BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4144
         (1413 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003350_1828546 Oryza sativa (japonica cultivar-group) genom...   221   2e-56   
gb:AE005173_892639 Arabidopsis thaliana chromosome 1, bottom arm...   217   5e-55   
pir|T52396|T52396 formin-binding protein homolog [imported] - Ar...   190   7e-47   Arabidopsis thaliana [mouse-ear cress]
gb:T12C22_1723351 Sequence of BAC T12C22 from Arabidopsis thalia...   138   2e-31   
gb:AE014134_1127291 Drosophila melanogaster chromosome 2L, compl...    88   5e-16   
gb:AE014134_1127290 Drosophila melanogaster chromosome 2L, compl...    88   5e-16   
gb:BC051961_2100863 Mus musculus RIKEN cDNA 2610317D23 gene, mRN...    78   4e-13   
pir|T38804|T38804 hypothetical WW domain-containing protein - fi...    78   4e-13   Schizosaccharomyces pombe
gb:AF135440_2055919 Mus musculus huntington yeast partner C (Hyp...    78   5e-13   
gb:AF155096_1886608 Homo sapiens NY-REN-6 antigen mRNA, partial ...    77   9e-13   
sp|Q9R1C7|FNB3_MOUSE|FNB3_MOUSE Formin binding protein 3 (Formin binding pr...    77   9e-13   Mus musculus [mouse]
sp|O75400|FNB3_HUMAN|FNB3_HUMAN Formin binding protein 3 (Huntingtin yeast ...    77   9e-13   Homo sapiens [man]
gb:BC067364_1987312 Homo sapiens Huntingtin interacting protein ...    77   1e-12   
gb:BC050398_1984321 Homo sapiens Huntingtin interacting protein ...    77   1e-12   
gb:HSM802172_1186623 Homo sapiens mRNA; cDNA DKFZp434H2121 (from...    77   1e-12   
pir|T46402|T46402 hypothetical protein DKFZp434H2121.1 - human (...    77   1e-12   Homo sapiens [man]
gb:BC049307_2550165 Danio rerio formin binding protein 3, mRNA (...    75   3e-12   
gb:AB057590_2462762 Gallus gallus mRNA for formin binding protei...    75   3e-12   
gb:AB035521_2461642 Gallus gallus FBP mRNA for formin binding pr...    75   3e-12   
gb:HSM805637_1187637 Homo sapiens mRNA; cDNA DKFZp434O1520 (from...    73   2e-11   
gb:AX881482_1478638 Sequence 16387 from Patent EP1074617.              72   2e-11   
pir|S40923|S40923 hypothetical protein ZK1098.1 - Caenorhabditis...    60   8e-08   Caenorhabditis elegans [roundworm]
sp|P34600|YO61_CAEEL|YO61_CAEEL Hypothetical 84.7 kDa protein ZK1098.1 in c...    60   8e-08   Caenorhabditis elegans [roundworm]
gb:PFMAL13_1191237 Plasmodium falciparum 3D7 chromosome 13, *** ...    54   1e-05   
gb:AK051375_1169665 Mus musculus 12 days embryo spinal ganglion ...    54   1e-05   
gb:AK041205_1165908 Mus musculus adult male aorta and vein cDNA,...    51   5e-05   
gb:AK027117_1910816 Homo sapiens cDNA: FLJ23464 fis, clone HSI09...    49   2e-04   
gb:CR382130_1662421 Yarrowia lipolytica chromosome D of strain C...    49   3e-04   
gb:AE016817_1747544 Ashbya gossypii (= Eremothecium gossypii) AT...    45   0.005   
gb:CR380958_1653304 Candida glabrata strain CBS138 chromosome L ...    40   0.090   
pir|S54157|S54157 extensin-like protein - cowpea (fragment)            40   0.12    Vigna unguiculata
gb:BC040284_2098497 Mus musculus transcription elongation regula...    38   0.45    
gb:BC039185_2098376 Mus musculus transcription elongation regula...    38   0.45    
gb:AB023485_2044268 Mus musculus mRNA for transcription factor C...    38   0.45    
pir|T08599|T08599 probable transcription factor CA150 - human>gb...    38   0.45    Homo sapiens [man]
gb:BC082994_2108466 Mus musculus RIKEN cDNA 2610317D23 gene, mRN...    37   0.99    
gb:AF067514_1880538 Homo sapiens PITSLRE protein kinase alpha SV...    37   0.99    
gb:HSU07705_2021820 Human protein kinase PITSLRE isoform PBETA22...    37   1.3     
gb:BT015197_1358274 Drosophila melanogaster RE71183 full insert ...    36   1.7     
gb:AE014296_1136106 Drosophila melanogaster chromosome 3L, compl...    36   1.7     
gb:BC085869_2109428 Rattus norvegicus similar to CBF1 interactin...    36   2.2     
gb:CDC2L1S13_1992077 Homo sapiens PITSLRE protein kinase (CDC2L1...    36   2.2     
gb:HSU04817_2021584 Human protein kinase PITSLRE alpha 2-3 mRNA,...    35   2.9     
gb:HSU04816_2021583 Human protein kinase PITSLRE alpha 2-2 mRNA,...    35   2.9     
gb:BC052920_2101359 Mus musculus cell division cycle 2-like 1, m...    35   3.8     
gb:CDC2L1S13_1992074 Homo sapiens PITSLRE protein kinase (CDC2L1...    35   3.8     
gb:BC009375_1971950 Homo sapiens cell division cycle 2-like 1 (P...    35   3.8     
gb:AF067516_1880540 Homo sapiens PITSLRE protein kinase alpha SV...    35   3.8     
gb:AF067512_1880536 Homo sapiens PITSLRE protein kinase alpha SV...    35   3.8     
gb:AK077668_1171993 Mus musculus 8 days embryo whole body cDNA, ...    35   3.8     
pir|A55817|A55817 cyclin-dependent kinase p130-PITSLRE - mouse>g...    35   3.8     Mus musculus [mouse]
sp|P21127|CDL1_HUMAN|CDL1_HUMAN PITSLRE serine/threonine-protein kinase CDC...    35   3.8     Homo sapiens [man]
gb:HSU07704_2021819 Human protein kinase PITSLRE isoform PBETA21...    35   4.9     
gb:CR382137_1670288 Debaryomyces hansenii chromosome E of strain...    35   4.9     
gb:CR380957_1652585 Candida glabrata strain CBS138 chromosome K ...    34   8.4     
gb:AX883953_1479547 Sequence 18858 from Patent EP1074617.>gb:AK0...    34   8.4     
gb:U58758_1405401 Caenorhabditis elegans cosmid ZK1127, complete...    34   8.4     
gb:U58758_1405400 Caenorhabditis elegans cosmid ZK1127, complete...    34   8.4     
gb:U58758_1405399 Caenorhabditis elegans cosmid ZK1127, complete...    34   8.4     
gb:U58758_1405398 Caenorhabditis elegans cosmid ZK1127, complete...    34   8.4     
gb:AK008283_1154485 Mus musculus adult male small intestine cDNA...    34   8.4     
pir|E88196|E88196 protein ZK1127.6 [imported] - Caenorhabditis e...    34   8.4     Caenorhabditis elegans [roundworm]
pir|F88196|F88196 protein ZK1127.9 [imported] - Caenorhabditis e...    34   8.4     Caenorhabditis elegans [roundworm]


>gb:AP003350_1828546 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0702H08.
          Length = 446

 Score =  221 bits (564), Expect = 2e-56
 Identities = 114/233 (48%), Positives = 147/233 (63%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            DDERCSRL KIDRLE+FQEYIRD                 R ERKNRD FR M+E+H+A 
Sbjct: 47   DDERCSRLEKIDRLEIFQEYIRDLEKEEEEHKRIHKEQVRRQERKNRDEFRKMLEEHVAE 106

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G +TAKT WRDYC  VK+S  Y AVASN SGS PKDLFEDV+EELE QY +DK R+K  +
Sbjct: 107  GMLTAKTRWRDYCAQVKDSSVYLAVASNISGSMPKDLFEDVMEELEKQYQDDKARIKEAV 166

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXX 873
            KS KI  +  W+ EDF+ A+ E      I+ +N++LIF+D +                  
Sbjct: 167  KSGKIPMTTSWTLEDFETAVTEDDTLKGITNINMKLIFDDQVERLREKEVKEAKKRQRLG 226

Query: 872  KDFVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
            ++F ++L +  EI+A+S+W++ K L EDS E KA+  ET  RE+FEE V  L+
Sbjct: 227  ENFSDLLYSIKEISASSTWDDSKALFEDSQEYKALDSETYSRELFEECVVHLK 279



 Score = 60.8 bits (146), Expect = 6e-08
 Identities = 25/38 (65%), Positives = 33/38 (86%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGESRRKRHKKERDASRRS 273
           RRHS +RKKS+KH H+ +SD E+R KRHKK+RD+SRR+
Sbjct: 391 RRHSSDRKKSRKHTHASDSDSENRHKRHKKDRDSSRRN 428



>gb:AE005173_892639 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC007915_1536329 Genomic sequence
            for Arabidopsis thaliana BAC F27F5 from chromosome I,
            complete sequence.
          Length = 937

 Score =  217 bits (552), Expect = 5e-55
 Identities = 115/233 (49%), Positives = 150/233 (64%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            DD+RCS L KIDRL  F+EYI D                 RAERKNRDAFR ++E+H+AA
Sbjct: 559  DDDRCSCLEKIDRLIGFEEYILDLEKEEEELKRVEKEHVRRAERKNRDAFRTLLEEHVAA 618

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G +TAKT W DYC  +K+   YQAVASNTSGSTPKDLFEDV EELE QYHEDK+ VK+ +
Sbjct: 619  GILTAKTYWLDYCIELKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQYHEDKSYVKDAM 678

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXX 873
            KS K          +FK+AI E + T  IS++NL+LI++DL+                  
Sbjct: 679  KSRK---------ANFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA 729

Query: 872  KDFVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
            ++F  +L    EIT AS+WE+ K+LVE+S E ++IG+E+  + +FEEY+T LQ
Sbjct: 730  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ 782



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 24/38 (63%), Positives = 31/38 (81%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGESRRKRHKKERDASRRS 273
           R+H  +RKKS+KHA+SPES+ E+R KR KKE  +SRRS
Sbjct: 890 RKHGNDRKKSRKHANSPESESENRHKRQKKE--SSRRS 925



>pir|T52396|T52396 formin-binding protein homolog [imported] -
            Arabidopsis thaliana>gb:AP000417_1820117 Arabidopsis
            thaliana genomic DNA, chromosome 3, P1 clone: MMB12.
          Length = 844

 Score =  190 bits (482), Expect = 7e-47
 Identities = 96/212 (45%), Positives = 135/212 (63%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            DERCSRL KID+LE+FQEY+RD                 + ERK+RD F  ++++HIA G
Sbjct: 428  DERCSRLEKIDQLEIFQEYLRDLEREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIATG 487

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             +TAKT+WRDY   VK+   Y A+ASN+SG+TPKDLFED VE+L+ + HE K+++K+VLK
Sbjct: 488  ELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKRDHELKSQIKDVLK 547

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXK 870
              K+  S   +F++FK +I E IG P I +V L+L+F+DL+                  +
Sbjct: 548  LRKVNLSAGSTFDEFKVSISEDIGFPLIPDVRLKLVFDDLLERAKEKEEKEARKQTRQTE 607

Query: 869  DFVEMLSNADEITAASSWEECKELVEDSSESK 774
              V+ML +  +ITA+SSWEE K LVE S + +
Sbjct: 608  KLVDMLRSFKDITASSSWEELKHLVEGSEKCR 639



 Score = 44.7 bits (104), Expect = 0.005
 Identities = 42/171 (24%), Positives = 64/171 (37%), Gaps = 23/171 (13%)
 Frame = -2

Query: 1157 ASNTSGSTPKDLFEDVVEEL-------ENQYHEDKTRVKN----------VLKSEKITFS 1029
            A+  SGS PK+  + +VE         E Q H++     N          +LKS K+   
Sbjct: 247  ANQGSGSGPKESQKPMVESEKVESQTEEKQIHQESFSFNNKLEAVDVFKSLLKSAKVGSD 306

Query: 1028 PLWS------FEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXKD 867
              W         D +   L T+G         Q   E L+                  +D
Sbjct: 307  WTWEQAMREIINDKRYGALRTLGERK------QAFNEFLLQTKRAAEEERLARQKKLYED 360

Query: 866  FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
            F  ML    E+T ++ W +   + ED    KA+  E   R IFE++V+ L+
Sbjct: 361  FKRMLEECVELTPSTRWSKTVTMFEDDERFKALEREKDRRNIFEDHVSELK 411



>gb:T12C22_1723351 Sequence of BAC T12C22 from Arabidopsis thaliana
            chromosome 1, complete sequence.
          Length = 919

 Score =  138 bits (348), Expect = 2e-31
 Identities = 87/233 (37%), Positives = 118/233 (50%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            DD+RCS L KIDRL  F+EYI D                     K  +  + + +     
Sbjct: 587  DDDRCSCLEKIDRLIGFEEYILDL-------------------EKEEEELKRVEK----- 622

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
                           +K+   YQAVASNTSGSTPKDLFEDV EELE Q            
Sbjct: 623  ---------------LKDLPQYQAVASNTSGSTPKDLFEDVTEELEKQ------------ 655

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXX 873
                I+    W FEDFK+AI E + T  IS++NL+LI++DL+                  
Sbjct: 656  ----ISMVSSWLFEDFKSAISEDLSTQQISDINLKLIYDDLVGRVKEKEEKEARKLQRLA 711

Query: 872  KDFVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
            ++F  +L    EIT AS+WE+ K+LVE+S E ++IG+E+  + +FEEY+T LQ
Sbjct: 712  EEFTNLLHTFKEITVASNWEDSKQLVEESQEYRSIGDESVSQGLFEEYITSLQ 764



 Score = 50.8 bits (120), Expect = 7e-05
 Identities = 24/38 (63%), Positives = 31/38 (81%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGESRRKRHKKERDASRRS 273
           R+H  +RKKS+KHA+SPES+ E+R KR KKE  +SRRS
Sbjct: 872 RKHGNDRKKSRKHANSPESESENRHKRQKKE--SSRRS 907



 Score = 37.0 bits (84), Expect = 0.99
 Identities = 13/52 (25%), Positives = 28/52 (53%)
 Frame = -2

Query: 869 DFVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
           +FV+ML   +E++++  W +   L E+    KA+       ++F+ Y+  L+
Sbjct: 493 EFVKMLEECEELSSSLKWSKAMSLFENDQRFKAVDRPRDREDLFDNYIVELE 544



>gb:AE014134_1127291 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003581_1216367 Drosophila melanogaster
            chromosome 2L, section 10 of 83 of the complete sequence.
          Length = 757

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 57/225 (25%), Positives = 103/225 (45%), Gaps = 3/225 (1%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            + K D L VF+E+IR                  R +RKNRD+F  +++     G +T+ +
Sbjct: 359  MDKEDALIVFEEHIRTLEKEEDEEREREKKRMKRQQRKNRDSFLALLDSLHEEGKLTSMS 418

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
            LW +  P++   + + A+    SGSTP DLF+  VE L+ ++H++K  ++ +LK +    
Sbjct: 419  LWVELYPIISADLRFSAMLGQ-SGSTPLDLFKFYVENLKARFHDEKKIIREILKEKAFVV 477

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXKDFVEML 852
                SFEDF   + E   + S+   N++L +  L+                  +     +
Sbjct: 478  QAKTSFEDFATVVCEDKRSASLDAGNVKLTYNSLLEKAEAIEKERMKEEVRRLRKLENEI 537

Query: 851  SN---ADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYV 726
             N      ++ A  +E  K+LVE         +E  + +I+E++V
Sbjct: 538  KNEWLEANVSVAEPYESAKKLVEHLEAFALYEKEIGVEKIWEDFV 582



>gb:AE014134_1127290 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003581_1216366 Drosophila melanogaster
            chromosome 2L, section 10 of 83 of the complete
            sequence.>gb:AY058551_1291705 Drosophila melanogaster
            LD24714 full length cDNA.
          Length = 806

 Score = 87.8 bits (216), Expect = 5e-16
 Identities = 57/225 (25%), Positives = 103/225 (45%), Gaps = 3/225 (1%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            + K D L VF+E+IR                  R +RKNRD+F  +++     G +T+ +
Sbjct: 408  MDKEDALIVFEEHIRTLEKEEDEEREREKKRMKRQQRKNRDSFLALLDSLHEEGKLTSMS 467

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
            LW +  P++   + + A+    SGSTP DLF+  VE L+ ++H++K  ++ +LK +    
Sbjct: 468  LWVELYPIISADLRFSAMLGQ-SGSTPLDLFKFYVENLKARFHDEKKIIREILKEKAFVV 526

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXKDFVEML 852
                SFEDF   + E   + S+   N++L +  L+                  +     +
Sbjct: 527  QAKTSFEDFATVVCEDKRSASLDAGNVKLTYNSLLEKAEAIEKERMKEEVRRLRKLENEI 586

Query: 851  SN---ADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYV 726
             N      ++ A  +E  K+LVE         +E  + +I+E++V
Sbjct: 587  KNEWLEANVSVAEPYESAKKLVEHLEAFALYEKEIGVEKIWEDFV 631



>gb:BC051961_2100863 Mus musculus RIKEN cDNA 2610317D23 gene, mRNA
            (cDNA clone IMAGE:5689342), partial cds.
          Length = 890

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 59/237 (24%), Positives = 102/237 (43%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D++   + K D L  F+E+IR                  R +RKNR+AF++ +++    G
Sbjct: 469  DQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETG 528

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 529  QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 587

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXX----XXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 588  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEARETEREKEEARRMR 647

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 648  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 704



>pir|T38804|T38804 hypothetical WW domain-containing protein - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPAC4D7_1717940
            S.pombe chromosome I cosmid c4D7.
          Length = 695

 Score = 78.2 bits (191), Expect = 4e-13
 Identities = 59/235 (25%), Positives = 105/235 (44%), Gaps = 9/235 (3%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            L K+D L  F+++++                  R ERKNRDAFR +++D      +T +T
Sbjct: 370  LSKLDALVAFEDHVKHLEREYILDKQKQKKEKHRIERKNRDAFRALLQDLRVQKKITLRT 429

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
             W++  P++K+   Y  +    SGSTP DLF D + +LEN Y E +  V + L+  +I+ 
Sbjct: 430  KWKELYPIIKDDPRYLNLLGQ-SGSTPLDLFWDTIVDLENMYREKRNLVLDCLEVLQISV 488

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFED----LMXXXXXXXXXXXXXXXXXXKDF 864
                +  +  A + E +     SE   + + E+    L                   +  
Sbjct: 489  DDTSNIPEIIARLSEKLKDREESEAVTEDLIEEVVNRLRDKAIHKKAEEKRADERRIRRK 548

Query: 863  VEMLSNA-----DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
            ++ L +A       I+A +S++E + L+    E  A+  E      F++Y+ RL+
Sbjct: 549  IDNLRSAIKYLKPPISADASYDEIRPLISILPEFAALHSEEHRMAAFDKYIRRLR 603



>gb:AF135440_2055919 Mus musculus huntington yeast partner C (Hypc)
            mRNA, complete cds.
          Length = 873

 Score = 77.8 bits (190), Expect = 5e-13
 Identities = 59/237 (24%), Positives = 102/237 (43%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D++   + K D L  F+E+IR                  R +RKNR+AF++ +++    G
Sbjct: 449  DQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETG 508

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 509  QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 567

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 568  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 627

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 628  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 684



>gb:AF155096_1886608 Homo sapiens NY-REN-6 antigen mRNA, partial cds.
          Length = 427

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 24   EDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEH 83

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++L
Sbjct: 84   GQLHSMSSWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDIL 142

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +        +FEDF A I  T  + ++   N++L F  L+                  
Sbjct: 143  KDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 202

Query: 884  XXXXKDFVEMLSN-ADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML   A  I   + WE+ +E        + I  E+  + IF++++  L+
Sbjct: 203  KRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLE 260



>sp|Q9R1C7|FNB3_MOUSE Formin binding protein 3 (Formin binding protein
            11) (FBP 11).>gb:AF135439_2055918 Mus musculus formin
            binding protein 11 (FBP11) mRNA, complete cds.
          Length = 953

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 561  EDEELQNMDKEDALICFEEHIRALEKEEEEEKQKTLLRERRRQRKNRESFQIFLDELHEH 620

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++L
Sbjct: 621  GQLHSMSSWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDIL 679

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +        +FEDF A I  T  + ++   N++L F  L+                  
Sbjct: 680  KDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 739

Query: 884  XXXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML  A   I   + WE+ +E        + I  E+  + IF++++  L+
Sbjct: 740  KRKESAFKSMLKQATPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLE 797



>sp|O75400|FNB3_HUMAN Formin binding protein 3 (Huntingtin yeast
            partner A) (Huntingtin- interacting protein HYPA/FBP11)
            (Fas-ligand associated factor 1) (NY- REN-6 antigen)
            (HSPC225).
          Length = 957

 Score = 77.0 bits (188), Expect = 9e-13
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 565  EDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEH 624

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++L
Sbjct: 625  GQLHSMSSWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDIL 683

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +        +FEDF A I  T  + ++   N++L F  L+                  
Sbjct: 684  KDKGFVVEVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 743

Query: 884  XXXXKDFVEMLSN-ADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML   A  I   + WE+ +E        + I  E+  + IF++++  L+
Sbjct: 744  KRKESAFKSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLE 801



>gb:BC067364_1987312 Homo sapiens Huntingtin interacting protein C,
            mRNA (cDNA clone MGC:71266 IMAGE:6644672), complete cds.
          Length = 871

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D +   + K D L  F+E+IR                  R +RKNR+AF+  +++    G
Sbjct: 449  DHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETG 508

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 509  QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 567

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 568  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 627

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 628  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 684



>gb:BC050398_1984321 Homo sapiens Huntingtin interacting protein C,
            mRNA (cDNA clone IMAGE:6046382), partial cds.
          Length = 788

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D +   + K D L  F+E+IR                  R +RKNR+AF+  +++    G
Sbjct: 449  DHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETG 508

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 509  QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 567

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 568  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 627

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 628  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 684



>gb:HSM802172_1186623 Homo sapiens mRNA; cDNA DKFZp434H2121 (from
            clone DKFZp434H2121).
          Length = 452

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D +   + K D L  F+E+IR                  R +RKNR+AF+  +++    G
Sbjct: 31   DHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETG 90

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 91   QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 149

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 150  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 209

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 210  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 266



>pir|T46402|T46402 hypothetical protein DKFZp434H2121.1 - human
            (fragment)
          Length = 452

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D +   + K D L  F+E+IR                  R +RKNR+AF+  +++    G
Sbjct: 31   DHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETG 90

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 91   QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 149

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 150  DRGFCVEVNTAFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 209

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 210  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 266



>gb:BC049307_2550165 Danio rerio formin binding protein 3, mRNA (cDNA
            clone MGC:56384 IMAGE:5604710), complete cds.
          Length = 851

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 55/238 (23%), Positives = 102/238 (42%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 459  EDEELQNMDKEDALICFEEHIRALEKEEEDEKQKTLLRERRRQRKNRESFQKFLDELHDH 518

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GSTP DLF+  VE+L+ +YH++K  +K++L
Sbjct: 519  GQLHSMSAWMEMYPTISADIRFSNMLGQP-GSTPLDLFKFYVEDLKARYHDEKRIIKDIL 577

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +         FEDF + I       ++   N++L F  L+                  
Sbjct: 578  KDKGFLVEINTGFEDFGSVISSDKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 637

Query: 884  XXXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML  A   +   ++WE  +E        + I  E+  + IF++++  L+
Sbjct: 638  KRKEAAFKSMLKQATPPLEPEATWEGVRERFLKEPAFEDITLESERKRIFKDFMHVLE 695



>gb:AB057590_2462762 Gallus gallus mRNA for formin binding protein
            11-related protein, partial cds.
          Length = 1070

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 677  EDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEH 736

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++L
Sbjct: 737  GQLHSMSSWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDIL 795

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +        SFEDF   I  T    ++   N++L F  L+                  
Sbjct: 796  KDKGFVVEVNTSFEDFVTVISSTKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 855

Query: 884  XXXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML  A   I   + WE+ ++        + I  E+  + IF++++  L+
Sbjct: 856  KRKESAFKSMLKQATPPIELDAVWEDIRDRFVKEPAFEDITLESERKRIFKDFMHVLE 913



>gb:AB035521_2461642 Gallus gallus FBP mRNA for formin binding protein
            11-related protein, complete cds.
          Length = 853

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 5/238 (2%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            +DE    + K D L  F+E+IR                  R +RKNR++F+  +++    
Sbjct: 505  EDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEH 564

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
            G + + + W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++L
Sbjct: 565  GQLHSMSSWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDIL 623

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXX 885
            K +        SFEDF   I  T    ++   N++L F  L+                  
Sbjct: 624  KDKGFVVEVNTSFEDFVTVISSTKRATTLDAGNIKLAFNSLLEKAEAREREREKEEARKM 683

Query: 884  XXXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                  F  ML  A   I   + WE+ ++        + I  E+  + IF++++  L+
Sbjct: 684  KRKESAFKSMLKQATPPIELDAVWEDIRDRFVKEPAFEDITLESERKRIFKDFMHVLE 741



>gb:HSM805637_1187637 Homo sapiens mRNA; cDNA DKFZp434O1520 (from
            clone DKFZp434O1520).
          Length = 858

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 5/237 (2%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D +   + K D L  F+E+IR                  R +RKNR+AF+  +++    G
Sbjct: 443  DHQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQTFLDELHETG 502

Query: 1229 TVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLK 1050
             + + + W +  P V   V +  +     GSTP DLF+  VEEL+ ++H++K  +K++LK
Sbjct: 503  QLHSMSTWMELYPAVSTDVRFANMLGQP-GSTPLDLFKFYVEELKARFHDEKKIIKDILK 561

Query: 1049 SEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXX 882
                      +FEDF   I       ++   N++L F  L+                   
Sbjct: 562  VNT-------AFEDFAHVISFDKRAAALDAGNIKLTFNSLLEKAEAREREREKEEARRMR 614

Query: 881  XXXKDFVEMLSNA-DEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
                 F  ML  A   +   ++WEE +E     S  + I  E+    +F E++  L+
Sbjct: 615  RREAAFRSMLRQAVPALELGTAWEEVRERFVCDSAFEQITLESERIRLFREFLQVLE 671



>gb:AX881482_1478638 Sequence 16387 from Patent EP1074617.
          Length = 365

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 55/231 (23%), Positives = 101/231 (43%), Gaps = 5/231 (2%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            + K D L  F+E+IR                  R +RKNR++F+  +++    G + + +
Sbjct: 1    MDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQLHSMS 60

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
             W +  P +   + +  +     GST  DLF+  VE+L+ +YH++K  +K++LK +    
Sbjct: 61   SWMELYPTISSDIRFTNMLGQP-GSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVV 119

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXX----XXXXXXXXXXXXXKDF 864
                +FEDF A I  T  + ++   N++L F  L+                        F
Sbjct: 120  EVNTTFEDFVAIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAF 179

Query: 863  VEMLSN-ADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRLQ 714
              ML   A  I   + WE+ +E        + I  E+  + IF++++  L+
Sbjct: 180  KSMLKQAAPPIELDAVWEDIRERFVKEPAFEDITLESERKRIFKDFMHVLE 230



>pir|S40923|S40923 hypothetical protein ZK1098.1 - Caenorhabditis
            elegans
          Length = 695

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 36/155 (23%), Positives = 71/155 (45%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            + K D L VF+++I+                  R +RK R+ +R ++E     G +T+ +
Sbjct: 378  MDKEDALTVFEDHIKQAEKEHDEEKEQEEKRLRRQQRKVREEYRLLLESLHKRGELTSMS 437

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
            LW    P++     ++ +     GS+P DLF+  VE+L+ QY ED+  +K +L  +    
Sbjct: 438  LWTSLFPIISTDTRFELMLFQP-GSSPLDLFKFFVEDLKEQYTEDRRLIKEILTEKGCQV 496

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLM 927
                 + +F   ++       +   N++L +  L+
Sbjct: 497  IATTEYREFSDWVVSHEKGGKVDHGNMKLCYNSLI 531



>sp|P34600|YO61_CAEEL Hypothetical 84.7 kDa protein ZK1098.1 in
            chromosome III.>pir|F88557|F88557 protein ZK1098.1
            [imported] - Caenorhabditis elegans>gb:CEZK1098_1371435
            Caenorhabditis elegans cosmid ZK1098, complete sequence.
          Length = 724

 Score = 60.5 bits (145), Expect = 8e-08
 Identities = 36/155 (23%), Positives = 71/155 (45%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            + K D L VF+++I+                  R +RK R+ +R ++E     G +T+ +
Sbjct: 407  MDKEDALTVFEDHIKQAEKEHDEEKEQEEKRLRRQQRKVREEYRLLLESLHKRGELTSMS 466

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
            LW    P++     ++ +     GS+P DLF+  VE+L+ QY ED+  +K +L  +    
Sbjct: 467  LWTSLFPIISTDTRFELMLFQP-GSSPLDLFKFFVEDLKEQYTEDRRLIKEILTEKGCQV 525

Query: 1031 SPLWSFEDFKAAILETIGTPSISEVNLQLIFEDLM 927
                 + +F   ++       +   N++L +  L+
Sbjct: 526  IATTEYREFSDWVVSHEKGGKVDHGNMKLCYNSLI 560



>gb:PFMAL13_1191237 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 906

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 36/161 (22%), Positives = 65/161 (40%)
 Frame = -2

Query: 1412 DDERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAA 1233
            DDE    L KID L  ++++                       RK R+AF  ++ ++   
Sbjct: 606  DDEDFHSLHKIDALAAWEDFYEKYHNVEKMKLKKKIYRIL---RKKREAFIELLNEYYEN 662

Query: 1232 GTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVL 1053
              +  KT W  +   + +   Y  +  +  GS+P+ LF++ ++ L+ QY   K+ +K   
Sbjct: 663  NILNMKTQWIFFVSKIYKDTRYTDILGH-QGSSPRILFDEFIDSLQEQYLIHKSYIKKAY 721

Query: 1052 KSEKITFSPLWSFEDFKAAILETIGTPSISEVNLQLIFEDL 930
            K    T     + EDF           +I + N+  I+  L
Sbjct: 722  KEMDFTIDENITLEDFLKTFSNVQSKYNIPDANMNFIYLSL 762



>gb:AK051375_1169665 Mus musculus 12 days embryo spinal ganglion cDNA,
            RIKEN full-length enriched library, clone:D130042G20
            product:formin binding protein 3, full insert sequence.
          Length = 307

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 5/148 (3%)
 Frame = -2

Query: 1142 GSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSIS 963
            GST  DLF+  VE+L+ +YH++K  +K++LK +        +FEDF A I  T  + ++ 
Sbjct: 4    GSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLD 63

Query: 962  EVNLQLIFEDLMXXXXX----XXXXXXXXXXXXXKDFVEMLSNA-DEITAASSWEECKEL 798
              N++L F  L+                        F  ML  A   I   + WE+ +E 
Sbjct: 64   AGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRER 123

Query: 797  VEDSSESKAIGEETTLREIFEEYVTRLQ 714
                   + I  E+  + IF++++  L+
Sbjct: 124  FVKEPAFEDITLESERKRIFKDFMHVLE 151



>gb:AK041205_1165908 Mus musculus adult male aorta and vein cDNA,
            RIKEN full-length enriched library, clone:A530090F13
            product:formin binding protein 3, full insert sequence.
          Length = 303

 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 5/147 (3%)
 Frame = -2

Query: 1139 STPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISE 960
            ST  DLF+  VE+L+ +YH++K  +K++LK +        +FEDF A I  T  + ++  
Sbjct: 1    STALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFVAIISSTKRSTTLDA 60

Query: 959  VNLQLIFEDLMXXXXX----XXXXXXXXXXXXXKDFVEMLSNA-DEITAASSWEECKELV 795
             N++L F  L+                        F  ML  A   I   + WE+ +E  
Sbjct: 61   GNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQATPPIELDAVWEDIRERF 120

Query: 794  EDSSESKAIGEETTLREIFEEYVTRLQ 714
                  + I  E+  + IF++++  L+
Sbjct: 121  VKEPAFEDITLESERKRIFKDFMHVLE 147



>gb:AK027117_1910816 Homo sapiens cDNA: FLJ23464 fis, clone HSI09275.
          Length = 347

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 38/147 (25%), Positives = 63/147 (42%), Gaps = 5/147 (3%)
 Frame = -2

Query: 1139 STPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISE 960
            STP DLF+  VEEL+ ++H++K  +K++LK          +FEDF   I       ++  
Sbjct: 34   STPLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDA 93

Query: 959  VNLQLIFEDLMXXXXX----XXXXXXXXXXXXXKDFVEMLSNA-DEITAASSWEECKELV 795
             N++L F  L+                        F  ML  A   +   ++WEE +E  
Sbjct: 94   GNIKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERF 153

Query: 794  EDSSESKAIGEETTLREIFEEYVTRLQ 714
               S  + I  E+    +F E++  L+
Sbjct: 154  VCDSAFEQITLESERIRLFREFLQVLE 180



>gb:CR382130_1662421 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 568

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 29/116 (25%), Positives = 49/116 (42%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            L K+D L+V+ + I +                 R  R  R  F  ++ + +  G +   T
Sbjct: 304  LNKMDLLDVYSKTIEEKEAELVEQIEQKSAVAARQARIARQQFVKLLSEQVDKGHIVYTT 363

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSE 1044
             W++    +K+ V +Q +      STP DLF DV+E    +    +T  +  L SE
Sbjct: 364  KWKELVDYIKDDVRFQNLCGIRHSSTPLDLFWDVIEVENRRVRNLRTIAQGYLTSE 419



>gb:AE016817_1747544 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 569

 Score = 44.7 bits (104), Expect = 0.005
 Identities = 47/230 (20%), Positives = 91/230 (39%), Gaps = 9/230 (3%)
 Frame = -2

Query: 1391 LXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAGTVTAKT 1212
            L K+D L  + E +                    ++R  RDAF+ ++ +H A  ++   T
Sbjct: 313  LEKVDILREYIEIVTKIISDYDSEIDALSRVNYTSDRIARDAFKELLSEHKA--SIRYNT 370

Query: 1211 LWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEELENQYHEDKTRVKNVLKSEKITF 1032
             W     ++K    +       SGS+  DLF D VEE        ++  + +L  E   +
Sbjct: 371  SWNSIYQLIKNDPRFLNTLGR-SGSSALDLFLDQVEEHRLTISAHRSVAQQILIDENFQW 429

Query: 1031 S---PLWSFEDFKAAILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXKDFV 861
            +   PL + E   A I E     +I   +L  I E+L+                  +   
Sbjct: 430  NDKEPLANREKILALIREKDQFKNIDPQDLDPIPEELIKTRQKKLEEDQLRLAQLEEQRK 489

Query: 860  E-----MLSNADEITAASSWEECKELVEDSSESKAI-GEETTLREIFEEY 729
            +     +L    +      WE+ +E ++   E +++  EE+ ++E++E++
Sbjct: 490  QYFTLLLLRVFRQRDTMPPWEDARERIKHYPEFQSMAAEESVMKEVYEQF 539



>gb:CR380958_1653304 Candida glabrata strain CBS138 chromosome L
            complete sequence.
          Length = 590

 Score = 40.4 bits (93), Expect = 0.090
 Identities = 50/215 (23%), Positives = 89/215 (41%), Gaps = 25/215 (11%)
 Frame = -2

Query: 1283 RKNRDAFRNMMEDHIAAGTVTAKTLWRDYCPMVKESVAY-QAVASNTSGSTPKDLFEDVV 1107
            R  RD F+ M++       + A + W +  P +K   A+ Q V  N  GS+P DLF D  
Sbjct: 363  RMARDQFKVMLKQPKL--DIRADSKWSELYPKIKSEKAFLQLVGRN--GSSPLDLFYDYT 418

Query: 1106 EE----------------LENQY----HEDKTRV-KNVLKSEKITFSPLWSF--EDFKAA 996
             E                ++N Y     ED TR+ KN+ + EK  F  +     ED K A
Sbjct: 419  NEKKAAINGYASVAQQILIDNSYVWAGIEDSTRISKNITEFEKANFQNISGIIHEDGKLA 478

Query: 995  ILETIGTPSISEVNLQLIFEDLMXXXXXXXXXXXXXXXXXXKDFVEMLSNADEITAASSW 816
            +L+   T  + +  + + ++ +                   K+ +  L +   +T    +
Sbjct: 479  LLDEKDTQLVVKQAIAVKYDTV-----KEIEQRNLNMTRIKKNNLVALFHRTFVTKPGRF 533

Query: 815  EECKELVEDSSESKAI-GEETTLREIFEEYVTRLQ 714
            E+   ++++  E KA+  E   ++E+F  +V   Q
Sbjct: 534  EDAVAIIQNKPEYKALENEPDIIKELFSSFVPSKQ 568



>pir|S54157|S54157 extensin-like protein - cowpea (fragment)
          Length = 279

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 37/135 (27%), Positives = 54/135 (40%), Gaps = 4/135 (2%)
 Frame = +2

Query: 194 LMHKTKSTTEFHHPHRV-HHLP-ALRIHHYDEMHRVLFCVSCVDFHRLIQVNVHASLTSS 367
           L H     T  H  H + HHLP  +  HH+  +HR L   +      L+  ++H  ++  
Sbjct: 68  LPHHLPMFTSLHLLHLLPHHLPMCISPHHHHLLHRHLLMFTSHHLLHLLPHHLHMCISRH 127

Query: 368 VHHYVDGTS*FPLSHPYQKSHHQ*SYDAVSDVSYLCPYPSFYLLCVHIQRNLHSHYQHHP 547
            HH    TS     H +   HH         +     +P  +LL  H+   + SH+ HH 
Sbjct: 128 HHHLPMSTS----PHHHHLLHHH--------LPMSTSHPLLHLLLHHLHMCI-SHHHHHL 174

Query: 548 FSNVL--FPSPFLSH 586
               L  F SP L H
Sbjct: 175 LHLRLPTFTSPHLLH 189



>gb:BC040284_2098497 Mus musculus transcription elongation regulator 1
            (CA150), mRNA (cDNA clone MGC:36862 IMAGE:4460736),
            complete cds.
          Length = 1079

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 28/136 (20%), Positives = 61/136 (44%), Gaps = 2/136 (1%)
 Frame = -2

Query: 1118 EDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEV-NLQLI 942
            E+   E +N+  + K   K +++  K  F+P  +F +F A   +     +I ++ + + +
Sbjct: 696  EEERREKKNKIMQAKEDFKKMMEEAK--FNPRATFSEFAAKHAKDSRFKAIEKMKDREAL 753

Query: 941  FEDLMXXXXXXXXXXXXXXXXXX-KDFVEMLSNADEITAASSWEECKELVEDSSESKAIG 765
            F + +                    DF E+LSN   + + S W + K+ VE     KA+ 
Sbjct: 754  FNEFVAAARKKEKEDSKTRGEKIKSDFFELLSN-HHLDSQSRWSKVKDKVESDPRYKAVD 812

Query: 764  EETTLREIFEEYVTRL 717
              +   ++F++Y+ ++
Sbjct: 813  SSSMREDLFKQYIEKI 828



>gb:BC039185_2098376 Mus musculus transcription elongation regulator 1
            (CA150), mRNA (cDNA clone MGC:28934 IMAGE:3982736),
            complete cds.
          Length = 1057

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 28/136 (20%), Positives = 61/136 (44%), Gaps = 2/136 (1%)
 Frame = -2

Query: 1118 EDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEV-NLQLI 942
            E+   E +N+  + K   K +++  K  F+P  +F +F A   +     +I ++ + + +
Sbjct: 674  EEERREKKNKIMQAKEDFKKMMEEAK--FNPRATFSEFAAKHAKDSRFKAIEKMKDREAL 731

Query: 941  FEDLMXXXXXXXXXXXXXXXXXX-KDFVEMLSNADEITAASSWEECKELVEDSSESKAIG 765
            F + +                    DF E+LSN   + + S W + K+ VE     KA+ 
Sbjct: 732  FNEFVAAARKKEKEDSKTRGEKIKSDFFELLSN-HHLDSQSRWSKVKDKVESDPRYKAVD 790

Query: 764  EETTLREIFEEYVTRL 717
              +   ++F++Y+ ++
Sbjct: 791  SSSMREDLFKQYIEKI 806



>gb:AB023485_2044268 Mus musculus mRNA for transcription factor
            CA150b, complete cds.
          Length = 1034

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 28/136 (20%), Positives = 61/136 (44%), Gaps = 2/136 (1%)
 Frame = -2

Query: 1118 EDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEV-NLQLI 942
            E+   E +N+  + K   K +++  K  F+P  +F +F A   +     +I ++ + + +
Sbjct: 717  EEERREKKNKIMQAKEDFKKMMEEAK--FNPRATFSEFAAKHAKDSRFKAIEKMKDREAL 774

Query: 941  FEDLMXXXXXXXXXXXXXXXXXX-KDFVEMLSNADEITAASSWEECKELVEDSSESKAIG 765
            F + +                    DF E+LSN   + + S W + K+ VE     KA+ 
Sbjct: 775  FNEFVAAARKKEKEDSKTRGEKIKSDFFELLSN-HHLDSQSRWSKVKDKVESDPRYKAVD 833

Query: 764  EETTLREIFEEYVTRL 717
              +   ++F++Y+ ++
Sbjct: 834  SSSMREDLFKQYIEKI 849



>pir|T08599|T08599 probable transcription factor CA150 -
            human>gb:AF017789_1876805 Homo sapiens putative
            transcription factor CA150 mRNA, complete cds.
          Length = 1098

 Score = 38.1 bits (87), Expect = 0.45
 Identities = 28/136 (20%), Positives = 61/136 (44%), Gaps = 2/136 (1%)
 Frame = -2

Query: 1118 EDVVEELENQYHEDKTRVKNVLKSEKITFSPLWSFEDFKAAILETIGTPSISEV-NLQLI 942
            E+   E +N+  + K   K +++  K  F+P  +F +F A   +     +I ++ + + +
Sbjct: 715  EEERREKKNKIMQAKEDFKKMMEEAK--FNPRATFSEFAAKHAKDSRFKAIEKMKDREAL 772

Query: 941  FEDLMXXXXXXXXXXXXXXXXXX-KDFVEMLSNADEITAASSWEECKELVEDSSESKAIG 765
            F + +                    DF E+LSN   + + S W + K+ VE     KA+ 
Sbjct: 773  FNEFVAAARKKEKEDSKTRGEKIKSDFFELLSN-HHLDSQSRWSKVKDKVESDPRYKAVD 831

Query: 764  EETTLREIFEEYVTRL 717
              +   ++F++Y+ ++
Sbjct: 832  SSSMREDLFKQYIEKI 847



>gb:BC082994_2108466 Mus musculus RIKEN cDNA 2610317D23 gene, mRNA
            (cDNA clone MGC:91243 IMAGE:6333535), complete cds.
          Length = 557

 Score = 37.0 bits (84), Expect = 0.99
 Identities = 20/81 (24%), Positives = 37/81 (45%)
 Frame = -2

Query: 1409 DERCSRLXKIDRLEVFQEYIRDXXXXXXXXXXXXXXXXXRAERKNRDAFRNMMEDHIAAG 1230
            D++   + K D L  F+E+IR                  R +RKNR+AF++ +++    G
Sbjct: 449  DQQLQNMDKEDALICFEEHIRALEREEEEERERARLRERRQQRKNREAFQSFLDELHETG 508

Query: 1229 TVTAKTLWRDYCPMVKESVAY 1167
             + + + W +  P V   V +
Sbjct: 509  QLHSMSTWMELYPAVSTDVRF 529



>gb:AF067514_1880538 Homo sapiens PITSLRE protein kinase alpha SV5
           isoform (CDC2L1) mRNA, complete cds.
          Length = 737

 Score = 37.0 bits (84), Expect = 0.99
 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           E++K KKHA   E + E  RRKRH++E+D +RR
Sbjct: 69  EKRKEKKHARVKEKEREHERRKRHREEQDKARR 101



>gb:HSU07705_2021820 Human protein kinase PITSLRE isoform PBETA22
           (p58CDC2L1) mRNA, complete cds.
          Length = 775

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 17/32 (53%), Positives = 24/32 (75%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGESRRKRHKKERDASRR 276
           E++K KKHA   E + E RRKRH++E+D +RR
Sbjct: 103 EKRKEKKHARVKEREHE-RRKRHREEQDKARR 133



>gb:BT015197_1358274 Drosophila melanogaster RE71183 full insert
           cDNA.
          Length = 954

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (5%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGE--SRRKRHKKERDASRRS 273
           +RKK+KK A S +SD E  S+RK+HKK +  S++S
Sbjct: 841 KRKKAKKPADSSDSDSEASSKRKKHKKHKKHSKKS 875



>gb:AE014296_1136106 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003539_1214602 Drosophila melanogaster
           chromosome 3L, section 46 of 83 of the complete
           sequence.
          Length = 954

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 2/35 (5%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGE--SRRKRHKKERDASRRS 273
           +RKK+KK A S +SD E  S+RK+HKK +  S++S
Sbjct: 841 KRKKAKKPADSSDSDSEASSKRKKHKKHKKHSKKS 875



>gb:BC085869_2109428 Rattus norvegicus similar to CBF1 interacting
           corepressor (predicted), mRNA (cDNA clone MGC:94623
           IMAGE:7191148), complete cds.
          Length = 451

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
 Frame = -2

Query: 380 HSGERKKSKKHAHSPESDGESRR--KRHKKERDASRRS 273
           HSG  +KS+ H HSPE  G  R    R +   + SRRS
Sbjct: 367 HSGSDRKSRSHQHSPERKGSDRNGGSRSRSRAEGSRRS 404



>gb:CDC2L1S13_1992077 Homo sapiens PITSLRE protein kinase (CDC2L1)
           gene, exons 14-20 and alternatively spliced isoforms,
           complete cds.
          Length = 738

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)
 Frame = -2

Query: 383 RHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           R   +RK+ +KHA   E + E  RRKRH++E+D +RR
Sbjct: 66  RKDEKRKEKRKHARVKEKEREHERRKRHREEQDKARR 102



>gb:HSU04817_2021584 Human protein kinase PITSLRE alpha 2-3 mRNA,
           complete cds.
          Length = 768

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           E++K KKHA   + + E  RRKRH++E+D +RR
Sbjct: 103 EKRKEKKHARVKKKEREHERRKRHREEQDKARR 135



>gb:HSU04816_2021583 Human protein kinase PITSLRE alpha 2-2 mRNA,
           complete cds.
          Length = 777

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%)
 Frame = -2

Query: 371 ERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           E++K KKHA   + + E  RRKRH++E+D +RR
Sbjct: 103 EKRKEKKHARVKKKEREHERRKRHREEQDKARR 135



>gb:BC052920_2101359 Mus musculus cell division cycle 2-like 1, mRNA
           (cDNA clone MGC:56740 IMAGE:6489832), complete cds.
          Length = 750

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 75  RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 112



>gb:CDC2L1S13_1992074 Homo sapiens PITSLRE protein kinase (CDC2L1)
           gene, exons 14-20 and alternatively spliced isoforms,
           complete cds.
          Length = 755

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>gb:BC009375_1971950 Homo sapiens cell division cycle 2-like 1
           (PITSLRE proteins), mRNA (cDNA clone IMAGE:4121554),
           partial cds.
          Length = 263

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>gb:AF067516_1880540 Homo sapiens PITSLRE protein kinase alpha SV10
           isoform (CDC2L1) mRNA, complete
           cds.>gb:CDC2L1S13_1992076 Homo sapiens PITSLRE protein
           kinase (CDC2L1) gene, exons 14-20 and alternatively
           spliced isoforms, complete cds.
          Length = 748

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 75  RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 112



>gb:AF067512_1880536 Homo sapiens PITSLRE protein kinase alpha SV1
           isoform (CDC2L1) mRNA, complete
           cds.>gb:CDC2L1S13_1992075 Homo sapiens PITSLRE protein
           kinase (CDC2L1) gene, exons 14-20 and alternatively
           spliced isoforms, complete cds.
          Length = 782

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>gb:AK077668_1171993 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730514E05
           product:cell division cycle 2 homolog (S. pombe)-like 2,
           full insert sequence.
          Length = 784

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>pir|A55817|A55817 cyclin-dependent kinase p130-PITSLRE -
           mouse>gb:MUSCDPK_2125458 Mus musculus cyclin-dependent
           kinase homologue (p130PITSL) mRNA, complete cds.
          Length = 783

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>sp|P21127|CDL1_HUMAN PITSLRE serine/threonine-protein kinase CDC2L1
           (EC 2.7.1.37) (Galactosyltransferase associated protein
           kinase p58/GTA) (Cell division cycle 2-like 1) (CLK-1)
           (CDK11) (p58 CLK-1).>gb:AF067515_1880539 Homo sapiens
           PITSLRE protein kinase alpha SV9 isoform (CDC2L1) mRNA,
           complete cds.
          Length = 795

 Score = 35.0 bits (79), Expect = 3.8
 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   E + E  RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEKEREHERRKRHREEQDKARR 146



>gb:HSU07704_2021819 Human protein kinase PITSLRE isoform PBETA21
           (p58CDC2L1) mRNA, complete cds.
          Length = 777

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGESRRKRHKKERDASRR 276
           RRH     +  KHA   E + E RRKRH++E+D +RR
Sbjct: 109 RRHRSHSAEGGKHARVKEREHE-RRKRHREEQDKARR 144



>gb:CR382137_1670288 Debaryomyces hansenii chromosome E of strain
            CBS767 of Debaryomyces hansenii.
          Length = 659

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 24/93 (25%), Positives = 48/93 (51%)
 Frame = -2

Query: 1289 AERKNRDAFRNMMEDHIAAGTVTAKTLWRDYCPMVKESVAYQAVASNTSGSTPKDLFEDV 1110
            ++RK R +F+ ++  +I    + A +L+ +  P+++    +  +    +GS+P D F DV
Sbjct: 346  SDRKARQSFKELLLRNI---NINANSLFENIFPLLENEDCFIELCGR-NGSSPLDFFWDV 401

Query: 1109 VEELENQYHEDKTRVKNVLKSEKITFSPLWSFE 1011
            V+E        K  V+N L   K   +P +S++
Sbjct: 402  VDEKYQTMKLKKDLVENTLSGLK--NNPKYSYD 432



>gb:CR380957_1652585 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 400

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 2/61 (3%)
 Frame = -2

Query: 1271 DAFRNMMEDHIAAGTVTAKTL--WRDYCPMVKESVAYQAVASNTSGSTPKDLFEDVVEEL 1098
            DA + ++    A G +T K +  W + C M  E   ++AV      + P     D++EEL
Sbjct: 336  DAEKELLNGQSAQGIITCKEVHEWLETCEMTHEFPLFEAVYQIVYNNVPMKNLPDMIEEL 395

Query: 1097 E 1095
            E
Sbjct: 396  E 396



>gb:AX883953_1479547 Sequence 18858 from Patent
            EP1074617.>gb:AK024361_1909964 Homo sapiens cDNA FLJ14299
            fis, clone PLACE1010310, weakly similar to SPIDROIN
            2.>gb:BC032534_1980518 Homo sapiens hypothetical protein
            FLJ14299, mRNA (cDNA clone MGC:44951 IMAGE:5527569),
            complete cds.
          Length = 590

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 22/72 (30%), Positives = 30/72 (41%), Gaps = 6/72 (8%)
 Frame = +2

Query: 1163 PDKPRTPSPLDNSHAIVF*Q*LCQQQYGLPSYYEKHH------GSCAQHVSIVPFVFSVA 1324
            P KP + SPL  +    F Q LC+  Y L  Y+   H       +C+ H    P + +  
Sbjct: 354  PGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGG 413

Query: 1325 LPLPSPSHEYIP 1360
             PL  P H   P
Sbjct: 414  YPLVYPGHPLQP 425



>gb:U58758_1405401 Caenorhabditis elegans cosmid ZK1127, complete
           sequence.
          Length = 604

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 390 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 439



>gb:U58758_1405400 Caenorhabditis elegans cosmid ZK1127, complete
           sequence.
          Length = 693

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 390 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 439



>gb:U58758_1405399 Caenorhabditis elegans cosmid ZK1127, complete
           sequence.
          Length = 914

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 611 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 660



>gb:U58758_1405398 Caenorhabditis elegans cosmid ZK1127, complete
           sequence.
          Length = 905

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 602 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 651



>gb:AK008283_1154485 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010016J05
           product:cell division cycle 2 homolog (S. pombe)-like 2,
           full insert sequence.
          Length = 312

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -2

Query: 386 RRHSGERKKSKKHAHSPESDGE-SRRKRHKKERDASRR 276
           RRH     +  KHA   + + E  RRKRH++E+D +RR
Sbjct: 109 RRHGSHSAEGGKHAKVKDKEREHERRKRHREEQDKARR 146



>pir|E88196|E88196 protein ZK1127.6 [imported] - Caenorhabditis
           elegans>gb:U58758_1405397 Caenorhabditis elegans cosmid
           ZK1127, complete sequence.
          Length = 424

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 120 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 169



>pir|F88196|F88196 protein ZK1127.9 [imported] - Caenorhabditis
           elegans
          Length = 946

 Score = 33.9 bits (76), Expect = 8.4
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -2

Query: 866 FVEMLSNADEITAASSWEECKELVEDSSESKAIGEETTLREIFEEYVTRL 717
           FV++L     +T  S W   K+ +ED     A+   +T   +F E+V  L
Sbjct: 643 FVKLLEEQTGLTRKSKWSTTKKTLEDEERYIALDSSSTRESLFREFVANL 692


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,060,484,089
Number of Sequences: 1806583
Number of extensions: 19566576
Number of successful extensions: 65145
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 60424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64778
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 119930970042
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)