BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3967
         (831 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47631|T47631 Peptidase-like protein - Arabidopsis thaliana>...   114   2e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M1S8|GCP2_ARATH|GCP2_ARATH Probable glutamate carboxypeptidase II (EC ...   114   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AP003768_1833278 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AC087096_1733929 Oryza sativa chromosome 3 BAC OSJNBa0087O09 ...    79   1e-13   
gb:AP002972_1824083 Oryza sativa (japonica cultivar-group) genom...    73   7e-12   
gb:BT008323_1639540 Arabidopsis thaliana At5g19740 gene, complet...    67   4e-10   
gb:AY243507_2080513 Mus musculus NAAG-peptidase II mRNA, complet...    57   6e-07   
gb:BC049312_2550169 Danio rerio zgc:56429, mRNA (cDNA clone MGC:...    55   1e-06   
sp|O35409|FOH1_MOUSE|FOH1_MOUSE Glutamate carboxypeptidase II (EC 3.4.17.21...    55   1e-06   Mus musculus [mouse]
gb:CS008000_1455558 Sequence 9 from Patent EP1502602.                  54   3e-06   
gb:CS007998_1455557 Sequence 7 from Patent EP1502602.                  54   3e-06   
gb:AK002920_1151540 Mus musculus adult male kidney cDNA, RIKEN f...    54   3e-06   
gb:BC038840_1982398 Homo sapiens N-acetylated alpha-linked acidi...    52   1e-05   
sp|Q9Y3Q0|NLD2_HUMAN|NLD2_HUMAN N-acetylated-alpha-linked acidic dipeptidas...    52   1e-05   Homo sapiens [man]
gb:AF007544_1876072 Homo sapiens prostate-specific membrane anti...    52   1e-05   
sp|O77564|FOH1_PIG|FOH1_PIG Glutamate carboxypeptidase II (EC 3.4.17.21) ...    52   2e-05   Sus scrofa [pigs]
gb:BC025672_1978520 Homo sapiens folate hydrolase (prostate-spec...    51   2e-05   
gb:CS007992_1455554 Sequence 1 from Patent EP1502602.>gb:AX46722...    51   2e-05   
sp|Q04609|FOH1_HUMAN|FOH1_HUMAN Glutamate carboxypeptidase II (EC 3.4.17.21...    51   2e-05   Homo sapiens [man]
sp|P70627|FOH1_RAT|FOH1_RAT Glutamate carboxypeptidase II (EC 3.4.17.21) ...    50   5e-05   Rattus norvegicus [brown rat]
gb:CR382124_1657055 Kluyveromyces lactis strain NRRL Y-1140 chro...    48   3e-04   
gb:U88179_1406687 Caenorhabditis elegans cosmid R57, complete se...    41   0.024   
gb:U88179_1406686 Caenorhabditis elegans cosmid R57, complete se...    41   0.024   
sp|P91406|GCP2_CAEEL|GCP2_CAEEL Glutamate carboxypeptidase II homolog (EC 3...    41   0.024   Caenorhabditis elegans [roundworm]
gb:CR382128_1660550 Yarrowia lipolytica chromosome B of strain C...    41   0.032   
gb:CR382138_1671306 Debaryomyces hansenii chromosome F of strain...    37   0.46    
gb:BA000045_741442 Gloeobacter violaceus PCC 7421 DNA, complete ...    37   0.60    
gb:PPO543320_1395617 Physarum polycephalum mRNA for poly(L-malat...    36   1.0     
gb:AY600247_1340191 Physarum polycephalum poly(L-malate)-hydrola...    36   1.0     
pir|T19751|T19751 hypothetical protein C35C5.2 - Caenorhabditis ...    34   3.0     Caenorhabditis elegans [roundworm]
sp|O54697|NLDL_RAT|NLDL_RAT N-acetylated-alpha-linked acidic dipeptidase ...    34   3.9     Rattus norvegicus [brown rat]
gb:CR382130_1662341 Yarrowia lipolytica chromosome D of strain C...    33   5.0     
gb:AE016814_1745723 Ashbya gossypii (= Eremothecium gossypii) AT...    33   6.6     
pir|S42039|S42039 hypothetical protein 2 - Leuconostoc oenos pla...    33   8.6     Oenococcus oeni


>pir|T47631|T47631 Peptidase-like protein - Arabidopsis
           thaliana>gb:ATT5N23_1556232 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T5N23.
          Length = 703

 Score =  114 bits (286), Expect = 2e-24
 Identities = 69/156 (44%), Positives = 87/156 (55%), Gaps = 4/156 (2%)
 Frame = +3

Query: 372 TYSLIFVMFIIVFLATLHHHSRRD----LTAVKRNGLYYRNDFISSASNYTIAAYLRNLT 539
           ++  + V+F+  F  TLHH          +    N L  R  F+SSASN TI++YLR LT
Sbjct: 27  SFLFVIVLFVATFY-TLHHPDAVTPPLLFSRNAYNALRLRRLFLSSASNATISSYLRELT 85

Query: 540 GRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGSDVPVPL 719
             PHLAGT  SL    YV +HF+ L L+T V  Y  LLSYP   SVTA FSN + +   L
Sbjct: 86  RHPHLAGTKPSLDTLHYVFNHFQSLGLETHVAEYEALLSYPTHISVTASFSNTTTLEFDL 145

Query: 720 SEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
           ++             PYHAYSPSGSA G  VF+N+G
Sbjct: 146 ND----VPGDSPVVRPYHAYSPSGSAQGNVVFVNHG 177



>sp|Q9M1S8|GCP2_ARATH Probable glutamate carboxypeptidase II (EC
           3.4.17.21).>gb:AF357217_1790788 Arabidopsis thaliana
           glutamate carboxypeptidase (AMP1) mRNA, complete cds.
          Length = 705

 Score =  114 bits (286), Expect = 2e-24
 Identities = 69/156 (44%), Positives = 87/156 (55%), Gaps = 4/156 (2%)
 Frame = +3

Query: 372 TYSLIFVMFIIVFLATLHHHSRRD----LTAVKRNGLYYRNDFISSASNYTIAAYLRNLT 539
           ++  + V+F+  F  TLHH          +    N L  R  F+SSASN TI++YLR LT
Sbjct: 27  SFLFVIVLFVATFY-TLHHPDAVTPPLLFSRNAYNALRLRRLFLSSASNATISSYLRELT 85

Query: 540 GRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGSDVPVPL 719
             PHLAGT  SL    YV +HF+ L L+T V  Y  LLSYP   SVTA FSN + +   L
Sbjct: 86  RHPHLAGTKPSLDTLHYVFNHFQSLGLETHVAEYEALLSYPTHISVTASFSNTTTLEFDL 145

Query: 720 SEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
           ++             PYHAYSPSGSA G  VF+N+G
Sbjct: 146 ND----VPGDSPVVRPYHAYSPSGSAQGNVVFVNHG 177



>gb:AP003768_1833278 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E07.
          Length = 728

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 51/124 (41%), Positives = 69/124 (55%), Gaps = 4/124 (3%)
 Frame = +3

Query: 471 YYRNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVL 650
           YYR+ F+S  SN T AA+L  LT RPHLAGT ++  AA +V S    L   TRVV Y+VL
Sbjct: 57  YYRSLFLSLGSNDTAAAHLHALTLRPHLAGTEANARAAEHVVSALSSLSFPTRVVPYSVL 116

Query: 651 LSYPLSASVTACFSNGSDVPVPLSE---PXXXXXXXXXXXMP-YHAYSPSGSAYGKAVFL 818
           L+YP+  S++      +  P  L +   P           +P + AY+ SGS   +AV+ 
Sbjct: 117 LAYPVHRSLSLSAPGHATTPFALVQDTYPGDPYAAVSAEAVPTFLAYAASGSVAAEAVYA 176

Query: 819 NYGR 830
           NYGR
Sbjct: 177 NYGR 180



>gb:AC087096_1733929 Oryza sativa chromosome 3 BAC OSJNBa0087O09
           genomic sequence, complete sequence.
          Length = 772

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 51/115 (44%), Positives = 64/115 (55%), Gaps = 1/115 (0%)
 Frame = +3

Query: 489 ISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLS 668
           +S  +N TIAA LR LT  PHLAGT ++ GAA  V S F    L T    YT LLSYP  
Sbjct: 94  LSEGANATIAADLRALTAGPHLAGTGAAAGAAARVLSGFRAAGLRTLTREYTPLLSYPGH 153

Query: 669 ASVTACFSNGSDVP-VPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYGR 830
           AS+    ++ + +  + L EP            PYHAY+PSG A  +AVF+N GR
Sbjct: 154 ASLALLRADRTLLAHLSLDEP---ADVGRRLVRPYHAYAPSGGAVAEAVFVNLGR 205



>gb:AP002972_1824083 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0638D12.
          Length = 661

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 47/124 (37%), Positives = 66/124 (53%), Gaps = 5/124 (4%)
 Frame = +3

Query: 474 YRNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLL 653
           Y + F+S ASN T A +LR LT  PH+AGT ++   A YV   F  L +   +  Y+VLL
Sbjct: 57  YGSLFLSLASNDTAALHLRALTLHPHVAGTRANSLTAAYVCDAFSSLSIPAHITPYSVLL 116

Query: 654 SYPLSASVT-ACFSNGSDVPVPLSE---PXXXXXXXXXXXMP-YHAYSPSGSAYGKAVFL 818
           SYP+  S++ A     +     LS+   P           MP ++AY+ SGS   +AV+ 
Sbjct: 117 SYPVERSLSLAVPGRATTTSFALSQETYPNDPYASATAEVMPTFYAYAASGSVSAEAVYA 176

Query: 819 NYGR 830
           NYGR
Sbjct: 177 NYGR 180



>gb:BT008323_1639540 Arabidopsis thaliana At5g19740 gene, complete
           cds.
          Length = 681

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 44/124 (35%), Positives = 63/124 (50%), Gaps = 4/124 (3%)
 Frame = +3

Query: 471 YYRNDFISSA--SNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYT 644
           +Y   FIS++   N ++A  L  LT RPH+AGT ++  AA YV+S F    L + VV Y 
Sbjct: 29  HYHELFISTSFSDNASVALNLHTLTRRPHVAGTVANAEAAEYVRSVFTSSALKSHVVAYQ 88

Query: 645 VLLSYPLSAS-VTACFSNGSDVPVPLSEPXXXXXXXXXXXMP-YHAYSPSGSAYGKAVFL 818
           V L+YP+  S V     +   +   L +            MP +H Y+ SG+  G  V+ 
Sbjct: 89  VSLTYPVHRSLVLTPTDSAKPITFLLEQEKLGDNPYANEVMPTFHGYAKSGNVSGPVVYA 148

Query: 819 NYGR 830
           NYGR
Sbjct: 149 NYGR 152



>gb:AY243507_2080513 Mus musculus NAAG-peptidase II mRNA, complete
           cds.
          Length = 740

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 6/120 (5%)
 Frame = +3

Query: 489 ISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYPL 665
           +S      I ++LR+ T  PHLAGT  +L  A  +++ +++  LD+  +V+Y VLLSYP 
Sbjct: 52  LSEMKAENIRSFLRSFTKLPHLAGTEQNLLLAKKIQTQWKKFGLDSANLVHYDVLLSYPN 111

Query: 666 SAS---VTACFSNGSDV--PVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYGR 830
             +   V+    +G ++     L  P            PY+A+S SG   G+ V++NY R
Sbjct: 112 ETNANYVSIVDEHGVEIFKTSYLEPPPDGYENVTNIIPPYNAFSASGMPEGELVYVNYAR 171



>gb:BC049312_2550169 Danio rerio zgc:56429, mRNA (cDNA clone
           MGC:56429 IMAGE:5612032), complete cds.
          Length = 745

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 39/131 (29%), Positives = 62/131 (47%), Gaps = 6/131 (4%)
 Frame = +3

Query: 456 KRNGLYYRNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RV 632
           +R    +  DF+       I  +LR  T  PHLAGT  +L  A  +++ +    LD+  +
Sbjct: 39  ERTSKSFLRDFMDEMHAENIKHHLRKFTKLPHLAGTQQNLNLAEQIRNEWMEFGLDSVEL 98

Query: 633 VNYTVLLSYPLSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSA 797
           V Y VLLSYP   +   ++     G+++    L+EP           + PY A+S  G  
Sbjct: 99  VPYDVLLSYPNKTNPNYISIVDQLGNEIFKTSLAEPVPEGYEDVADIVPPYSAFSAKGQP 158

Query: 798 YGKAVFLNYGR 830
             + V++NYGR
Sbjct: 159 EDELVYVNYGR 169



>sp|O35409|FOH1_MOUSE Glutamate carboxypeptidase II (EC 3.4.17.21)
           (Membrane glutamate carboxypeptidase) (mGCP)
           (N-acetylated-alpha-linked acidic dipeptidase I)
           (NAALADase I) (Pteroylpoly-gamma-glutamate
           carboxypeptidase) (Folylpoly-gamma-glutamate
           carboxypeptidase) (FGCP) (Folate hydrolase 1)
           (Prostate-specific membrane antigen
           homolog).>gb:AF026380_2051305 Mus musculus
           prostate-specific membrane antigen homolog (mopsm) mRNA,
           complete cds.
          Length = 752

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/124 (30%), Positives = 58/124 (46%), Gaps = 6/124 (4%)
 Frame = +3

Query: 477 RNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLD-TRVVNYTVLL 653
           + +F+       I  +L N T  PHLAGT ++   A  +   ++   LD   + +Y VLL
Sbjct: 60  KKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKEFGLDLVELSHYDVLL 119

Query: 654 SYPLSAS---VTACFSNGSDV-PVPLSE-PXXXXXXXXXXXMPYHAYSPSGSAYGKAVFL 818
           SYP       ++    +G+++    LSE P            PY A+SP G+  G  VF+
Sbjct: 120 SYPNKTHPNYISIINEDGNEIFKTSLSEQPPPGYENISDVVPPYSAFSPQGTPEGDLVFV 179

Query: 819 NYGR 830
           NY R
Sbjct: 180 NYAR 183



>gb:CS008000_1455558 Sequence 9 from Patent EP1502602.
          Length = 694

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 6/124 (4%)
 Frame = +3

Query: 477 RNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLD-TRVVNYTVLL 653
           + +F+       I  +L N T  PHLAGT ++   A  +   ++   LD   + +Y VLL
Sbjct: 2   KKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKEFGLDLVELSHYDVLL 61

Query: 654 SYPLSAS---VTACFSNGSDV-PVPLSE-PXXXXXXXXXXXMPYHAYSPSGSAYGKAVFL 818
           SYP       ++    +G+++    LSE P            PY A+SP G+  G  V++
Sbjct: 62  SYPNKTHPNYISIINEDGNEIFKTSLSEQPPPGYENISDVVPPYSAFSPQGTPEGDLVYV 121

Query: 819 NYGR 830
           NY R
Sbjct: 122 NYAR 125



>gb:CS007998_1455557 Sequence 7 from Patent EP1502602.
          Length = 752

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 6/124 (4%)
 Frame = +3

Query: 477 RNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLD-TRVVNYTVLL 653
           + +F+       I  +L N T  PHLAGT ++   A  +   ++   LD   + +Y VLL
Sbjct: 60  KKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKEFGLDLVELSHYDVLL 119

Query: 654 SYPLSAS---VTACFSNGSDV-PVPLSE-PXXXXXXXXXXXMPYHAYSPSGSAYGKAVFL 818
           SYP       ++    +G+++    LSE P            PY A+SP G+  G  V++
Sbjct: 120 SYPNKTHPNYISIINEDGNEIFKTSLSEQPPPGYENISDVVPPYSAFSPQGTPEGDLVYV 179

Query: 819 NYGR 830
           NY R
Sbjct: 180 NYAR 183



>gb:AK002920_1151540 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610042N21
           product:FOLATE HYDROLASE, full insert sequence.
          Length = 752

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 6/124 (4%)
 Frame = +3

Query: 477 RNDFISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLD-TRVVNYTVLL 653
           + +F+       I  +L N T  PHLAGT ++   A  +   ++   LD   + +Y VLL
Sbjct: 60  KKEFLHELKAENIKKFLYNFTRTPHLAGTQNNFELAKQIHDQWKEFGLDLVELSHYDVLL 119

Query: 654 SYPLSAS---VTACFSNGSDV-PVPLSE-PXXXXXXXXXXXMPYHAYSPSGSAYGKAVFL 818
           SYP       ++    +G+++    LSE P            PY A+SP G+  G  V++
Sbjct: 120 SYPNKTHPNYISIINEDGNEISKTSLSEQPPPGYENISDVVPPYSAFSPQGTPEGDLVYV 179

Query: 819 NYGR 830
           NY R
Sbjct: 180 NYAR 183



>gb:BC038840_1982398 Homo sapiens N-acetylated alpha-linked acidic
           dipeptidase 2, mRNA (cDNA clone IMAGE:5201306), complete
           cds.
          Length = 317

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 39/151 (25%), Positives = 70/151 (46%), Gaps = 6/151 (3%)
 Frame = +3

Query: 396 FIIVFLATLHHHSRRDLTAVKRNGLYYRNDFISSASNYTIAAYLRNLTGRPHLAGTPSSL 575
           F++ F+        ++ T   R     R   +S      I ++LR+ T  PHLAGT  + 
Sbjct: 21  FLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRSFTKLPHLAGTEQNF 80

Query: 576 GAAVYVKSHFERLKLDT-RVVNYTVLLSYPLSAS---VTACFSNGSDV--PVPLSEPXXX 737
             A  +++ +++  LD+ ++V+Y VLLSYP   +   ++    + +++     L  P   
Sbjct: 81  LLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDG 140

Query: 738 XXXXXXXXMPYHAYSPSGSAYGKAVFLNYGR 830
                    PY+A+S  G   G  V++NY R
Sbjct: 141 YENVTNIVPPYNAFSAQGMPEGDLVYVNYAR 171



>sp|Q9Y3Q0|NLD2_HUMAN N-acetylated-alpha-linked acidic dipeptidase
           II (EC 3.4.17.21) (NAALADase II).>gb:AX136153_1461956
           Sequence 75 from Patent EP1067182.>gb:HSA012370_2000093
           Homo sapiens mRNA for NAALADase II protein.
          Length = 740

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 39/151 (25%), Positives = 70/151 (46%), Gaps = 6/151 (3%)
 Frame = +3

Query: 396 FIIVFLATLHHHSRRDLTAVKRNGLYYRNDFISSASNYTIAAYLRNLTGRPHLAGTPSSL 575
           F++ F+        ++ T   R     R   +S      I ++LR+ T  PHLAGT  + 
Sbjct: 21  FLMGFMVGWFIKPLKETTTSVRYHQSIRWKLVSEMKAENIKSFLRSFTKLPHLAGTEQNF 80

Query: 576 GAAVYVKSHFERLKLDT-RVVNYTVLLSYPLSAS---VTACFSNGSDV--PVPLSEPXXX 737
             A  +++ +++  LD+ ++V+Y VLLSYP   +   ++    + +++     L  P   
Sbjct: 81  LLAKKIQTQWKKFGLDSAKLVHYDVLLSYPNETNANYISIVDEHETEIFKTSYLEPPPDG 140

Query: 738 XXXXXXXXMPYHAYSPSGSAYGKAVFLNYGR 830
                    PY+A+S  G   G  V++NY R
Sbjct: 141 YENVTNIVPPYNAFSAQGMPEGDLVYVNYAR 171



>gb:AF007544_1876072 Homo sapiens prostate-specific membrane antigen
           (PSM) gene, complete cds.
          Length = 750

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYP 662
           F+       I  +L N T  PHLAGT  +   A  ++S ++   LD+  + +Y VLLSYP
Sbjct: 61  FLDELKAENIKKFLHNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP 120

Query: 663 LSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSAYGKAVFLNYG 827
                  ++    +G+++    L EP           + P+ A+SP G   G  V++NY 
Sbjct: 121 NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA 180

Query: 828 R 830
           R
Sbjct: 181 R 181



>sp|O77564|FOH1_PIG Glutamate carboxypeptidase II (EC 3.4.17.21)
           (Membrane glutamate carboxypeptidase) (mGCP)
           (N-acetylated-alpha-linked acidic dipeptidase I)
           (NAALADase I) (Pteroylpoly-gamma-glutamate
           carboxypeptidase) (Folylpoly-gamma-glutamate
           carboxypeptidase) (FGCP) (Folate hydrolase 1)
           (Prostate-specific membrane antigen
           homolog).>gb:AF050502_1412845 Sus scrofa
           folylpoly-gamma-glutamate carboxypeptidase mRNA,
           complete cds.
          Length = 751

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYP 662
           F+       I  +L N T  PHLAGT  +   A  ++S ++   LD+  + +Y VLLSYP
Sbjct: 62  FLDELKAENIKTFLYNFTRIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP 121

Query: 663 LSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSAYGKAVFLNYG 827
                  ++    +G+++    L EP           + P+ A+SP G   G  V++NY 
Sbjct: 122 NKTRPNYISIIDEDGNEIFNTSLFEPPPPGYENVSDVVPPFSAFSPQGMPEGDLVYVNYA 181

Query: 828 R 830
           R
Sbjct: 182 R 182



>gb:BC025672_1978520 Homo sapiens folate hydrolase
           (prostate-specific membrane antigen) 1, mRNA (cDNA clone
           MGC:34488 IMAGE:5202715), complete cds.
          Length = 719

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYP 662
           F+       I  +L N T  PHLAGT  +   A  ++S ++   LD+  + +Y VLLSYP
Sbjct: 61  FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP 120

Query: 663 LSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSAYGKAVFLNYG 827
                  ++    +G+++    L EP           + P+ A+SP G   G  V++NY 
Sbjct: 121 NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA 180

Query: 828 R 830
           R
Sbjct: 181 R 181



>gb:CS007992_1455554 Sequence 1 from Patent
           EP1502602.>gb:AX467227_1469191 Sequence 1 from Patent
           WO0234287.
          Length = 750

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYP 662
           F+       I  +L N T  PHLAGT  +   A  ++S ++   LD+  + +Y VLLSYP
Sbjct: 61  FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP 120

Query: 663 LSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSAYGKAVFLNYG 827
                  ++    +G+++    L EP           + P+ A+SP G   G  V++NY 
Sbjct: 121 NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA 180

Query: 828 R 830
           R
Sbjct: 181 R 181



>sp|Q04609|FOH1_HUMAN Glutamate carboxypeptidase II (EC 3.4.17.21)
           (Membrane glutamate carboxypeptidase) (mGCP)
           (N-acetylated-alpha-linked acidic dipeptidase I)
           (NAALADase I) (Pteroylpoly-gamma-glutamate
           carboxypeptidase) (Folylpoly-gamma-glutamate
           carboxypeptidase) (FGCP) (Folate hydrolase 1)
           (Prostate-specific membrane antigen) (PSMA)
           (PSM).>pir|A56881|A56881 prostate-specific membrane
           antigen - human>gb:AX505108_1469693 Sequence 1 from
           Patent WO0240059.>gb:AF176574_1888021 Homo sapiens
           folylpoly-gamma-glutamate carboxypeptidase (FGCP) mRNA,
           complete cds.>gb:AY101595_1936448 Homo sapiens
           prostate-specific membrane antigen mRNA, complete
           cds.>gb:HUMPSM_2036007 Human prostate-specific membrane
           antigen (PSM) mRNA, complete cds.
          Length = 750

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 36/121 (29%), Positives = 57/121 (47%), Gaps = 6/121 (4%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDT-RVVNYTVLLSYP 662
           F+       I  +L N T  PHLAGT  +   A  ++S ++   LD+  + +Y VLLSYP
Sbjct: 61  FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP 120

Query: 663 LSAS---VTACFSNGSDV-PVPLSEPXXXXXXXXXXXM-PYHAYSPSGSAYGKAVFLNYG 827
                  ++    +G+++    L EP           + P+ A+SP G   G  V++NY 
Sbjct: 121 NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA 180

Query: 828 R 830
           R
Sbjct: 181 R 181



>sp|P70627|FOH1_RAT Glutamate carboxypeptidase II (EC 3.4.17.21)
           (Membrane glutamate carboxypeptidase) (mGCP)
           (N-acetylated-alpha-linked acidic dipeptidase I)
           (NAALADase I) (Pteroylpoly-gamma-glutamate
           carboxypeptidase) (Folylpoly-gamma-glutamate
           carboxypeptidase) (FGCP) (Folate hydrolase 1)
           (Prostate-specific membrane antigen
           homolog).>gb:AF040256_2051938 Rattus norvegicus
           glutamate carboxypeptidase II mRNA, complete
           cds.>gb:AF513486_2067281 Rattus norvegicus N-acetylated
           alpha-linked acidic dipeptidase (Naalad) mRNA, complete
           cds.>gb:RNU75973_2137723 Rattus norvegicus
           NAAG-peptidase mRNA, complete cds.
          Length = 752

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 45/154 (29%), Positives = 67/154 (43%), Gaps = 9/154 (5%)
 Frame = +3

Query: 396 FIIVFLATLHHHSRRDLTA-VKRNGLYYRNDFISSASNYTIAAYLRNLTGRPHLAGTPSS 572
           FII FL         D T+ V   G+  +  F+       I  +L N T  PHLAGT  +
Sbjct: 34  FIIGFLFGWFIKPSNDSTSSVSYPGM--KKAFLQELKAENIKKFLYNFTRTPHLAGTQHN 91

Query: 573 LGAAVYVKSHFERLKLD-TRVVNYTVLLSYPLSAS---VTACFSNGSDV----PVPLSEP 728
              A  + + ++   LD   + +Y VLLSYP       ++    +G+++       LS P
Sbjct: 92  FELAKQIHAQWKEFGLDLVELSDYDVLLSYPNKTHPNYISIINEDGNEIFKTSLAELSPP 151

Query: 729 XXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYGR 830
                       PY A+SP G+  G  V++NY R
Sbjct: 152 GYENISDVVP--PYSAFSPQGTPEGDLVYVNYAR 183



>gb:CR382124_1657055 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 760

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 41/165 (24%), Positives = 63/165 (38%), Gaps = 5/165 (3%)
 Frame = +3

Query: 348 KMAIKFKFTYSLIFVMFIIVFLATLHHHSRRDLTAVKRNGLYYRNDFISS--ASNYTIAA 521
           K A+   F   L   + + +   +    S RD +      L Y      S  A N++   
Sbjct: 34  KKALSLSFQVGLFCYLLVNILSYSFSSSSHRDRSQATATELAYLKTLDDSNLAGNWS--- 90

Query: 522 YLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGS 701
               LT  PHLAG    L    +  S FE   L T V  + + ++YP+   +T    +  
Sbjct: 91  --EKLTSVPHLAGKGIEL--VNWTASKFEEYGLKTEVEAFDIYMNYPVDNGLTLLQEDEP 146

Query: 702 DVPVPLSE---PXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
                L+E   P             +H YS SG+   + V++NYG
Sbjct: 147 VFKANLTEDHLPEDSTTGGDDLVPAFHGYSASGNVTAEFVYVNYG 191



>gb:U88179_1406687 Caenorhabditis elegans cosmid R57, complete
           sequence.
          Length = 576

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 45/166 (27%), Positives = 69/166 (41%), Gaps = 16/166 (9%)
 Frame = +3

Query: 378 SLIFVMFIIVFLATLHHHSRRDLTAVKRNGL--YYRND---FISSASNYTIAAYLRNLTG 542
           SLIFV F I  L    HHS R      +  +   +++D      +     I  YLR  T 
Sbjct: 11  SLIFV-FCIAALGV--HHSERKFNKFNKVSIDDIHKSDAGVIQDNIKTENIKKYLRIFTK 67

Query: 543 RPHLAGTPSSLGAAVYVKSHFERLKL-DTRVVNYTVLLSYP----------LSASVTACF 689
            PH+AGT ++   A  + + +    L D   + Y VLLSYP           S++    F
Sbjct: 68  DPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVF 127

Query: 690 SNGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
            +    PV + +              + AY+ +GSA    V++N+G
Sbjct: 128 KSKGVSPVIIPDEQSGKYAGH----QWLAYAGNGSASADVVYINHG 169



>gb:U88179_1406686 Caenorhabditis elegans cosmid R57, complete
           sequence.
          Length = 770

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 45/166 (27%), Positives = 69/166 (41%), Gaps = 16/166 (9%)
 Frame = +3

Query: 378 SLIFVMFIIVFLATLHHHSRRDLTAVKRNGL--YYRND---FISSASNYTIAAYLRNLTG 542
           SLIFV F I  L    HHS R      +  +   +++D      +     I  YLR  T 
Sbjct: 30  SLIFV-FCIAALGV--HHSERKFNKFNKVSIDDIHKSDAGVIQDNIKTENIKKYLRIFTK 86

Query: 543 RPHLAGTPSSLGAAVYVKSHFERLKL-DTRVVNYTVLLSYP----------LSASVTACF 689
            PH+AGT ++   A  + + +    L D   + Y VLLSYP           S++    F
Sbjct: 87  DPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVF 146

Query: 690 SNGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
            +    PV + +              + AY+ +GSA    V++N+G
Sbjct: 147 KSKGVSPVIIPDEQSGKYAGH----QWLAYAGNGSASADVVYINHG 188



>sp|P91406|GCP2_CAEEL Glutamate carboxypeptidase II homolog (EC
           3.4.17.21).>pir|T30154|T30154 hypothetical protein R57.1
           - Caenorhabditis elegans
          Length = 751

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 45/166 (27%), Positives = 69/166 (41%), Gaps = 16/166 (9%)
 Frame = +3

Query: 378 SLIFVMFIIVFLATLHHHSRRDLTAVKRNGL--YYRND---FISSASNYTIAAYLRNLTG 542
           SLIFV F I  L    HHS R      +  +   +++D      +     I  YLR  T 
Sbjct: 11  SLIFV-FCIAALGV--HHSERKFNKFNKVSIDDIHKSDAGVIQDNIKTENIKKYLRIFTK 67

Query: 543 RPHLAGTPSSLGAAVYVKSHFERLKL-DTRVVNYTVLLSYP----------LSASVTACF 689
            PH+AGT ++   A  + + +    L D   + Y VLLSYP           S++    F
Sbjct: 68  DPHVAGTEANKKVAYEIANAWSEAGLEDVHTLPYEVLLSYPDFENPNSVIIKSSAGKEVF 127

Query: 690 SNGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
            +    PV + +              + AY+ +GSA    V++N+G
Sbjct: 128 KSKGVSPVIIPDEQSGKYAGH----QWLAYAGNGSASADVVYINHG 169



>gb:CR382128_1660550 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 758

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = +3

Query: 537 TGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGSDV-PV 713
           T  PHLAGT   L  A + +   +    D  +  Y V L+YPL  ++     NG  +   
Sbjct: 75  TAEPHLAGTNKEL--AEWTRDQLQSFGWDAGIEEYEVYLNYPLDHALNLVDDNGKVIYEA 132

Query: 714 PLSEPXXXX--XXXXXXXMP-YHAYSPSGSAYGKAVFLNYG 827
            L E              +P +H YS +G+   + V+ NYG
Sbjct: 133 SLEEDVLKEDPTTGLRDRVPTFHGYSANGNVTAQFVYANYG 173



>gb:CR382138_1671306 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 808

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 38/150 (25%), Positives = 59/150 (39%), Gaps = 22/150 (14%)
 Frame = +3

Query: 444 LTAVKRNGLYYRNDFISSA---------SNYTIAAYLRNLTGR--------PHLAGTPSS 572
           L  V  +GL + N  IS A         S   + A   NL G          HL GT  +
Sbjct: 35  LAIVAFSGLIFTNRIISLAPEVNEREDRSKIYLKALETNLAGNWSQKYTSEAHLPGT--N 92

Query: 573 LGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGS----DVPVPLSEPXXXX 740
            G   + K+ FE     T + +Y V +SYP    +    + G     + P+   E     
Sbjct: 93  YGFVEWTKNKFEEYGFKTCIDSYDVYVSYPFQHDLKLLDAKGKHTLYEAPLREDELDEDK 152

Query: 741 XXXXXXXMP-YHAYSPSGSAYGKAVFLNYG 827
                  +P + +YS +G+   + V++NYG
Sbjct: 153 TSKGKDLVPTFLSYSANGNVTAQYVYVNYG 182



>gb:BA000045_741442 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 790

 Score = 36.6 bits (83), Expect = 0.60
 Identities = 27/117 (23%), Positives = 46/117 (39%), Gaps = 3/117 (2%)
 Frame = +3

Query: 486 FISSASNYTIAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPL 665
           F S      +  + R L  RPH  G+P     A ++ + +        +  + VL   P+
Sbjct: 79  FDSLIDKNNLQNWTRRLAARPHHVGSPVQKEHAEFLVAQYRSWGYQAEIERFDVLFPVPV 138

Query: 666 SASVTACFSNGSDVPVPLSEP--XXXXXXXXXXXMP-YHAYSPSGSAYGKAVFLNYG 827
           + S+             L+EP             +P Y+AYS  G   G+ V++N+G
Sbjct: 139 TRSLELVAP--MKFKAKLAEPPLKEDAGTAQAGQLPVYNAYSADGDVTGELVYVNFG 193



>gb:PPO543320_1395617 Physarum polycephalum mRNA for
           poly(L-malate)-hydrolase precursor (pma gene).
          Length = 705

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 8/110 (7%)
 Frame = +3

Query: 522 YLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVN-YTVLLSYPL-------SASV 677
           +L+  T  PHLAG+      AVY    F    L   V++   V+ ++PL        A  
Sbjct: 42  HLQYYTSSPHLAGSQRDYETAVYTHDKFVEYGLSDVVIHTQHVVANFPLQRELELRKADG 101

Query: 678 TACFSNGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
           T  F+ G   P  + +P             ++ +S SG+   + V+ NYG
Sbjct: 102 TVLFTAGLYEPPLVEDPYDPAEDPT-----FNMFSGSGTVTNRIVYANYG 146



>gb:AY600247_1340191 Physarum polycephalum poly(L-malate)-hydrolase
           (polymalatase) (pma) gene, complete cds; and
           microsatellite sequence.
          Length = 706

 Score = 35.8 bits (81), Expect = 1.0
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 8/110 (7%)
 Frame = +3

Query: 522 YLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVN-YTVLLSYPL-------SASV 677
           +L+  T  PHLAG+      AVY    F    L   V++   V+ ++PL        A  
Sbjct: 42  HLQYYTSSPHLAGSQRDYETAVYTHDKFVEYGLSDVVIHTQHVVANFPLQRELELRKADG 101

Query: 678 TACFSNGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
           T  F+ G   P  + +P             ++ +S SG+   + V+ NYG
Sbjct: 102 TVLFTAGLYEPPLVEDPYDPAEDPT-----FNMFSGSGTVTNRIVYANYG 146



>pir|T19751|T19751 hypothetical protein C35C5.2 - Caenorhabditis
           elegans>gb:CEC35C5_1361006 Caenorhabditis elegans cosmid
           C35C5, complete sequence.
          Length = 1483

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 12/115 (10%)
 Frame = +3

Query: 513 IAAYLRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVN-YTVLLSYP--------- 662
           I + L +LT +PH+AGT ++L  A  ++       L+    N Y V+LSYP         
Sbjct: 76  IRSNLHSLTKKPHVAGTENNLRVAEMIRDQMITQGLENVHFNEYNVMLSYPNWTTPNIIE 135

Query: 663 -LSASVTACFS-NGSDVPVPLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLN 821
            L  +    FS  G  V V   E            + + AYS +G+  G  V++N
Sbjct: 136 ILKENRDLVFSTTGRSVSVIKEE-----QNDPLAEIQWLAYSAAGTVEGDIVYVN 185



>sp|O54697|NLDL_RAT N-acetylated-alpha-linked acidic dipeptidase
           like protein (EC 3.4.17.21) (NAALADase L) (Ileal
           dipeptidylpeptidase) (100 kDa ileum brush border
           membrane protein) (I100).>gb:AF009921_2050497 Rattus
           norvegicus ileal peptidase I100 mRNA, complete cds.
          Length = 745

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 33/112 (29%), Positives = 46/112 (41%), Gaps = 11/112 (9%)
 Frame = +3

Query: 525 LRNLTGRPHLAGTPSSLGAAVYVKSHFERLK-----LDT-RVVNYTVLLSYPLSASVTAC 686
           LR L+  PH+A   +S      V+    R K     LDT +   YTVLLS+P +    + 
Sbjct: 66  LRELSKEPHVA---TSARDEALVQLLLGRWKDSASGLDTAKTYEYTVLLSFPSTEQPNSV 122

Query: 687 FSNGSDVPV-----PLSEPXXXXXXXXXXXMPYHAYSPSGSAYGKAVFLNYG 827
              G +  V     P  +             PY AY+P G+  G  V+ N G
Sbjct: 123 EVVGPNGTVFHSFQPFEKNLTGEQAEPNVLQPYAAYAPPGTPKGPLVYANRG 174



>gb:CR382130_1662341 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 577

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = -2

Query: 740 SRNSRLRQRDGNIGTVAKTRRDRSAQRVRQKNGVVNDAGVELEALE 603
           + NSR RQR+      A+ +R+R A + R K  +V D   ++EAL+
Sbjct: 310 AENSRKRQRESKAERKAEEKREREADKARFKKLMVKDVVKKMEALK 355



>gb:AE016814_1745723 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 802

 Score = 33.1 bits (74), Expect = 6.6
 Identities = 20/61 (32%), Positives = 28/61 (45%)
 Frame = +3

Query: 525 LRNLTGRPHLAGTPSSLGAAVYVKSHFERLKLDTRVVNYTVLLSYPLSASVTACFSNGSD 704
           L  L+  PH+AGT   +    YVKS F    L     +Y   ++YP   S T  F +G  
Sbjct: 191 LEYLSKMPHMAGTKGDMAMLNYVKSSFSNNGLKVIQRDYQTYINYPGPVS-TEIFKDGKS 249

Query: 705 V 707
           +
Sbjct: 250 L 250



>pir|S42039|S42039 hypothetical protein 2 - Leuconostoc oenos
           plasmid p4028>gb:LEUORF15X_140365 Leuconostoc oenos
           complete ORF1-ORF5.>gb:LOPLORFG_141708 L.oenos plasmid
           p4028 ORF1, ORF2, ORF3, ORF4, ORF5 genes.
          Length = 397

 Score = 32.7 bits (73), Expect = 8.6
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = +3

Query: 330 MLRAPTKMAIKFKFTYSLIFVMFIIVFLATLHHHSRRDLTAVKRNGLYYRN 482
           ML+ P  M   +K  ++++F+  IIVFLA+   H +  + A+++  +   N
Sbjct: 1   MLQVPFYM--NYKLVFTIVFIALIIVFLASFLQHRQHSIKALRKKTIKQYN 49


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 696,899,109
Number of Sequences: 1806583
Number of extensions: 12601468
Number of successful extensions: 31386
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 30564
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31346
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 55035364698
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)