++FD   GTS GG++ + L        G  L S
Sbjct: 17  LEGGGVKGEIHLEKLKVIEEITGKPTCKVFDFTGGTSVGGLILILLNLPDSDNPGKPLFS 76

Query: 653 LEKCEEVYKDLGKLVFAE 706
            E+ + +++ +   +F E
Sbjct: 77  AEQAQTLFERMVHNIFPE 94



>gb:AP006849_1863089 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0054F02.
          Length = 387

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 8/66 (12%)
 Frame = +2

Query: 461 RQVPKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGG 616
           R  P  G  + +LS+DGGG++G+    +L  +E       G   RI + FD+I GTSTGG
Sbjct: 10  RHPPTYGNLITVLSIDGGGIRGIIPAVVLTFLESELQKLDGEEARIADYFDVIAGTSTGG 69

Query: 617 MLAVAL 634
           ++   L
Sbjct: 70  LVTAML 75



>gb:AP003962_1835752 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1705_C03.>gb:AP004397_1841169 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0436B06.
          Length = 442

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 6/55 (10%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG++G+    IL  +E+      G   R+ + FD+I GTSTGG++   L
Sbjct: 58  VLSIDGGGVRGIIPGTILAFLEEKLQELDGPAARVADYFDVIAGTSTGGLVTAML 112



>gb:AF498099_1805905 Solanum chacoense patatin storage protein mRNA,
           complete cds.
          Length = 387

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>gb:AF061282_1765193 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 410

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 8/63 (12%)
 Frame = +2

Query: 470 PKQG--LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLA 625
           P +G  + ILS+DGGG++GL    I+  +E       G   RI + FD+I GTSTG +L 
Sbjct: 19  PSKGKLITILSIDGGGIRGLIPATIIAYLEAKLQELDGPDARIADYFDVIAGTSTGALLT 78

Query: 626 VAL 634
             L
Sbjct: 79  SML 81



>gb:POTPATATB_1701122 Potato patatin mRNA, complete cds, clone
           pPATB1.
          Length = 386

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>gb:CR382131_1664035 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 573

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 39/143 (27%), Positives = 69/143 (48%), Gaps = 4/143 (2%)
 Frame = +2

Query: 17  VEQACSA---LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASD 187
           VE  C+A   +T+LA+  +   ++ +S  + P+ ++ +S       +    L  +   SD
Sbjct: 163 VEVQCNAVGCITNLATHEANKSKIARSGALLPLTKLAKSKDMRVQRNATGALLNMT-HSD 221

Query: 188 TVSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPE-SLRELLLR 364
              Q+++    +  L  L + ++P+VQ  +  A+ N+A    NR  L + E  L E L++
Sbjct: 222 QNRQELVNAGAIPILVSLLSSRDPDVQYYSTTALSNIAVDESNRKKLSSSEPRLVEHLIK 281

Query: 365 LTASSEPRVSKAAARALAILGEN 433
           L  S  PRV   AA AL  L  +
Sbjct: 282 LMDSGSPRVQCQAALALRNLASD 304



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 1/102 (0%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + + +D L+ + LL  + +P++QR A  A+GNLA  +EN+ VL
Sbjct: 86  LQRSAALAFAEITEKDIRPVNRDCLEPVLLLLQNTDPDIQRAASAALGNLAVNNENK-VL 144

Query: 329 VAPESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAI 454
           +      E L+R   S    V   A   +  L  +E  +  I
Sbjct: 145 IVEMGGFEPLIRQMMSPNVEVQCNAVGCITNLATHEANKSKI 186



 Score = 34.7 bits (78), Expect = 3.7
 Identities = 31/142 (21%), Positives = 64/142 (45%), Gaps = 1/142 (0%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD    ++++K++ +  +  + +S+    V++ +  +  +++        
Sbjct: 293 QAALALRNLASDSDYQLEIVKANGLPHLFNLFQSTHTPLVLAAVACIRNISI-HPLNETP 351

Query: 203 MLTKDVLKSL-KLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASS 379
           ++    LK+L +LL A  N E+Q   +  + NLA  SE   + +      +    L   +
Sbjct: 352 IIEAGFLKTLVELLGASDNEEIQCHTISTLRNLAASSERNKLEIVEAGAVQKCKELVLDA 411

Query: 380 EPRVSKAAARALAILGENEVLR 445
              V       LA+L   + L+
Sbjct: 412 PRLVQSEMTACLAVLALGDELK 433



>pir|A24142|A24142 patatin precursor - potato
          Length = 384

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>pir|S05593|S05593 patatin precursor (clone pPATB1) - potato
           (fragment)
          Length = 377

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 22  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 77



>pir|B26017|B26017 patatin T58 precursor - potato
          Length = 386

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>sp|P11768|PAT3_SOLTU Patatin class I precursor (Potato tuber
           protein).>pir|A29810|A29810 patatin -
           potato>gb:POTPATA_1701113 Potato patatin class I gene,
           complete cds.
          Length = 386

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>sp|P15477|PAT2_SOLTU Patatin B2 precursor (Potato tuber
           protein).>pir|S05592|S05592 patatin precursor (clone
           pPATB2) - potato>gb:STPATB2_1722843 Potato mRNA for
           tuber protein patatin B2.
          Length = 386

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>sp|P15476|PAT1_SOLTU Patatin B1 precursor (Potato tuber protein)
           (Fragment).>gb:STPATB1_1722842 Potato mRNA for tuber
           protein patatin B1.
          Length = 377

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 22  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 77



>sp|P07745|PAT0_SOLTU Patatin precursor (Potato tuber
           protein).>gb:STPATG1_1722845 Potato (tetraploid variety
           Maris piper) patatin gene.
          Length = 386

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPAIILEFLEGQLQEVDNNKDARLADYFDVIGGTSTGGLLTAMI 86



>gb:AE016818_1748101 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 568

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 39/143 (27%), Positives = 69/143 (48%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKM 205
           AC+AL +LA +    + +++   ++P+   ++S+  E   + +  +  LA   D  + K+
Sbjct: 105 ACAALGNLAVNNENKILIVEMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNKA-KI 163

Query: 206 LTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEP 385
                L  L  L   KN  VQR A  A+ N+    ENR  LV   ++  +L+ L +SS+ 
Sbjct: 164 AHSGALVPLTKLAKSKNIRVQRNATGALLNMTHSGENRKELVDAGAV-PVLVSLLSSSDA 222

Query: 386 RVSKAAARALAILGENEVLRRAI 454
            V      AL+ +  +E  RR +
Sbjct: 223 DVQYYCTTALSNIAVDESNRRKL 245



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 23/77 (29%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + + ++VL+ + +L    +P++Q  A  A+GNLA  +EN+ ++
Sbjct: 63  LQRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQIAACAALGNLAVNNENKILI 122

Query: 329 VAPESLRELLLRLTASS 379
           V    L  L+ ++ +++
Sbjct: 123 VEMGGLEPLIEQMKSNN 139



>gb:AP004154_1838288 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1111_E05.
          Length = 430

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 12/172 (6%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL----- 634
           +LS+DGGG++G+    IL  +E+      G   R+   FD+I GTSTGG++   L     
Sbjct: 49  VLSIDGGGVRGIIPGTILAFLEEKLQELDGPEARLANYFDVIAGTSTGGLVTAMLTAPND 108

Query: 635 -GIKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKH 811
            G  L +     + Y +    +F  PV K             L+KS +        G K+
Sbjct: 109 NGDPLFAARDINDFYLEHCPRIF-PPVSKGPLG---------LFKSMT--------GPKY 150

Query: 812 SADQFERLLRELCTDEDGDLLIESAVKGIPKVFVVSTLVSVSPAQPFIFRNY 967
                  ++++L     GD  ++S +  I    VV T   +   QP IF  Y
Sbjct: 151 DGRHLHSVVQQLL----GDKRVDSTITNI----VVPTF-DIKLLQPTIFSTY 193



>gb:CR380959_1653795 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 582

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 37/143 (25%), Positives = 67/143 (46%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKM 205
           AC+AL +LA +    + ++    ++P+   +  +  E   + +  +  LA   D    K+
Sbjct: 105 ACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLATRDDN-KHKI 163

Query: 206 LTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEP 385
            T   L  L  L   K+  VQR A  A+ N+    ENR  LV   ++  +L+ L +S++P
Sbjct: 164 ATSGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAV-PVLVSLLSSNDP 222

Query: 386 RVSKAAARALAILGENEVLRRAI 454
            V      AL+ +  +E  R+ +
Sbjct: 223 DVQYYCTTALSNIAVDEANRKKL 245



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 24/77 (31%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + +++DVL+ + +L   ++P++Q  A  A+GNLA  +EN+ ++
Sbjct: 63  LQRSAALAFAEVTEKYVRQVSRDVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLI 122

Query: 329 VAPESLRELLLRLTASS 379
           V    L  L+ ++  ++
Sbjct: 123 VDMGGLEPLINQMMGTN 139



>gb:AY033231_1559430 Solanum cardiophyllum patatin mRNA, complete
           cds.
          Length = 386

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILK-------EIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG++G+    IL+       E++     R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIRGIIPATILEFLEGQLQEMDNNADARLADYFDVIGGTSTGGLLTAMI 86



>pir|F85437|F85437 patatin-like protein [imported] - Arabidopsis
           thaliana>gb:ATAP21_1543992 Arabidopsis thaliana DNA
           chromosome 4, ESSA I AP2 contig fragment No.
           1.>gb:ATCHRIV86_1547660 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 428

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 6/59 (10%)
 Frame = +2

Query: 476 QGLRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           Q + ILS+DGGG++G+    IL  +E       G   R+ + FD+I GTSTGG++   L
Sbjct: 33  QLVTILSIDGGGIRGIIPGTILAYLESQLQELDGEEARLVDYFDVISGTSTGGLIVAML 91



>sp|P39968|VAC8_YEAST Vacuolar protein 8.>pir|S50446|S50446 VAC8
           protein - yeast (Saccharomyces
           cerevisiae)>gb:SCE9871_1708249 Saccharomyces cerevisiae
           chromosome V cosmids 9871, 8199, 9867, 9495 and lambda
           clones 6693 and 5898.>gb:AF005267_1760789 Saccharomyces
           cerevisiae Yeb3p (YEB3) mRNA, complete cds.
          Length = 578

 Score = 43.1 bits (100), Expect = 0.010
 Identities = 37/143 (25%), Positives = 67/143 (46%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKM 205
           AC+AL +LA +    + +++   ++P+   +     E   + +  +  LA   D    K+
Sbjct: 105 ACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDN-KHKI 163

Query: 206 LTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEP 385
            T   L  L  L   K+  VQR A  A+ N+    ENR  LV   ++  +L+ L +S++P
Sbjct: 164 ATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAV-PVLVSLLSSTDP 222

Query: 386 RVSKAAARALAILGENEVLRRAI 454
            V      AL+ +  +E  R+ +
Sbjct: 223 DVQYYCTTALSNIAVDEANRKKL 245



 Score = 37.7 bits (86), Expect = 0.44
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + ++++VL+ + +L   ++P++Q  A  A+GNLA  +EN+ ++
Sbjct: 63  LQRSAALAFAEITEKYVRQVSREVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLI 122

Query: 329 VAPESLRELL 358
           V    L  L+
Sbjct: 123 VEMGGLEPLI 132



>gb:CSPATATLP_1674081 Cucumis sativus mRNA for patatin-like protein,
           partial.
          Length = 405

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 6/57 (10%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           + ILS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L
Sbjct: 24  ITILSIDGGGIRGIIPSIILAFLESKLQELDGPDVRIADYFDVIAGTSTGGLVTSML 80



>gb:AX298159_1465338 Sequence 5 from Patent
           WO0183788.>gb:AF158253_1773165 Nicotiana tabacum
           patatin-like protein 3 (PAT3) mRNA, complete cds.
          Length = 411

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 6/55 (10%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG++G+    +L  +E       G   R+ + FD++ GTSTGG++   L
Sbjct: 35  VLSVDGGGIRGIIPGTVLAFLESKLQELDGPNARLADYFDVVAGTSTGGLITTML 89



>pir|T10260|T10260 patatin-like protein - cucumber (fragment)
          Length = 405

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 6/57 (10%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATVRILKEIEK------GTGKRIHELFDLICGTSTGGMLAVAL 634
           + ILS+DGGG++G+    IL  +E       G   RI + FD+I GTSTGG++   L
Sbjct: 24  ITILSIDGGGIRGIIPSIILAFLESKLQELDGPDVRIADYFDVIAGTSTGGLVTSML 80



>gb:AE017341_1754182 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 660

 Score = 42.0 bits (97), Expect = 0.023
 Identities = 35/132 (26%), Positives = 68/132 (51%), Gaps = 4/132 (3%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD    ++++K   ++P+ R+L SS    ++S    +  +++     S  
Sbjct: 301 QAALALRNLASDSKYQLEIVKFGGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESPI 360

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSE-NRCVLV---APESLRELLLRLT 370
           + +  +   ++LL   +N EVQ  A+  + NLA  SE N+  +V   A E ++ L+L + 
Sbjct: 361 IESGFLQPLIELLSFDENEEVQCHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVP 420

Query: 371 ASSEPRVSKAAA 406
            + +  ++   A
Sbjct: 421 LAVQSEMTACVA 432



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T  + + + +D L  +  L +  +PEVQR A  A+GNLA  +EN+ ++
Sbjct: 94  LQRSAALAFAEITEKEVREVGRDTLDPVLYLLSSHDPEVQRAASAALGNLAVNAENKLLV 153

Query: 329 VAPESLRELLLRL 367
           V+   L  L+ ++
Sbjct: 154 VSLGGLEPLIRQM 166



 Score = 33.9 bits (76), Expect = 6.3
 Identities = 36/147 (24%), Positives = 65/147 (44%)
 Frame = +2

Query: 14  VVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTV 193
           V   A +AL +LA +    + ++    ++P+ R + S   E   + +  +  LA   +  
Sbjct: 132 VQRAASAALGNLAVNAENKLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDENK 191

Query: 194 SQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTA 373
           +Q +     L  L  L   K+  VQR A  A+ N+    ENR  LVA  ++  +L+ L  
Sbjct: 192 TQ-IAKSGALVPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVAAGAI-PVLVSLLN 249

Query: 374 SSEPRVSKAAARALAILGENEVLRRAI 454
           S +  V      AL+ +  +   R+ +
Sbjct: 250 SPDTDVQYYCTTALSNIAVDAANRKKL 276



>gb:AP003816_1833765 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1165_F02.
          Length = 456

 Score = 41.6 bits (96), Expect = 0.030
 Identities = 32/140 (22%), Positives = 68/140 (48%), Gaps = 2/140 (1%)
 Frame = +2

Query: 5   NQHVVEQACSALTSLASDVSVAMQ-LMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALA 181
           ++ ++  AC AL  +   VS  +Q ++ +     +  +L  +    ++ V+ VLA+++  
Sbjct: 176 DEKILGDACWALCYICDGVSDGIQHVLDAGACPQLVNLLMHASANILLPVITVLARISSG 235

Query: 182 SDTVSQKMLTKDVLKSLKLLCAHKNPE-VQRLALFAVGNLAFCSENRCVLVAPESLRELL 358
            D   Q ++  D+L  L  L A   P+ +++ A   V N++  S++    V    +   L
Sbjct: 236 DDAQVQVLVENDILNYLAPLLARNYPKSIKKQACLIVSNISTGSKDNIQAVIDADVISPL 295

Query: 359 LRLTASSEPRVSKAAARALA 418
           + L  +SE  + + AA A++
Sbjct: 296 IFLLKTSEKDIKEEAAWAIS 315



>gb:BX842627_1643878 Neurospora crassa DNA linkage group I BAC clone
           B8J22.
          Length = 593

 Score = 41.6 bits (96), Expect = 0.030
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +2

Query: 482 LRILSMDGGGMKGLATV----RILKEIEKGTG----KRIHELFDLICGTSTGGMLAVALG 637
           + ILS+DGGG++ L+ V    RI+K I++  G     +  + F LI G  TGG+ A+  G
Sbjct: 8   VNILSLDGGGVRALSEVMMLDRIMKRIQEKQGLAEMPKPCDYFHLIGGIGTGGIAAILFG 67

Query: 638 IKLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREK 748
              M+  +    Y+++   +F+    +   +  +RE+
Sbjct: 68  RLRMTTTEALTGYENIASEIFSTRKRRLEFSVDFREE 104



>gb:BX842620_1643725 Neurospora crassa DNA linkage group V BAC
           contig B11E5.
          Length = 578

 Score = 41.6 bits (96), Expect = 0.030
 Identities = 33/141 (23%), Positives = 66/141 (46%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD    ++++++  + P+ R+L+SS    ++S +  +  +++     S  
Sbjct: 291 QAALALRNLASDEKYQLEIVRASGLGPLLRLLQSSYLPLILSAVACIRNISIHPMNESPI 350

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
           +    +   + LL +  N E+Q  A+  + NLA  S+    LV      +   +L     
Sbjct: 351 IEAGFLKPLVDLLGSTDNEEIQCHAISTLRNLAASSDRNKALVLEAGAVQKCKQLVLEVP 410

Query: 383 PRVSKAAARALAILGENEVLR 445
             V      A+A+L  ++ L+
Sbjct: 411 VTVQSEMTAAIAVLALSDELK 431



>gb:AE014296_1134939 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003564_1215750 Drosophila melanogaster
           chromosome 3L, section 21 of 83 of the complete
           sequence.
          Length = 442

 Score = 41.6 bits (96), Expect = 0.030
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 1/152 (0%)
 Frame = +2

Query: 86  SDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEV 265
           ++I+Q +  VL +     +   L  +  LA  ++T+ Q +L  +V+  +  L  H N  V
Sbjct: 189 AEIIQALNIVLYNPEANVLEDALMAVRNLAHGNETI-QMLLDFEVVPRIIYLLEHPNVTV 247

Query: 266 QRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEVLR 445
           Q  AL A+ N+A  SE +   +   +L   L  L ++S+P +     + L  + +  + +
Sbjct: 248 QNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQ 307

Query: 446 R-AIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
           R AI    +  + L  L  D   +K  A + I
Sbjct: 308 RHAIMNAGLLHKILECLKADAISLKSAAALTI 339



 Score = 35.0 bits (79), Expect = 2.8
 Identities = 23/97 (23%), Positives = 47/97 (48%)
 Frame = +2

Query: 11  HVVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDT 190
           +V+E A  A+ +LA        L+  +++  I  +L         + LQ L  +A  S+ 
Sbjct: 205 NVLEDALMAVRNLAHGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEE 264

Query: 191 VSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLA 301
             Q++L  ++L  L  L ++ +P+++   L  + N+A
Sbjct: 265 QIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIA 301



>pir|T07592|T07592 class I patatin - potato>gb:STPOTAX_1722874
           S.tuberosum mRNA for patatin.
          Length = 386

 Score = 41.6 bits (96), Expect = 0.030
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEKGTGK-------RIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG+KG+    IL+ +E    K       R+ + FD+I GTSTGG+L   +
Sbjct: 31  VLSIDGGGIKGIIPGTILEFLEGQLQKMDNNADARLADYFDVIGGTSTGGLLTAMI 86



>gb:BC079724_2561262 Xenopus laevis cDNA clone MGC:83011
           IMAGE:5542008, complete cds.
          Length = 720

 Score = 40.8 bits (94), Expect = 0.051
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 6/132 (4%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 585 LLSTRPHIDQIMSTHGKQIMQAVTFILEGEHNIEVKEQTLCILANIADGTTAKDLIMTND 644

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRE-----LLLRLTASS 379
           D+L+ +K    H N ++Q  A+F + NL + +E        + LRE     +L +L+ S+
Sbjct: 645 DILQKIKYYVGHSNLKLQLAAMFCIANLTW-NEEEGSQERQDKLREIGIVDILHKLSQST 703

Query: 380 EPRVSKAAARAL 415
           +P +   A  AL
Sbjct: 704 DPNLCDKAKTAL 715



>gb:BC076400_2559238 Danio rerio unc-45 (C. elegans) related, mRNA
            (cDNA clone MGC:100776 IMAGE:6900748), complete cds.
          Length = 932

 Score = 40.4 bits (93), Expect = 0.067
 Identities = 36/138 (26%), Positives = 72/138 (52%), Gaps = 3/138 (2%)
 Frame = +2

Query: 89   DIMQPIERVLRSSRPE-EVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEV 265
            ++++P+  +L + R   E    L+ L  LA  +D +  K+L +  L  ++      + ++
Sbjct: 718  EVVRPLVSLLGTDRDGMENFEALRGLTNLAGLNDKLRVKILKEKALPEIENYMFEDHEQI 777

Query: 266  QRLALFAVGNLAFCSE--NRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEV 439
            ++ A   + NL  C E  +R +    + L+ LL+ L    E ++ +AAA ALA+L   + 
Sbjct: 778  RQAATECMCNLVCCKEVQDRYLEDGNDKLK-LLVLLCGEDEEKLQRAAAGALAMLTAAQ- 835

Query: 440  LRRAIRVRQVPKQGLRIL 493
             + A+++ +V +Q L IL
Sbjct: 836  KKLAVKMTKVTEQWLEIL 853



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 8/101 (7%)
 Frame = +2

Query: 152  LQVLAKLALASDTVSQKML-------TKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCS 310
            LQ  A  ALA  T +QK L       T+  L+ L+ LC H NPE+Q   L  V N+    
Sbjct: 820  LQRAAAGALAMLTAAQKKLAVKMTKVTEQWLEILQRLCIHDNPEIQHRGLVTVFNMLDAD 879

Query: 311  ENRCVLVAPESLRELLLRLT-ASSEPRVSKAAARALAILGE 430
            +     +    + E+L  +      P+   A   A A L +
Sbjct: 880  DQLAKKLVESDMLEILTYVAKLEDNPKKQNAIDAARACLSK 920



>gb:AF330001_2487933 Danio rerio UNC45-related protein mRNA, complete
            cds.
          Length = 934

 Score = 40.4 bits (93), Expect = 0.067
 Identities = 36/138 (26%), Positives = 72/138 (52%), Gaps = 3/138 (2%)
 Frame = +2

Query: 89   DIMQPIERVLRSSRPE-EVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEV 265
            ++++P+  +L + R   E    L+ L  LA  +D +  K+L +  L  ++      + ++
Sbjct: 720  EVVRPLVSLLGTDRDGMENFEALRGLTNLAGLNDKLRVKILKEKALPEIENYMFEDHEQI 779

Query: 266  QRLALFAVGNLAFCSE--NRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEV 439
            ++ A   + NL  C E  +R +    + L+ LL+ L    E ++ +AAA ALA+L   + 
Sbjct: 780  RQAATECMCNLVCCKEVQDRYLEDGNDKLK-LLVLLCGEDEEKLQRAAAGALAMLTAAQ- 837

Query: 440  LRRAIRVRQVPKQGLRIL 493
             + A+++ +V +Q L IL
Sbjct: 838  KKLAVKMTKVTEQWLEIL 855



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 8/101 (7%)
 Frame = +2

Query: 152  LQVLAKLALASDTVSQKML-------TKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCS 310
            LQ  A  ALA  T +QK L       T+  L+ L+ LC H NPE+Q   L  V N+    
Sbjct: 822  LQRAAAGALAMLTAAQKKLAVKMTKVTEQWLEILQRLCIHDNPEIQHRGLVTVFNMLDAD 881

Query: 311  ENRCVLVAPESLRELLLRLT-ASSEPRVSKAAARALAILGE 430
            +     +    + E+L  +      P+   A   A A L +
Sbjct: 882  DQLAKKLVESDMLEILTYVAKLEDNPKKQNAIDAARACLSK 922



>gb:AP003728_1832552 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0710B08.>gb:AP004989_1846769 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1153E06.
          Length = 450

 Score = 40.4 bits (93), Expect = 0.067
 Identities = 27/71 (38%), Positives = 36/71 (50%), Gaps = 7/71 (9%)
 Frame = +2

Query: 482 LRILSMDGGGMKGL----ATVRI---LKEIEKGTGKRIHELFDLICGTSTGGMLAVALGI 640
           +R+LS+DGG   G     A VR+   LKE+      R+ + FDL  G+  GG LA AL  
Sbjct: 99  VRVLSIDGGADGGALAAAALVRLERRLKELSGNPDARVADYFDLAAGSGAGGFLAAALFA 158

Query: 641 KLMSLEKCEEV 673
             M  E   +V
Sbjct: 159 CRMPAEAARDV 169



>gb:ATF28P10_1550409 Arabidopsis thaliana DNA chromosome 3, BAC clone
            F28P10.
          Length = 1070

 Score = 40.4 bits (93), Expect = 0.067
 Identities = 37/155 (23%), Positives = 80/155 (51%), Gaps = 1/155 (0%)
 Frame = +2

Query: 44   SLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVL 223
            SL+   +   +L +   +Q I ++++S   E  I  ++V+A LA A +    K++ +  +
Sbjct: 806  SLSGQRATMARLCEEVGIQKILQLIKSEDLEVQIQAVKVVANLA-AEEANQVKIVEEGGV 864

Query: 224  KSLKLLC-AHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSKA 400
            ++L +L  + +N  + R+A  A+ NLA   +++ +++     + L   +T + +P+  + 
Sbjct: 865  EALLMLVQSSQNSTILRVASGAIANLAMNEKSQDLIMNKGGAQLLAKMVTKTDDPQTLRM 924

Query: 401  AARALAILGENEVLRRAIRVRQVPKQGLRILSMDG 505
             A ALA L  NE   + ++  +  K GL  ++  G
Sbjct: 925  VAGALANLCGNEKFLKLLKEEEGIK-GLLTMAQSG 958



>pir|T06733|T06733 kinesin homolog F28P10.150 - Arabidopsis thaliana
          Length = 1070

 Score = 40.4 bits (93), Expect = 0.067
 Identities = 37/155 (23%), Positives = 80/155 (51%), Gaps = 1/155 (0%)
 Frame = +2

Query: 44   SLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVL 223
            SL+   +   +L +   +Q I ++++S   E  I  ++V+A LA A +    K++ +  +
Sbjct: 806  SLSGQRATMARLCEEVGIQKILQLIKSEDLEVQIQAVKVVANLA-AEEANQVKIVEEGGV 864

Query: 224  KSLKLLC-AHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSKA 400
            ++L +L  + +N  + R+A  A+ NLA   +++ +++     + L   +T + +P+  + 
Sbjct: 865  EALLMLVQSSQNSTILRVASGAIANLAMNEKSQDLIMNKGGAQLLAKMVTKTDDPQTLRM 924

Query: 401  AARALAILGENEVLRRAIRVRQVPKQGLRILSMDG 505
             A ALA L  NE   + ++  +  K GL  ++  G
Sbjct: 925  VAGALANLCGNEKFLKLLKEEEGIK-GLLTMAQSG 958



>gb:CR382135_1668395 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 560

 Score = 40.0 bits (92), Expect = 0.088
 Identities = 26/77 (33%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + + +DVL+ + +L    + EVQR A  A+GNLA  +EN+ ++
Sbjct: 65  LQRSAALAFAEITEKDVREVNRDVLEPILILLQSADSEVQRAACGALGNLAVNNENKILI 124

Query: 329 VAPESLRELLLRLTASS 379
           V    L  L+ ++ +++
Sbjct: 125 VEMGGLEPLIRQMMSTN 141



 Score = 39.7 bits (91), Expect = 0.11
 Identities = 37/150 (24%), Positives = 70/150 (46%)
 Frame = +2

Query: 5   NQHVVEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALAS 184
           +  V   AC AL +LA +    + +++   ++P+ R + S+  E   + +  +  LA   
Sbjct: 100 DSEVQRAACGALGNLAVNNENKILIVEMGGLEPLIRQMMSTNIEVQCNAVGCITNLATQD 159

Query: 185 DTVSQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLR 364
           D  + K+     L  L  L   K+  VQR A  A+ N+    ENR  LV   ++  +L+ 
Sbjct: 160 DNKT-KIAKSGALIPLAKLAKSKDIRVQRNATGALLNMTHSGENRQELVNAGAV-PVLVS 217

Query: 365 LTASSEPRVSKAAARALAILGENEVLRRAI 454
           L ++ +  V      AL+ +  +E+ R+ +
Sbjct: 218 LLSNEDADVQYYCTTALSNIAVDEMNRKKL 247



>gb:AK041744_1166095 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630034B15
           product:CDNA FLJ32827 FIS, CLONE TESTI2003109, WEAKLY
           SIMILAR TO VACUOLAR PROTEIN 8 (FRAGMENT) homolog [Homo
           sapiens], full insert sequence.
          Length = 684

 Score = 39.3 bits (90), Expect = 0.15
 Identities = 37/172 (21%), Positives = 74/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  +  D      L ++  +  + ++L +    ++ +  L V+A      DT+   
Sbjct: 211 ALKTLGVITCDKEARTMLKENQGLDHLTKILETKELNDLHVEALSVIANCLEDMDTMVLM 270

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L    +   P++Q+ A  A+   A+  ENR V    E + + L+ L  S  
Sbjct: 271 QQTGSLKKVLSFAESSTIPDIQKNAAKAIAKAAYDPENRKVFHEQE-VEKCLVTLLGSDS 329

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ L EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 330 DGTKIAASQAISALCENLSCKEFFNTQGIP-QIVQLLRSDNEEVREAAALAL 380



>gb:AP003526_1830456 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0548D03.
          Length = 891

 Score = 38.9 bits (89), Expect = 0.20
 Identities = 31/114 (27%), Positives = 56/114 (49%)
 Frame = +2

Query: 200 KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASS 379
           K+  +  L+ +  L   + P+V+  A+  V NLA    N+  +V    L  LL+ L +S 
Sbjct: 628 KLFEQVGLQKILSLLESEEPDVRVHAVKVVANLAAEEANQEKIVEAGGLTSLLMLLRSSE 687

Query: 380 EPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRIL 541
           +  + + AA A+A L  NE  +  I    + + G+ +LSM     +   T+R++
Sbjct: 688 DETIRRVAAGAIANLAMNETNQDLI----MAQGGVSLLSMTASDAEDPQTLRMV 737



>gb:BT000869_1635124 Arabidopsis thaliana clone C103467 unknown
           protein (At4g29800) mRNA, complete cds.
          Length = 525

 Score = 38.9 bits (89), Expect = 0.20
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = +2

Query: 470 PKQGLRILSMDGGGMKGLAT-------VRILKEIEKGTGKRIHELFDLICGTSTGGMLAV 628
           P+  + +LS+DGGGM+GL          ++LKE       RI + FD+  G+  GG+ A 
Sbjct: 117 PRGRICVLSIDGGGMRGLLAGKSLIYLEQMLKEKSGDPNARIADYFDVAAGSGVGGVFAA 176

Query: 629 AL 634
            +
Sbjct: 177 MI 178



>pir|T08541|T08541 hypothetical protein F27B13.40 - Arabidopsis
           thaliana>gb:ATCHRIV71_1546901 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           71.>gb:ATF27B13_1550186 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F27B13 (ESSA project).
          Length = 526

 Score = 38.9 bits (89), Expect = 0.20
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 7/62 (11%)
 Frame = +2

Query: 470 PKQGLRILSMDGGGMKGLAT-------VRILKEIEKGTGKRIHELFDLICGTSTGGMLAV 628
           P+  + +LS+DGGGM+GL          ++LKE       RI + FD+  G+  GG+ A 
Sbjct: 117 PRGRICVLSIDGGGMRGLLAGKSLIYLEQMLKEKSGDPNARIADYFDVAAGSGVGGVFAA 176

Query: 629 AL 634
            +
Sbjct: 177 MI 178



>gb:CR382121_1654751 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 579

 Score = 38.5 bits (88), Expect = 0.26
 Identities = 38/158 (24%), Positives = 73/158 (46%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKM 205
           +C+AL +LA +    + +++   ++P+   ++S   E   + +  +  LA   D   + +
Sbjct: 107 SCAALGNLAVNNENKLLIVEMGGLEPLIEQMKSDNVEVQCNAVGCITNLATQDDNKIE-I 165

Query: 206 LTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEP 385
                L  L  L    N  VQR A  A+ N+    ENR  LV   ++  +L+ L +S + 
Sbjct: 166 AQSGALVPLTKLARSSNIRVQRNATGALLNMTHSGENRKELVDAGAV-PVLVSLLSSMDA 224

Query: 386 RVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSM 499
            V      AL+ +  +E  RR +  +  PK   +++S+
Sbjct: 225 DVQYYCTTALSNIAVDESNRRYLS-KHAPKLVTKLVSL 261



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T      +++DVL+ + +L  + +P+++  +  A+GNLA  +EN+ ++
Sbjct: 65  LQRSAALAFAEITEKYVSPVSRDVLEPILMLLTNPDPQIRIASCAALGNLAVNNENKLLI 124

Query: 329 VAPESLRELLLRLTASS 379
           V    L  L+ ++ + +
Sbjct: 125 VEMGGLEPLIEQMKSDN 141



>gb:AJ620477_527392 Angiococcus disciformis partial ORF16, ORF15,
           ORF14, ORF13, ORF12, ORF11, ORF10, ORF9, ORF8, ORF7,
           ORF6, ORF5, ORF4, ORF3, tubA gene, ORF2, tubZ gene,
           ORF1, tubB gene, tubC gene, tubD gene, tubE gene, tubF
           gene, ORF17, ORF18, ORF19, ORF20, tubG gene, ORF21,
           ORF22, ORF23 and ORF24, strain An
           d48.>gb:CQ792604_1452925 Sequence 18 from Patent
           WO2004022586.
          Length = 351

 Score = 38.5 bits (88), Expect = 0.26
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGI---KLMSL 655
           RILS+DGGG++ L ++ +LK I++     + ++ DL+ GTS G + A+ +       + L
Sbjct: 20  RILSLDGGGLRTLLSIGLLKRIDQLRPGFLDQV-DLVAGTSAGAISALIIAAAREPAVGL 78

Query: 656 EKCEEVY 676
           E+  +++
Sbjct: 79  EQARQIW 85



>gb:CR555306_107700 Azoarcus sp. EbN1 complete genome.
          Length = 376

 Score = 38.5 bits (88), Expect = 0.26
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +2

Query: 476 QGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGI 640
           +G   L + GGG +    V +L  I K  G++    F ++CGTS GG+ A  L +
Sbjct: 3   EGKAALVLTGGGARAAYQVGVLAAIRKIRGRQPGNPFPILCGTSAGGINAATLAV 57



>gb:AP004994_1846913 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846950 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 518

 Score = 38.1 bits (87), Expect = 0.33
 Identities = 58/246 (23%), Positives = 100/246 (40%), Gaps = 10/246 (4%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKM 205
           A +AL +L+ +    +++++S  + P+  VLRS  PE        +  LA+  +  +   
Sbjct: 235 AAAALVNLSLEAENKVRIVRSGAVSPLVEVLRSGHPEARDHAAGAVYSLAVEDENRAAIG 294

Query: 206 LTKDVLKSLKLL-CAHKNPEVQRLALFAVGNLAFCSENRCVLV-APESLRELLLRLTASS 379
           +   +   L+L  CA      +R A  A+ +++    NR  +   P  +R LL    A+ 
Sbjct: 295 VLGAIPPLLELFACAGAAHLARREAGMALYHVSLSGMNRSKIARTPGVVRTLLAAAEAAR 354

Query: 380 EPRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKG 559
           + R ++A A AL  +         I          R   MDGG +   A VR++      
Sbjct: 355 DDRANEADAAALRRIAV------MILANLAGCPDGRTALMDGGAV--AAVVRLMSSGSAA 406

Query: 560 TGKRIHE-LFDLICGTSTGGM----LAVALGIKLMSLEKCE---EVYKDLGKLVFAEPVP 715
            G    E     + G S G +    LA A G++       E    V +D+ +        
Sbjct: 407 PGSAEEEYCISSLYGMSRGSLRFRGLARAAGVEAALTPVAEGAGGVGRDMARRTLRAMRG 466

Query: 716 KDNEAA 733
           +D+EAA
Sbjct: 467 EDDEAA 472



>gb:BX908798_831195 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 1533

 Score = 38.1 bits (87), Expect = 0.33
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 9/122 (7%)
 Frame = +2

Query: 320 CVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEVLRRAIRVRQV-----PK-QG 481
           CV    E   E LL+L        S   A  LAI   N+ +   I+   V     PK Q 
Sbjct: 411 CVKGKKEGSFEFLLKLGCQDVENNSGQNALQLAIDLNNKEIENFIQKNVVGESWDPKTQP 470

Query: 482 LRILSMDGGGMKGLATVRILKEIEKGTGKRIHEL---FDLICGTSTGGMLAVALGIKLMS 652
            + L + GGG KG+A + +LK++E+      HE     + I GTS+G + A  + +   S
Sbjct: 471 PKNLVIKGGGPKGIAYIAVLKKLEE------HEALKNLERIAGTSSGAIFASLISVGYTS 524

Query: 653 LE 658
            E
Sbjct: 525 SE 526



>gb:AJ620477_527391 Angiococcus disciformis partial ORF16, ORF15,
           ORF14, ORF13, ORF12, ORF11, ORF10, ORF9, ORF8, ORF7,
           ORF6, ORF5, ORF4, ORF3, tubA gene, ORF2, tubZ gene,
           ORF1, tubB gene, tubC gene, tubD gene, tubE gene, tubF
           gene, ORF17, ORF18, ORF19, ORF20, tubG gene, ORF21,
           ORF22, ORF23 and ORF24, strain An
           d48.>gb:CQ792604_1452926 Sequence 18 from Patent
           WO2004022586.
          Length = 351

 Score = 38.1 bits (87), Expect = 0.33
 Identities = 19/50 (38%), Positives = 34/50 (68%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           RILS+DGGG++ L ++ +LK I++     + ++ DL+ GTS G + A+ +
Sbjct: 20  RILSLDGGGLRTLLSIGLLKRIDQLRPGFLDQV-DLVAGTSAGAISALII 68



>gb:AY056391_1563699 Arabidopsis thaliana AT3g63200/F16M2_50 mRNA,
           complete cds.>gb:BT001015_1635270 Arabidopsis thaliana
           At3g63200/F16M2_50 mRNA, complete cds.
          Length = 384

 Score = 37.7 bits (86), Expect = 0.44
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 7/57 (12%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKG----TGK---RIHELFDLICGTSTGGMLAVAL 634
           RILS+DGGG  G+     +  +E      TG     I + FD++ GT  GG+LA  L
Sbjct: 31  RILSIDGGGTTGIVAAASILHLEHQIRLQTGDPHAHISDFFDIVAGTGIGGILAALL 87



>gb:AE016911_355402 Chromobacterium violaceum ATCC 12472 section 2
           of 16 of the complete genome.>gb:AE016825_1040556
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 322

 Score = 37.7 bits (86), Expect = 0.44
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEK---GTGKRIHELFDLICGTSTGGMLAVALGIKLMSL 655
           RILS+DGGG++G+  + IL  +++   G    IH    +  GTSTG ++A+ L  + M+ 
Sbjct: 8   RILSLDGGGLRGIIALVILDRLDRAAPGWRDGIH----MHAGTSTGALIALGLA-RGMTP 62

Query: 656 EKCEEVYKDLGKLVF 700
            +  + Y + G  +F
Sbjct: 63  RQILDQYLERGPKLF 77



>gb:AE011613_274848 Leptospira interrogans serovar lai str. 56601
           chromosome II, section 25 of 34 of the complete
           sequence.>gb:AE016824_341552 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome II,
           complete sequence.>gb:AE010301_1003522 Leptospira
           interrogans serovar lai str. 56601 chromosome II,
           complete sequence.
          Length = 292

 Score = 37.7 bits (86), Expect = 0.44
 Identities = 29/97 (29%), Positives = 44/97 (45%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIKLMSLEKC 664
           R L + GGG +G     +L+ +E+   K      D+ICGTS G + A A+G  + S E  
Sbjct: 3   RALILSGGGARGAYQAGVLRYLEEIQFKP-----DIICGTSVGAITATAMGCGMNSAE-- 55

Query: 665 EEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSS 775
                 + KL  +    K    + W + +D   KS S
Sbjct: 56  ------ITKLWKSIEAKKVMRYSIWNDLVDIFVKSYS 86



>pir|T48109|T48109 hypothetical protein F16M2.50 - Arabidopsis
           thaliana>gb:ATF16M2_1548845 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F16M2.
          Length = 382

 Score = 37.7 bits (86), Expect = 0.44
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 7/57 (12%)
 Frame = +2

Query: 485 RILSMDGGGMKGLATVRILKEIEKG----TGK---RIHELFDLICGTSTGGMLAVAL 634
           RILS+DGGG  G+     +  +E      TG     I + FD++ GT  GG+LA  L
Sbjct: 29  RILSIDGGGTTGIVAAASILHLEHQIRLQTGDPHAHISDFFDIVAGTGIGGILAALL 85



>gb:SPBC354_1719976 S.pombe chromosome II cosmid c354.
          Length = 550

 Score = 37.4 bits (85), Expect = 0.57
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 1/112 (0%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD    +++++S+ +  + R+LRSS    +++ +  +  +++     S  
Sbjct: 270 QAALALRNLASDERYQIEIVQSNALPSLLRLLRSSYLPLILASVACIRNISIHPLNESPI 329

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSE-NRCVLVAPESLREL 355
           +    +   + LL   +N E+Q  A+  + NLA  SE N+  ++   ++++L
Sbjct: 330 IDAGFLRPLVDLLSCTENEEIQCHAVSTLRNLAASSERNKRAIIEANAIQKL 381



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + + ++ ++ +  L    + E+QR A  A+GNLA  +EN+ ++
Sbjct: 63  LQRSAALAFAEITEKDVREVDRETIEPVLFLLQSPDAEIQRAASVALGNLAVNAENKALV 122

Query: 329 VAPESLRELLLRLTASSEPRVSKAAARA---LAILGENE 436
           V    L +LL+R   S    V   A      LA L EN+
Sbjct: 123 VKLNGL-DLLIRQMMSPHVEVQCNAVGCITNLATLDENK 160



>pir|T40294|T40294 hypothetical protein SPBC354.14c - fission yeast 
           (Schizosaccharomyces pombe)
          Length = 555

 Score = 37.4 bits (85), Expect = 0.57
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 1/112 (0%)
 Frame = +2

Query: 23  QACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQK 202
           QA  AL +LASD    +++++S+ +  + R+LRSS    +++ +  +  +++     S  
Sbjct: 275 QAALALRNLASDERYQIEIVQSNALPSLLRLLRSSYLPLILASVACIRNISIHPLNESPI 334

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSE-NRCVLVAPESLREL 355
           +    +   + LL   +N E+Q  A+  + NLA  SE N+  ++   ++++L
Sbjct: 335 IDAGFLRPLVDLLSCTENEEIQCHAVSTLRNLAASSERNKRAIIEANAIQKL 386



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/99 (32%), Positives = 49/99 (49%), Gaps = 4/99 (4%)
 Frame = +2

Query: 152 LQVLAKLALASDTVSQ-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVL 328
           LQ  A LA A  T    + + ++ ++ +  L    + E+QR A  A+GNLA  +EN+ ++
Sbjct: 68  LQRSAALAFAEITEKDVREVDRETIEPVLFLLQSPDAEIQRAASVALGNLAVNAENKALV 127

Query: 329 VAPESLRELLLRLTASSEPRVSKAAARA---LAILGENE 436
           V    L +LL+R   S    V   A      LA L EN+
Sbjct: 128 VKLNGL-DLLIRQMMSPHVEVQCNAVGCITNLATLDENK 165



>gb:BC039312_1982540 Homo sapiens armadillo repeat containing 3,
           mRNA (cDNA clone MGC:39786 IMAGE:5296302), complete cds.
          Length = 872

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  +A+D      L  +  +  + ++L +    ++ I  L V+A      DT+ Q 
Sbjct: 211 ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQI 270

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L        P++Q+ A  A+   A+  ENR  L   + + + L+ L  S  
Sbjct: 271 QQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENR-KLFHEQEVEKCLVALLGSEN 329

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ + EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 330 DGTKIAASQAISAMCENSGSKDFFNNQGIP-QLIQLLKSDNEEVREAAALAL 380



>gb:AL139815_1920815 Human DNA sequence from clone RP11-300B11 on
           chromosome 10 Contains the 3' end of a novel gene
           (FLJ32827) (FLJ25845), complete sequence.
          Length = 546

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  +A+D      L  +  +  + ++L +    ++ I  L V+A      DT+ Q 
Sbjct: 147 ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQI 206

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L        P++Q+ A  A+   A+  ENR  L   + + + L+ L  S  
Sbjct: 207 QQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENR-KLFHEQEVEKCLVALLGSEN 265

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ + EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 266 DGTKIAASQAISAMCENSGSKDFFNNQGIP-QLIQLLKSDNEEVREAAALAL 316



>gb:AL139815_1920814 Human DNA sequence from clone RP11-300B11 on
           chromosome 10 Contains the 3' end of a novel gene
           (FLJ32827) (FLJ25845), complete sequence.
          Length = 875

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  +A+D      L  +  +  + ++L +    ++ I  L V+A      DT+ Q 
Sbjct: 211 ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQI 270

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L        P++Q+ A  A+   A+  ENR  L   + + + L+ L  S  
Sbjct: 271 QQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENR-KLFHEQEVEKCLVALLGSEN 329

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ + EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 330 DGTKIAASQAISAMCENSGSKDFFNNQGIP-QLIQLLKSDNEEVREAAALAL 380



>gb:AK057389_1912014 Homo sapiens cDNA FLJ32827 fis, clone
           TESTI2003109, weakly similar to VACUOLAR PROTEIN 8.
          Length = 669

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  +A+D      L  +  +  + ++L +    ++ I  L V+A      DT+ Q 
Sbjct: 211 ALKTLGVIANDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQI 270

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L        P++Q+ A  A+   A+  ENR  L   + + + L+ L  S  
Sbjct: 271 QQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENR-KLFHEQEVEKCLVALLGSEN 329

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ + EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 330 DGTKIAASQAISAMCENSGSKDFFNNQGIP-QLIQLLKSDNEEVREAAALAL 380



>gb:AK004793_1152599 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200015K23
           product:CDNA FLJ10859 FIS, CLONE NT2RP4001567, WEAKLY
           SIMILAR TO ARMADILLO SEGMENT POLARITY PROTEIN homolog
           [Homo sapiens], full insert sequence.
          Length = 673

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 5/131 (3%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 538 LLSTRPHIDKIMSTHGKQIMQAVTLILEGEHSIEVKEQTLCILANIADGTTAKELIMTND 597

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSE 382
           D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S++
Sbjct: 598 DILQKIKYYMGHSHVKLQLAAMFCISNLTWNEEEGSQERQDKLRDMGIVDILHKLSQSAD 657

Query: 383 PRVSKAAARAL 415
             +   A  AL
Sbjct: 658 SNLCDKAKTAL 668



 Score = 33.5 bits (75), Expect = 8.2
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 1/101 (0%)
 Frame = +2

Query: 92  IMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEVQR 271
           + +P+ +VL+++  E ++    +L  L L      + +L    ++ L  L   +NP ++ 
Sbjct: 427 VWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRV 486

Query: 272 LALFAVGNLAFCSENRCVLVAPESL-RELLLRLTASSEPRV 391
             ++A+ N+AF +E +       SL  E L RL + S+  V
Sbjct: 487 NGIWALMNMAFQAEQKIKADILRSLSTEQLFRLLSDSDMNV 527



>gb:AY596297_633777 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 544

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 37/150 (24%), Positives = 65/150 (43%), Gaps = 6/150 (4%)
 Frame = +2

Query: 17  VEQACSALTSLASDVSVAMQ-LMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTV 193
           V  A + + +L++D       L+  D+   +E + R+   E V  + +  A   LA  TV
Sbjct: 393 VGTARTVILALSADTDTEFATLVIRDLNPDVEIIARAEESENVQKMYRAGADYVLALSTV 452

Query: 194 SQKMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAF-----CSENRCVLVAPESLRELL 358
           S +ML   +L+   ++   +  EV R+A   +GN         S   C +VA E    ++
Sbjct: 453 SGRMLASTILEDEDVISMDQQVEVIRVAANGLGNTTIGEADVRSRTGCTVVAIERNGAVI 512

Query: 359 LRLTASSEPRVSKAAARALAILGENEVLRR 448
             L+    P V+      L I G ++ + R
Sbjct: 513 TDLS----PDVTIEPTDKLVIAGTDDGVTR 538



>gb:CR378672_96256 Photobacterium profundum SS9; segment 10/12.
          Length = 374

 Score = 37.0 bits (84), Expect = 0.74
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +2

Query: 491 LSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL 634
           L + GGG +    V +LK I +   +  H  F + CGTS GG+ A+A+
Sbjct: 10  LLLTGGGARAAYQVGVLKAIAEWYPRVHHSPFSIYCGTSAGGINAIAI 57



>gb:AK024430_1909995 Homo sapiens mRNA for FLJ00019 protein, partial
           cds.
          Length = 732

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 4/142 (2%)
 Frame = +2

Query: 218 VLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSEP 385
           +L  + +L   K   VQ     A+GNLA     C +  C    P     L+  LTA  + 
Sbjct: 162 ILPLVTILQCMKTDSVQNRTARALGNLAMEPESCGDIHCAGAVPL----LVESLTACQDS 217

Query: 386 RVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTG 565
           +  ++  RAL  L ++   R A+  +   +    +L+        LA VR L E+ +G  
Sbjct: 218 QCLQSVVRALRNLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLELSRGCS 277

Query: 566 KRIHELFDLICGTSTGGMLAVA 631
           +   E   L  G   G ++++A
Sbjct: 278 RACAEQLSL--GGGLGPLVSLA 297



>gb:AY217348_1939458 Homo sapiens FLJ00019-like protein mRNA,
           complete cds.
          Length = 725

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 4/142 (2%)
 Frame = +2

Query: 218 VLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSEP 385
           +L  + +L   K   +Q     A+GNLA     C +  C    P     L+  LTA  + 
Sbjct: 155 ILPLVTILQCMKTDSIQNRTARALGNLAMEPESCGDIHCAGAVPL----LVESLTACQDS 210

Query: 386 RVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTG 565
           +  ++  RAL  L ++   R A+  +   +    +L+        LA VR L E+ +G  
Sbjct: 211 QCLQSVVRALRNLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLELSRGCS 270

Query: 566 KRIHELFDLICGTSTGGMLAVA 631
           +   E   L  G   G ++++A
Sbjct: 271 RACAEQLSL--GGGLGPLVSLA 290



>gb:AX877739_1477138 Sequence 12644 from Patent
           EP1074617.>gb:AK001882_1908705 Homo sapiens cDNA
           FLJ11020 fis, clone PLACE1003625, weakly similar to
           ARMADILLO SEGMENT POLARITY PROTEIN.
          Length = 431

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 5/132 (3%)
 Frame = +2

Query: 35  ALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLT 211
           +L S    +   M      IMQ +  +L      EV    L +LA +A  +      M  
Sbjct: 295 SLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTN 354

Query: 212 KDVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASS 379
            D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S 
Sbjct: 355 DDILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSP 414

Query: 380 EPRVSKAAARAL 415
           +  +   A  AL
Sbjct: 415 DSNLCDKAKMAL 426



>gb:CP000030_83309 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 288

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 16/36 (44%), Positives = 25/36 (69%)
 Frame = +2

Query: 536 ILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGIK 643
           +L E+E+  GK   E+FDL  G+S G ++AVAL ++
Sbjct: 1   MLYEVEQRLGKPAGEVFDLFVGSSVGAIIAVALALR 36



>gb:BC041699_1983111 Homo sapiens armadillo repeat containing 8,
           mRNA (cDNA clone MGC:48800 IMAGE:5240423), complete cds.
          Length = 659

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 524 LLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTND 583

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSE 382
           D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S +
Sbjct: 584 DILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPD 643

Query: 383 PRVSKAAARAL 415
             +   A  AL
Sbjct: 644 SNLCDKAKMAL 654



>gb:BC032661_1980602 Homo sapiens armadillo repeat containing 8,
           mRNA (cDNA clone MGC:45133 IMAGE:5530425), complete cds.
          Length = 659

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 524 LLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTND 583

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSE 382
           D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S +
Sbjct: 584 DILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPD 643

Query: 383 PRVSKAAARAL 415
             +   A  AL
Sbjct: 644 SNLCDKAKMAL 654



>gb:AB070084_1870955 Macaca fascicularis testis cDNA
           clone:QtsA-12696, full insert sequence.
          Length = 546

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 37/172 (21%), Positives = 74/172 (43%), Gaps = 1/172 (0%)
 Frame = +2

Query: 26  ACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEV-ISVLQVLAKLALASDTVSQK 202
           A   L  + +D      L  +  +  + ++L +    ++ I  L V+A      DT+ Q 
Sbjct: 147 ALKTLGVITNDKESRTMLRDNQGLDHLIKILETKELNDLHIEALAVIANCLEDMDTMVQI 206

Query: 203 MLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSE 382
             T  + K L        P++Q+ A  A+   A+  ENR  L   + + + L+ L  S  
Sbjct: 207 QQTGGLKKLLSFAENSTIPDIQKNAAKAITKAAYDPENR-KLFHEQEVEKCLVALLGSEN 265

Query: 383 PRVSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRI 538
                AA++A++ + EN   +     + +P Q +++L  D   ++  A + +
Sbjct: 266 DGTKIAASQAISAMCENSGSKDFFNNQGIP-QLIQLLKSDNEEVREAAALAL 316



 Score = 33.9 bits (76), Expect = 6.3
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 4/137 (2%)
 Frame = +2

Query: 17  VEQACSALTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVS 196
           +  A + LT++A    + + +   DIM  I   LRS+    V+     LA  A A D  +
Sbjct: 351 IANAATVLTNMAMQEPLRLNIQNHDIMHAIISPLRSA--NTVVQSKAALAVAATACDVEA 408

Query: 197 Q-KMLTKDVLKSLKLLCAHKNPEVQRLALFAVGNLA---FCSENRCVLVAPESLRELLLR 364
           + ++     L+ L  L   KN EV++ A +AV   A     +   C L A + L E  + 
Sbjct: 409 RTELRNSGGLEPLVELLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEE--VN 466

Query: 365 LTASSEPRVSKAAARAL 415
           L+ +   + S+AA   L
Sbjct: 467 LSGTRRNKFSEAAYNKL 483



>gb:AP004667_1842958 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0433E10.>gb:AP005158_1848423 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0007M04.
          Length = 298

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 39/153 (25%), Positives = 55/153 (35%), Gaps = 11/153 (7%)
 Frame = -3

Query: 687 PRSLYTSSHFSKDISLIPRATASMPPVDVPQIRSKSSCIRFPVPFSISL----------- 541
           P  L  SSH   ++ L   A    PPV  P        +R P P S +L           
Sbjct: 63  PPPLVVSSH---NLPLSSAAAPPRPPVPPPAPLPLPVLLRSPPPASSTLPRLHDRSSPRL 119

Query: 540 RILTVARPFIPPPSIESMRNPCLGTCLTRIARRRTSFSPRIXXXXXXXXLTRGSDEAVRR 361
           R+  VARP  PP      R   + +     A  R S +PR+         +  +  A   
Sbjct: 120 RLTAVARPRSPPQPAAVARPRLVAS-----ATGRRSSAPRLALPPQPVAASSATASAANH 174

Query: 360 RRSSLKLSGATRTHRFSEQKAKFPTANKANLCT 262
           RRSS     + R H  S  + +   A +  L +
Sbjct: 175 RRSSAPRLASPRLHDQSPPRPRPTAATRPRLAS 207



>gb:CR860412_1184482 Pongo pygmaeus mRNA; cDNA DKFZp459B111 (from
           clone DKFZp459B111).
          Length = 673

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 538 LLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTND 597

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSE 382
           D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S +
Sbjct: 598 DILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPD 657

Query: 383 PRVSKAAARAL 415
             +   A  AL
Sbjct: 658 SNLCDKAKMAL 668



>gb:AE017250_416487 Treponema denticola ATCC 35405, section 5 of 10
           of the complete genome.>gb:AE017226_1070083 Treponema
           denticola ATCC 35405, complete genome.
          Length = 258

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 34/107 (31%), Positives = 48/107 (44%), Gaps = 12/107 (11%)
 Frame = +2

Query: 389 VSKAAARALAILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGL-------ATVRILKE 547
           +SK +A ALA +   EV      V ++ K+G  I   D GG K L        TV I+  
Sbjct: 153 ISKVSAGALAWVPFVEVTNLVRTVERLKKEGFWIYGADAGG-KALPNLTFPKKTVLIMGN 211

Query: 548 IEKGTGKRIHELFDLICGTSTGGML-----AVALGIKLMSLEKCEEV 673
             +G  + + E  D I    T G L     +VA GI L  + + +EV
Sbjct: 212 EGRGMSRLVEETCDEIVSIPTKGKLDSLNVSVAAGILLYEISRKKEV 258



>gb:AE016919_357676 Chromobacterium violaceum ATCC 12472 section 10
           of 16 of the complete genome.>gb:AE016825_1042830
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 778

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 38/141 (26%), Positives = 67/141 (47%), Gaps = 6/141 (4%)
 Frame = +2

Query: 464 QVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLA--VALG 637
           QVP +G+ ++ + GGG +G A + +LKE+E     R+      I GTS G ++    A G
Sbjct: 69  QVP-EGVGVV-LGGGGARGFAHLGVLKELE-----RLRIPVACIAGTSAGALIGGIYANG 121

Query: 638 IKLMSLEKCEEVYKDLGKLVFAEP----VPKDNEAASWREKLDQLYKSSSQSFRVVVHGS 805
           + L  +E+ E    D  +++  +P    +P D +   ++  LD  +     + R  V  S
Sbjct: 122 LPLDEMER-EFNAADWDQMLSGKPARADIPYDRKRNDYQNYLDVSFGLKGGALR--VPRS 178

Query: 806 KHSADQFERLLRELCTDEDGD 868
             ++   E  + +L  D D D
Sbjct: 179 AINSQGIELYIHKLTRDRDID 199



>pir|T12513|T12513 hypothetical protein DKFZp434A043.1 -
           human>gb:HSM800635_2017170 Homo sapiens mRNA; cDNA
           DKFZp434A043 (from clone DKFZp434A043); partial cds.
          Length = 242

 Score = 35.4 bits (80), Expect = 2.2
 Identities = 31/131 (23%), Positives = 55/131 (41%), Gaps = 5/131 (3%)
 Frame = +2

Query: 38  LTSLASDVSVAMQLMKSDIMQPIERVLRSSRPEEVIS-VLQVLAKLALASDTVSQKMLTK 214
           L S    +   M      IMQ +  +L      EV    L +LA +A  +      M   
Sbjct: 107 LLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIADGTTAKDLIMTND 166

Query: 215 DVLKSLKLLCAHKNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSE 382
           D+L+ +K    H + ++Q  A+F + NL +     S+ R   +    + ++L +L+ S +
Sbjct: 167 DILQKIKYYMGHSHVKLQLAAMFCISNLIWNEEEGSQERQDKLRDMGIVDILHKLSQSPD 226

Query: 383 PRVSKAAARAL 415
             +   A  AL
Sbjct: 227 SNLCDKAKMAL 237



>pir|F86373|F86373 protein T23E23.12 [imported] - Arabidopsis
           thaliana>gb:AE005172_891348 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC002423_1530729 Genomic sequence for
           Arabidopsis thaliana BAC T23E23, complete sequence.
          Length = 711

 Score = 35.0 bits (79), Expect = 2.8
 Identities = 26/63 (41%), Positives = 32/63 (50%)
 Frame = +2

Query: 218 VLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSK 397
           V KSLK    H N  V  LALFA+GN+  CS      +APE     + RL    +P + K
Sbjct: 436 VTKSLKQDLNHSNQYVVGLALFALGNI--CSAEMAPDLAPE-----VERLVQFRDPNIRK 488

Query: 398 AAA 406
            AA
Sbjct: 489 KAA 491



>gb:BC080884_2561799 Xenopus tropicalis MGC79473 protein, mRNA (cDNA
           clone MGC:79473 IMAGE:6976322), complete cds.
          Length = 275

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%)
 Frame = +2

Query: 176 LASDTVSQKMLTKD--VLKSLKLLCAHKNPEVQRLALFAVGNLAFCSEN----RCVLVAP 337
           LASD ++++ + +D   L  L L   H NP+V   AL A+  LA C  N    RC L   
Sbjct: 17  LASDPLNRRAIVQDQGCLPGLILFLDHPNPQVVYSALLALRYLAECLSNREKMRCELGMM 76

Query: 338 ESLRELLLRLTASSEPRV 391
            SL+ ++ + T   + ++
Sbjct: 77  LSLQNVIQKTTTPGDTQL 94



>gb:BC076810_2559553 Xenopus laevis MGC83766 protein, mRNA (cDNA
           clone MGC:83766 IMAGE:6640807), complete cds.
          Length = 234

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (7%)
 Frame = +2

Query: 176 LASDTVSQKMLTKD--VLKSLKLLCAHKNPEVQRLALFAVGNLAFCSEN----RCVLVAP 337
           LASD ++++ + +D   L  L L   H NP+V   AL A+  LA C  N    RC L   
Sbjct: 17  LASDPLNRRAIVQDHGCLPGLILFLDHPNPQVVYSALLALRYLAECRANREKMRCELGMM 76

Query: 338 ESLRELLLRLTASSEPRV 391
            SL+ ++ + T   + ++
Sbjct: 77  LSLQNVIQKTTTPGDTQL 94



>gb:AC004812_1874681 Homo sapiens PAC clone 267D11 from 12, complete
           sequence.
          Length = 2392

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
 Frame = +2

Query: 83  KSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPE 262
           K  I+  I++ L  S PE VI  +  L    LAS T+       D++K L       +P 
Sbjct: 16  KDLILPTIQKSLLRS-PENVIETISSL----LASVTLDLSQYAMDIVKGLAGHLKSNSPR 70

Query: 263 VQRLALFAVGNLA-FCSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEV 439
           +   A+ A+ NLA  CS++     A ESL + L  +   SE +++  A +   + G   V
Sbjct: 71  LMDEAVLALRNLARQCSDSS----AMESLTKHLFAILGGSEGKLTVVAQKMSVLSGIGSV 126

Query: 440 LRRAI 454
               +
Sbjct: 127 SHHVV 131



>gb:BX294137_766397 Pirellula sp. strain 1 complete genome; segment
           5/24.
          Length = 644

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 6/118 (5%)
 Frame = +2

Query: 164 AKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEVQRL-ALFAVGNLAFC--SENRCVLVA 334
           +++A   DT +  ++  +      L   +   +++R  AL A  ++A    S NR  + A
Sbjct: 487 SEIASYIDTANIAVMPWEQANKALLSAINSGDKLERYWALVAASSIAAWNRSANRD-MAA 545

Query: 335 PESLRELLLRLTASSEPRVSKAAARALAILGENE---VLRRAIRVRQVPKQGLRILSM 499
            E+  +LL R T  +EP V+  AA+  AIL   +   + +R + + Q P + L+I +M
Sbjct: 546 DETFVKLLHRRTLDTEPLVASRAAQLAAILQVEDPRPIFQRTLELSQSPTEALQIFNM 603



>gb:AE017279_426100 Bacillus cereus ATCC 10987, section 16 of 18 of
           the complete genome.>gb:AE017194_1064519 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 259

 Score = 34.7 bits (78), Expect = 3.7
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +2

Query: 491 LSMDGGGMKGLATVRILKEIEKGTGKRIHEL-FDLICGTSTGGMLA--VALGIKLMSLE 658
           L++ GG ++GLA + +LK ++K      H +  D I GTS GG +   +A GI +  +E
Sbjct: 5   LALGGGAVRGLAHIGVLKVLKK------HNIPIDFIAGTSMGGAIGGLIAAGIDVEEIE 57



>gb:D86973_1995190 Human mRNA for KIAA0219 gene, partial cds.
          Length = 2675

 Score = 34.3 bits (77), Expect = 4.8
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
 Frame = +2

Query: 83  KSDIMQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPE 262
           K  I+  I++ L  S PE VI  +  L    LAS T+       D++K L       +P 
Sbjct: 263 KDLILPTIQKSLLRS-PENVIETISSL----LASVTLDFSQYAMDIVKGLAGHLKSNSPR 317

Query: 263 VQRLALFAVGNLA-FCSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENEV 439
           +   A+ A+ NLA  CS++     A ESL + L  +   SE +++  A +   + G   V
Sbjct: 318 LMDEAVLALRNLARQCSDSS----AMESLTKHLFAILGGSEGKLTVVAQKMSVLSGIGSV 373

Query: 440 LRRAI 454
               +
Sbjct: 374 SHHVV 378



>gb:AC091123_1734627 Oryza sativa chromosome 3 BAC OSJNBb0093E13
           genomic sequence, complete sequence.
          Length = 462

 Score = 34.3 bits (77), Expect = 4.8
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 9/58 (15%)
 Frame = +2

Query: 488 ILSMDGGG------MKGLATVRILKEIEKGTGK---RIHELFDLICGTSTGGMLAVAL 634
           +LS+DGGG      + G A V +   + + TG    R+ + FD+  G+  GG+LA  L
Sbjct: 68  VLSIDGGGRAADGLLAGAALVSLEASLRRRTGDETARLADFFDVAAGSGAGGVLAAML 125



>gb:AY596293_630857 Haloarcula marismortui ATCC 43049 plasmid
           pNG400, complete sequence.
          Length = 374

 Score = 34.3 bits (77), Expect = 4.8
 Identities = 27/88 (30%), Positives = 41/88 (46%)
 Frame = +2

Query: 257 PEVQRLALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGENE 436
           P V+  A  A G L   S+ R V    E L +           +V +AAA AL  +G + 
Sbjct: 113 PRVRTRAAQACGRL---SDPRVVPPLSERLSD--------GRQQVREAAANALGAIGTDR 161

Query: 437 VLRRAIRVRQVPKQGLRILSMDGGGMKG 520
            L   + V Q  ++GLR++++D  G  G
Sbjct: 162 ALAELVPVTQADEEGLRLIAVDELGQFG 189



>gb:AE016921_358155 Chromobacterium violaceum ATCC 12472 section 12
           of 16 of the complete genome.>gb:AE016825_1043309
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 379

 Score = 34.3 bits (77), Expect = 4.8
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = +2

Query: 491 LSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVAL----GIKLMSLE 658
           L + GGG +    V +L  I +      H  F +ICGTS G + AVAL    G   +++ 
Sbjct: 9   LVLSGGGARAAYQVGVLLGIARLLPDPRHNPFPIICGTSAGAINAVALASGAGNYQLAVS 68

Query: 659 KCEEVYKDL 685
              +V+K L
Sbjct: 69  TLAKVWKQL 77



>gb:BC014945_1974847 Homo sapiens armadillo repeat containing 5,
           mRNA (cDNA clone MGC:22948 IMAGE:4860377), complete cds.
          Length = 771

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 4/131 (3%)
 Frame = +2

Query: 251 KNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALA 418
           K   +Q     A+GNLA     C +  C    P     L+  LTA  + +  ++  RAL 
Sbjct: 2   KTDSIQNRTARALGNLAMEPESCGDIHCAGAVPL----LVESLTACQDSQCLQSVVRALR 57

Query: 419 ILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLIC 598
            L ++   R A+  +   +    +L+        LA VR L E+ +G  +   E   L  
Sbjct: 58  NLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLELSRGCSRACAEQLSL-- 115

Query: 599 GTSTGGMLAVA 631
           G   G ++++A
Sbjct: 116 GGGLGPLVSLA 126



>gb:AY099742_1576767 Arabidopsis thaliana putative protein
           (At3g53560) mRNA, complete cds.>gb:BT000274_1634552
           Arabidopsis thaliana putative protein (At3g53560) mRNA,
           complete cds.
          Length = 340

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 22/102 (21%)
 Frame = -3

Query: 711 TGSANTSFPRSLY-----------------TSSHFSKDISLIPRATASMPPVDVPQIRSK 583
           T +++++FP++L+                 +SS F   I+ +P++T        P    K
Sbjct: 19  THTSSSTFPKNLFKSSIQPISSLKSASIKASSSKFQNSITPLPKST--------PFRLFK 70

Query: 582 SSCIRFPVPFSISLRIL-----TVARPFIPPPSIESMRNPCL 472
           S+CI      ++ L  L      +A P  PPPS+ES  N  L
Sbjct: 71  STCITLTTAAALLLANLHLKSPAIAAPIAPPPSVESKENVTL 112



>gb:AX880179_1478161 Sequence 15084 from Patent
           EP1074617.>gb:AK023125_1909485 Homo sapiens cDNA
           FLJ13063 fis, clone NT2RP3001678.
          Length = 502

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 4/131 (3%)
 Frame = +2

Query: 251 KNPEVQRLALFAVGNLAF----CSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALA 418
           K   +Q     A+GNLA     C +  C    P     L+  LTA  + +  ++  RAL 
Sbjct: 2   KTDSIQNRTARALGNLAMEPESCGDIHCAGAVPL----LVESLTACQDSQCLQSVVRALR 57

Query: 419 ILGENEVLRRAIRVRQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLIC 598
            L ++   R A+  +   +    +L+        LA VR L E+ +G  +   E   L  
Sbjct: 58  NLADSPQHRLALAQQGAVRPLAELLATAPDAALTLALVRALLELSRGCSRACAEQLSL-- 115

Query: 599 GTSTGGMLAVA 631
           G   G ++++A
Sbjct: 116 GGGLGPLVSLA 126



>gb:AE017178_398005 Porphyromonas gingivalis W83 section 7 of 8 of
           the complete genome.>gb:AE015924_1033616 Porphyromonas
           gingivalis W83 complete genome.
          Length = 339

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 16/50 (32%), Positives = 31/50 (62%)
 Frame = +2

Query: 491 LSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGI 640
           L  +GGG+KG+A +  L+ +++   ++I      + GTS G ++AV +G+
Sbjct: 8   LVFEGGGVKGIAYIGALEVLQE---EKIFPKIKRVAGTSAGAIMAVLIGL 54



>pir|T45896|T45896 hypothetical protein F4P12.260 - Arabidopsis
           thaliana>gb:ATF4P12_1550741 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F4P12.
          Length = 388

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 27/102 (26%), Positives = 45/102 (44%), Gaps = 22/102 (21%)
 Frame = -3

Query: 711 TGSANTSFPRSLY-----------------TSSHFSKDISLIPRATASMPPVDVPQIRSK 583
           T +++++FP++L+                 +SS F   I+ +P++T        P    K
Sbjct: 67  THTSSSTFPKNLFKSSIQPISSLKSASIKASSSKFQNSITPLPKST--------PFRLFK 118

Query: 582 SSCIRFPVPFSISLRIL-----TVARPFIPPPSIESMRNPCL 472
           S+CI      ++ L  L      +A P  PPPS+ES  N  L
Sbjct: 119 STCITLTTAAALLLANLHLKSPAIAAPIAPPPSVESKENVTL 160



>pir|T06725|T06725 hypothetical protein F28P10.70 - Arabidopsis
           thaliana>gb:ATF28P10_1550401 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28P10.
          Length = 488

 Score = 33.9 bits (76), Expect = 6.3
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 7/56 (12%)
 Frame = +2

Query: 488 ILSMDGGGMKGLATVRILKEIEKG-------TGKRIHELFDLICGTSTGGMLAVAL 634
           ILS+DGGGM+G+   + L  +E            RI + FD+  G+  GG+    L
Sbjct: 100 ILSIDGGGMRGILPGKALAYLEHALKSKSGDPNARIADYFDVAAGSGIGGIYTAML 155



>gb:AF466017_2496350 Xenopus laevis amadillo repeat-containing
           protein mRNA, complete cds.
          Length = 275

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +2

Query: 176 LASDTVSQKMLTKD--VLKSLKLLCAHKNPEVQRLALFAVGNLAFCSENR 319
           LASD ++++ + +D   L  L L   H NP+V   AL A+  LA C  NR
Sbjct: 17  LASDPLNRRAIVQDQGCLPGLILFLDHPNPQVVHSALLALRYLAECRTNR 66



>gb:AY271826_1941553 Homo sapiens ZYG-11A early embryogenesis
           protein mRNA, complete cds.
          Length = 417

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 24/90 (26%), Positives = 48/90 (53%)
 Frame = +2

Query: 95  MQPIERVLRSSRPEEVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEVQRL 274
           +Q +E    S+   +V+ +L  +A++      +S K++T+DVLK +  L   +  EV   
Sbjct: 222 IQVLETFSESAIQSKVLGLLNNIAEVR----ELSSKLVTEDVLKHINSLLCSREMEV--- 274

Query: 275 ALFAVGNLAFCSENRCVLVAPESLRELLLR 364
           + FA G +A  + +R + ++ +  R  LL+
Sbjct: 275 SYFAAGIIAHLTSDRQLWISRDFQRRTLLQ 304



>gb:AF539794_1906426 Homo sapiens striated muscle UNC45 (UNC45) mRNA,
            complete cds.
          Length = 931

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 33/137 (24%), Positives = 67/137 (48%), Gaps = 2/137 (1%)
 Frame = +2

Query: 89   DIMQPIERVLRSSRPE-EVISVLQVLAKLALASDTVSQKMLTKDVLKSLKLLCAHKNPEV 265
            ++++P+ R+L + R   +    L  L  L+  SD + QK+  +  L  ++      + ++
Sbjct: 718  EVVRPLVRLLDTQRDGLQNYEALLGLTNLSGRSDKLRQKIFKERALPDIENYMFENHDQL 777

Query: 266  QRLALFAVGNLAFCSENRCVLVAPESLR-ELLLRLTASSEPRVSKAAARALAILGENEVL 442
            ++ A   + N+    E +   +A  + R +L++ L    + +V  AAA ALA+L      
Sbjct: 778  RQAATECMCNMVLHKEVQERFLADGNDRLKLVVLLCGEDDDKVQNAAAGALAMLTAAH-K 836

Query: 443  RRAIRVRQVPKQGLRIL 493
            +  +++ QV  Q L IL
Sbjct: 837  KLCLKMTQVTTQWLEIL 853



>gb:AP005609_1854849 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0014M17.
          Length = 442

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
 Frame = +2

Query: 272 LALFAVGNLAFCSENRCVLVAPESLRELLLRLTASSEPRVSKAAARALAILGEN----EV 439
           LA+ A+ +L  C+E R  LVA  +   ++ +      P  +++A RAL  +  N     V
Sbjct: 327 LAVVAIDHLCGCAEGRSELVAHPAGLAVVSKRAMRVSPAATESAVRALHAVARNAATPAV 386

Query: 440 LRRAIRVRQVPKQGLRILSMDGG 508
           L+  + V  V K  L +L  DGG
Sbjct: 387 LQEMLAVGVVAKL-LLVLQADGG 408



>gb:AY273870_605025 Pseudomonas aeruginosa PA14 pathogenicity island
           PAPI-2, complete sequence.
          Length = 105

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 25/75 (33%), Positives = 35/75 (46%)
 Frame = -3

Query: 648 ISLIPRATASMPPVDVPQIRSKSSCIRFPVPFSISLRILTVARPFIPPPSIESMRNPCLG 469
           + L  +A AS PP +    +S+SSCI   V  + SL    +A+   PP      RNP L 
Sbjct: 15  VGLAQQAAAS-PPAESHSEQSESSCIDVQVNGARSLSYNCMAQQMTPPKEDPRRRNPTLN 73

Query: 468 TCLTRIARRRTSFSP 424
           + L   + R T   P
Sbjct: 74  STLA--SERATRLPP 86



>gb:CR378673_96475 Photobacterium profundum SS9; segment 11/12.
          Length = 776

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 33/123 (26%), Positives = 50/123 (40%)
 Frame = +2

Query: 461 RQVPKQGLRILSMDGGGMKGLATVRILKEIEKGTGKRIHELFDLICGTSTGGMLAVALGI 640
           ++ PK G+    + GGG KG A + +LK +E+     +H   D I GTS G  +   L  
Sbjct: 42  KERPKIGV---VLGGGGAKGAAHIGVLKALEE-----MHIPIDYIAGTSMGAYVG-GLYA 92

Query: 641 KLMSLEKCEEVYKDLGKLVFAEPVPKDNEAASWREKLDQLYKSSSQSFRVVVHGSKHSAD 820
             MS ++ E                   E  +WR+      K S +  R      KH  D
Sbjct: 93  SGMSADEIESFL----------------ETINWRDGYQDGVKRSDRRVR-----EKHQED 131

Query: 821 QFE 829
           +F+
Sbjct: 132 RFQ 134


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,088,164,875
Number of Sequences: 1806583
Number of extensions: 21535208
Number of successful extensions: 68915
Number of sequences better than 10.0: 180
Number of HSP's better than 10.0 without gapping: 65558
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68775
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 89634994801
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)