BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3884
         (1205 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB124880_1528099 Nicotiana tabacum mRNA for ubiquitin activat...   519   e-146   
gb:AB124879_1528098 Nicotiana tabacum mRNA for ubiquitin activat...   516   e-145   
sp|P31251|UBA2_WHEAT|UBA2_WHEAT Ubiquitin-activating enzyme E1 2.>gb:WHTE1A...   460   e-128   Triticum aestivum [Canadian hard winter wheat]
pir|T03964|T03964 probable ubiquitin-protein ligase (EC 6.3.2.19...   459   e-128   Nicotiana tabacum [American tobacco]
sp|P20973|UBA1_WHEAT|UBA1_WHEAT Ubiquitin-activating enzyme E1 1.>pir|A3837...   459   e-128   Triticum aestivum [Canadian hard winter wheat]
gb:AB006700_1509915 Arabidopsis thaliana genomic DNA, chromosome...   458   e-127   
gb:AY090248_1574001 Arabidopsis thaliana At2g30110/T27E13.15 mRN...   456   e-127   
pir|T00587|T00587 probable ubiquitin-protein ligase (EC 6.3.2.19...   456   e-127   Arabidopsis thaliana [mouse-ear cress]
gb:AP004333_1840369 Oryza sativa (japonica cultivar-group) genom...   452   e-126   
sp|P31252|UBA3_WHEAT|UBA3_WHEAT Ubiquitin-activating enzyme E1 3.>pir|T0648...   448   e-124   Triticum aestivum [Canadian hard winter wheat]
gb:BC047256_2549875 Xenopus laevis ubiquitin activating enzyme, ...   279   7e-74   
gb:AB040073_2461837 Xenopus laevis E1 mRNA for ubiquitin activat...   276   5e-73   
gb:BC064684_2553874 Xenopus laevis cDNA clone MGC:68851 IMAGE:46...   274   2e-72   
gb:AB035495_2461636 Carassius auratus mRNA for ubiquitin-activat...   262   1e-68   
gb:BC060674_2552969 Danio rerio ubiquitin-activating enzyme E1 (...   255   1e-66   
gb:BT007751_2150683 Synthetic construct Homo sapiens ubiquitin-a...   253   4e-66   
sp|P22314|UBA1_HUMAN|UBA1_HUMAN Ubiquitin-activating enzyme E1 (A1S9 protei...   253   4e-66   Homo sapiens [man]
sp|Q29504|UBA1_RABIT|UBA1_RABIT Ubiquitin-activating enzyme E1.>gb:OCU58653...   253   7e-66   Oryctolagus cuniculus [domestic rabbit]
gb:HSQAE1_2019854 Human mRNA for ubiquitin activating enzyme E1.      252   1e-65   
gb:BC085791_2109358 Rattus norvegicus cDNA clone MGC:93773 IMAGE...   248   2e-64   
gb:AE013599_1130895 Drosophila melanogaster chromosome 2R, compl...   247   3e-64   
sp|Q02053|UBA1_MOUSE|UBA1_MOUSE Ubiquitin-activating enzyme E1 1.>pir|JC125...   247   3e-64   Mus musculus [mouse]
gb:MMC3HUBE9_2114367 Mus musculus ubiquitin activating enzyme E1...   247   4e-64   
gb:AF150963_2056718 Mus musculus ubiquitin-activating enzyme E1 ...   247   4e-64   
gb:AK030031_1161792 Mus musculus adult male testis cDNA, RIKEN f...   247   4e-64   
gb:DMRNAUAE_1380074 Drosophila melanogaster mRNA for ubiquitin a...   244   2e-63   
gb:AE017341_1753963 Cryptococcus neoformans var. neoformans JEC2...   242   1e-62   
gb:CR382122_1655428 Kluyveromyces lactis strain NRRL Y-1140 chro...   237   3e-61   
gb:CR382138_1671481 Debaryomyces hansenii chromosome F of strain...   234   2e-60   
gb:SPBC211_1719506 S.pombe chromosome II cosmid c211.                 233   8e-60   
pir|T50344|T50344 poly(A)+ RNA transport protein Ptr3p [imported...   233   8e-60   Schizosaccharomyces pombe
sp|O94609|UBA1_SCHPO|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 (Poly(A)+ ...   233   8e-60   Schizosaccharomyces pombe
gb:CR382131_1663710 Yarrowia lipolytica chromosome E of strain C...   228   1e-58   
gb:SCUBA1G_1710621 Yeast UBA1 gene for ubiquitin-activating enzyme.   221   3e-56   
sp|P22515|UBA1_YEAST|UBA1_YEAST Ubiquitin-activating enzyme E1 1.>pir|S3804...   221   3e-56   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380957_1652525 Candida glabrata strain CBS138 chromosome K ...   219   7e-56   
gb:AK049603_1168884 Mus musculus 12 days embryo spinal cord cDNA...   218   3e-55   
gb:AL513366_1928885 Human DNA sequence from clone CTD-2522E6 on ...   216   6e-55   
gb:AL513366_1928882 Human DNA sequence from clone CTD-2522E6 on ...   216   6e-55   
gb:HSM803766_2017722 Homo sapiens mRNA; cDNA DKFZp451P021 (from ...   214   3e-54   
gb:AE016819_1749268 Ashbya gossypii (= Eremothecium gossypii) AT...   214   4e-54   
gb:BX908809_1644599 Neurospora crassa DNA linkage group IV Cosmi...   214   4e-54   
gb:HSM803322_2017685 Homo sapiens mRNA; cDNA DKFZp451F154 (from ...   213   8e-54   
gb:BC031637_1980200 Homo sapiens hypothetical protein FLJ10808, ...   212   1e-53   
gb:AB014773_1864666 Homo sapiens mRNA for MOP-4, complete cds.        212   1e-53   
gb:AX418480_1468164 Sequence 1 from Patent WO0206485.                 212   1e-53   
gb:AK094969_1914275 Homo sapiens cDNA FLJ37650 fis, clone BRHIP2...   207   3e-52   
gb:AF288693_2061629 Mus musculus Ube1l (Ube1l) gene, partial cds.     206   6e-52   
gb:AK089235_1175857 Mus musculus NOD-derived CD11c +ve dendritic...   206   6e-52   
gb:AK004894_1152673 Mus musculus adult male liver cDNA, RIKEN fu...   206   6e-52   
gb:BT007757_2150689 Synthetic construct Homo sapiens ubiquitin-a...   199   7e-50   
gb:BC006378_1970240 Homo sapiens ubiquitin-activating enzyme E1-...   199   7e-50   
sp|P41226|UBAL_HUMAN|UBAL_HUMAN Ubiquitin-activating enzyme E1 homolog (D8)...   199   7e-50   Homo sapiens [man]
gb:FRU010348_2572058 Fugu rubripes UBE1-like gene, PRGFR2 gene a...   198   2e-49   
pir|T30812|T30812 ubiquitin-protein ligase (EC 6.3.2.19) - Fugu ...   198   2e-49   Takifugu rubripes [tiger puffer]
pir|A48195|A48195 ubiquitin-protein ligase E1 homolog - human         197   4e-49   Homo sapiens [man]
gb:AY597816_1431786 Bos taurus ubiquitin E1-like enzyme mRNA, co...   195   2e-48   
gb:AE014188_968056 Plasmodium falciparum 3D7 chromosome 12, comp...   169   1e-40   
gb:AC117076_1207861 Dictyostelium discoideum chromosome 2 map 33...   162   1e-38   
gb:MMUBE1Y2_2124228 Mus musculus ubiquitin-activating enzyme (Ub...   160   6e-38   
pir|I49380|I49380 ubiquitin-activating enzyme - mouse (fragment)      160   6e-38   Mus musculus [mouse]
pir|T20004|T20004 hypothetical protein C47E12.5 - Caenorhabditis...   157   3e-37   Caenorhabditis elegans [roundworm]
gb:CNS07EGA_1373003 chromosome III of strain GB-M1 of Encephalit...   142   1e-32   
gb:AL513366_1928880 Human DNA sequence from clone CTD-2522E6 on ...   139   1e-31   
gb:AL513366_1928883 Human DNA sequence from clone CTD-2522E6 on ...   121   3e-26   
gb:AY684131_1622186 Vitis vinifera ubiquitin-activating enzyme m...   120   4e-26   
gb:AL513366_1928881 Human DNA sequence from clone CTD-2522E6 on ...   114   5e-24   
gb:LMFL6586_1388304 Leishmania major Friedlin chromosome 23 cosm...   105   1e-21   
gb:BC079411_2107524 Rattus norvegicus ubiquitin-like 1 (sentrin)...   102   2e-20   
sp|Q9R1T2|SAE1_MOUSE|SAE1_MOUSE Ubiquitin-like 1 activating enzyme E1A (SUM...    99   2e-19   Mus musculus [mouse]
gb:AY099426_2512340 Xenopus laevis SUMO-1 activating enzyme E1 N...    98   3e-19   
gb:AF090385_1882423 Homo sapiens SUMO-1-activating enzyme E1 N s...    97   7e-19   
gb:AX880028_1478095 Sequence 14933 from Patent EP1074617.              97   7e-19   
gb:AX878852_1477583 Sequence 13757 from Patent EP1074617.              97   7e-19   
gb:CR925978_1185505 Pongo pygmaeus mRNA; cDNA DKFZp459I1120 (fro...    97   7e-19   
gb:CR861251_1185259 Pongo pygmaeus mRNA; cDNA DKFZp459P123 (from...    97   7e-19   
sp|Q9UBE0|SAE1_HUMAN|SAE1_HUMAN Ubiquitin-like 1 activating enzyme E1A (SUM...    97   7e-19   Homo sapiens [man]
gb:CR860370_1184443 Pongo pygmaeus mRNA; cDNA DKFZp459A1012 (fro...    97   9e-19   
gb:AF161489_1150382 Homo sapiens HSPC140 mRNA, complete cds.           96   1e-18   
gb:AF218863_1252106 Drosophila melanogaster Smt3 activating enzy...    89   2e-16   
gb:AF193554_1249726 Drosophila melanogaster ubiquitin-like prote...    89   2e-16   
gb:AE014297_1139221 Drosophila melanogaster chromosome 3R, compl...    89   2e-16   
gb:BC071328_2556070 Danio rerio zgc:86633, mRNA (cDNA clone MGC:...    86   2e-15   
gb:PFMAL13_1191399 Plasmodium falciparum 3D7 chromosome 13, *** ...    81   4e-14   
gb:U13875_1401865 Caenorhabditis elegans cosmid C26E6, complete ...    76   1e-12   
gb:CR382131_1664615 Yarrowia lipolytica chromosome E of strain C...    74   6e-12   
gb:LES011418_1684456 Lycopersicon esculentum mRNA for ubiquitin ...    73   1e-11   
gb:AF510524_1807241 Arabidopsis thaliana SUMO activating enzyme ...    73   1e-11   
gb:AF357838_1790808 Solanum tuberosum ubiquitin activating enzym...    73   1e-11   
gb:AB023037_1515382 Arabidopsis thaliana genomic DNA, chromosome...    73   1e-11   
gb:AY086686_1571730 Arabidopsis thaliana clone 26820 mRNA, compl...    72   2e-11   
pir|T19082|T19082 hypothetical protein C08B6.9 - Caenorhabditis ...    71   4e-11   Caenorhabditis elegans [roundworm]
sp|P79064|RA31_SCHPO|RA31_SCHPO DNA damage tolerance protein rad31.>pir|T45...    70   7e-11   Schizosaccharomyces pombe
gb:CR382132_1666102 Yarrowia lipolytica chromosome F of strain C...    69   1e-10   
gb:HSM801766_1186432 Homo sapiens mRNA; cDNA DKFZp434P241 (from ...    69   1e-10   
gb:AE010684_265644 Methanosarcina acetivorans str. C2A, section ...    69   1e-10   
gb:AE016818_1747877 Ashbya gossypii (= Eremothecium gossypii) AT...    69   2e-10   
gb:RNU90829_2137903 Rattus norvegicus APP-binding protein 1 mRNA...    69   2e-10   
pir|F88444|F88444 protein C26E6.8 [imported] - Caenorhabditis el...    69   2e-10   Caenorhabditis elegans [roundworm]
gb:AE010126_259576 Pyrococcus furiosus DSM 3638, section 1 of 17...    68   3e-10   
pir|E71224|E71224 probable HESA protein - Pyrococcus horikoshii>...    68   3e-10   Pyrococcus horikoshii
pir|D75192|D75192 molybdenum cofactor biosynthesis protein (moeb...    68   3e-10   Pyrococcus abyssi
gb:BC019163_2092821 Mus musculus amyloid beta precursor protein ...    68   4e-10   
gb:CR382137_1669639 Debaryomyces hansenii chromosome E of strain...    68   4e-10   
gb:AY072375_1567192 Arabidopsis thaliana ubiquitin activating en...    67   7e-10   
pir|T05515|T05515 ubiquitin-activating enzyme homolog F13M23.80 ...    67   7e-10   Arabidopsis thaliana [mouse-ear cress]
gb:CR382136_1668932 Debaryomyces hansenii chromosome D of strain...    67   9e-10   
gb:BC023680_2094206 Mus musculus amyloid beta precursor protein ...    66   1e-09   
gb:AC142210_1744085 Solanum demissum chromosome 11 BAC PGEC589 g...    65   4e-09   
gb:AX764247_1474526 Sequence 59 from Patent WO03040681.                65   4e-09   
gb:BX927154_833575 Corynebacterium glutamicum ATCC 13032, IS fin...    65   4e-09   
gb:BA000036_719769 Corynebacterium glutamicum ATCC 13032 DNA, co...    65   4e-09   
gb:AP006878_577269 Thermococcus kodakaraensis strain KOD1 DNA, c...    65   4e-09   
gb:AE017180_399207 Geobacter sulfurreducens PCA, complete genome.      65   4e-09   
gb:AE016962_368098 Coxiella burnetii strain RSA 493, section 3 o...    65   4e-09   
sp|Q06624|RH31_YEAST|RH31_YEAST DNA damage tolerance protein RHC31 (RAD31 h...    65   4e-09   Saccharomyces cerevisiae [brewer's yeast]
gb:BC068838_2555336 Xenopus laevis hypothetical protein MGC81483...    64   5e-09   
gb:AJ720838_2503025 Gallus gallus mRNA for hypothetical protein,...    64   5e-09   
gb:AY623106_1618403 Pisum sativum ubiquitin activating enzyme E1...    64   6e-09   
gb:BC055513_2551381 Danio rerio amyloid beta precursor protein b...    63   1e-08   
gb:BC050171_2550350 Danio rerio amyloid beta precursor protein b...    63   1e-08   
gb:CR380953_1651043 Candida glabrata strain CBS138 chromosome G ...    62   2e-08   
gb:AY142853_592036 Heliobacillus mobilis unknown gene.                 62   2e-08   
gb:AC104433_1737636 Oryza sativa chromosome 3 BAC OJ1754_E06 gen...    62   3e-08   
gb:AC104433_1737635 Oryza sativa chromosome 3 BAC OJ1754_E06 gen...    62   3e-08   
gb:BA000023_692959 Sulfolobus tokodaii str. 7 DNA, complete genome.    61   4e-08   
gb:AE017173_396785 Porphyromonas gingivalis W83 section 2 of 8 o...    61   4e-08   
gb:AE014186_938416 Plasmodium falciparum 3D7 chromosome 11 compl...    61   5e-08   
gb:CR628339_116291 Legionella pneumophila str. Lens plasmid pLPL...    61   5e-08   
pir|F90172|F90172 hypothetical protein thiF [imported] - Sulfolo...    61   5e-08   Saccharolobus solfataricus
gb:CR382125_1657428 Kluyveromyces lactis strain NRRL Y-1140 chro...    60   9e-08   
gb:CR543861_104281 Acinetobacter sp. ADP1 complete genome.             60   1e-07   
gb:CR628338_116153 Legionella pneumophila str. Paris plasmid pLP...    59   2e-07   
sp|P42744|AXR1_ARATH|AXR1_ARATH Auxin-resistance protein AXR1.>pir|S35071|S...    59   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY591340_1616670 Zea mays putative ubiquitin-activating enzym...    59   3e-07   
gb:BT001291_1356064 Drosophila melanogaster AT09990 full insert ...    59   3e-07   
gb:AE014296_1135771 Drosophila melanogaster chromosome 3L, compl...    59   3e-07   
gb:AE016928_360016 Bacteroides thetaiotaomicron VPI-5482, sectio...    59   3e-07   
gb:AE013870_300969 Yersinia pestis KIM section 270 of 415 of the...    59   3e-07   
gb:BA000035_716720 Corynebacterium efficiens YS-314 DNA, complet...    58   3e-07   
pir|C83827|C83827 molybdopterin biosynthesis moeB [imported] - B...    58   3e-07   Bacillus halodurans
pir|G84732|G84732 probable ubiquitin activating enzyme [imported...    58   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:ECTHICEFGH_132837 Escherichia coli thiCEFSGH operon, complete...    58   4e-07   
sp|P30138|THIF_ECOLI|THIF_ECOLI Adenylyltransferase thiF (EC 2.7.7.-).            58   4e-07   Escherichia coli [E. coli]
gb:AE017353_1760151 Cryptococcus neoformans var. neoformans JEC2...    57   6e-07   
gb:AP006841_573060 Bacteroides fragilis YCH46 DNA, complete genome.    57   6e-07   
gb:CP000031_84121 Silicibacter pomeroyi DSS-3, complete genome.        57   6e-07   
gb:AE005674_73648 Shigella flexneri 2a str. 301, complete genome...    57   6e-07   
pir|B82369|B82369 thiF protein VC0063 [imported] - Vibrio choler...    57   6e-07   Vibrio cholerae
pir|C65206|C65206 thiF protein - Escherichia coli (strain K-12)>...    57   6e-07   Escherichia coli K-12
gb:BX936398_836154 Yersinia pseudotuberculosis IP32953 genome, c...    57   7e-07   
pir|AB0182|AB0182 molybdopterin biosynthesis protein [imported] ...    57   7e-07   Yersinia pestis
pir|A86091|A86091 thiamin biosynthesis, thiazole moiety thiF [im...    57   7e-07   Escherichia coli O157:H7
gb:AY251481_1313095 Schistosoma japonicum IR3 (IR3) mRNA, comple...    57   1e-06   
gb:CP000020_870210 Vibrio fischeri ES114 chromosome I, complete ...    57   1e-06   
gb:BA000038_725181 Vibrio vulnificus YJ016 DNA, chromosome II, c...    57   1e-06   
gb:AE017283_430303 Propionibacterium acnes KPA171202, complete g...    57   1e-06   
gb:AE017266_422034 Bacillus cereus ATCC 10987, section 3 of 18 o...    57   1e-06   
gb:AE016809_338284 Vibrio vulnificus CMCP6 chromosome II section...    57   1e-06   
gb:CP000026_78635 Salmonella enterica subsp. enterica serovar Pa...    57   1e-06   
gb:AE017356_1760263 Cryptococcus neoformans var. neoformans JEC2...    56   1e-06   
gb:APU47055_582400 Anabaena PCC7120 nitrogen fixation proteins (...    56   1e-06   
gb:AE013388_291863 Methanosarcina mazei strain Goe1, section 170...    56   2e-06   
pir|E72538|E72538 probable HESA protein APE1594 - Aeropyrum pern...    56   2e-06   Aeropyrum pernix
sp|P46048|HEA2_ANAVA|HEA2_ANAVA Protein hesA, vegetative.>pir|S70247|S70247...    56   2e-06   
gb:HSA1S9_2000505 Human A1S9 mRNA for A1S9 protein of unknown fu...    55   2e-06   
gb:BA000032_709711 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    55   2e-06   
gb:AE016770_328915 Escherichia coli CFT073 section 16 of 18 of t...    55   2e-06   
pir|T38643|T38643 conserved hypothetical protein SPAC323.06c - f...    55   2e-06   Schizosaccharomyces pombe
pir|AH0932|AH0932 thiamin biosynthesis protein [imported] - Salm...    55   2e-06   Salmonella enterica subsp. enterica serovar Typhi
pir|C81953|C81953 ThiF protein NMA0373 [imported] - Neisseria me...    55   3e-06   Neisseria meningitidis serogroup A
gb:AE017282_428928 Methylococcus capsulatus str. Bath, complete ...    55   4e-06   
gb:AE009801_255854 Pyrobaculum aerophilum strain IM2 section 56 ...    55   4e-06   
gb:AE017346_1757224 Cryptococcus neoformans var. neoformans JEC2...    54   5e-06   
gb:AE017000_375697 Bacillus cereus ATCC 14579 section 3 of 18 of...    54   5e-06   
gb:AE015685_316816 Shewanella oneidensis MR-1 section 234 of 457...    54   5e-06   
pir|S11900|S11900 hypothetical protein 1 - Anabaena sp.>gb:ASHES...    54   5e-06   Nostoc sp. PCC 7120
pir|AE0455|AE0455 thiamin biosynthesis protein ThiF [imported] -...    54   5e-06   Yersinia pestis
sp|P18500|HESA_ANASP|HESA_ANASP Protein hesA.>pir|AE1985|AE1985 HesA protei...    54   5e-06   Anabaena sp.
gb:BX897675_1644354 Neurospora crassa DNA linkage group IV BAC c...    54   6e-06   
gb:U40187_1403273 Caenorhabditis elegans cosmid F11H8, complete ...    54   6e-06   
gb:PPU65651_1395663 Physarum polycephalum ubiquitin-activating e...    54   6e-06   
gb:CP000020_871785 Vibrio fischeri ES114 chromosome I, complete ...    54   6e-06   
pir|T16037|T16037 hypothetical protein F11H8.1 - Caenorhabditis ...    54   6e-06   Caenorhabditis elegans [roundworm]
gb:BA000043_737203 Geobacillus kaustophilus HTA426 DNA, complete...    54   8e-06   
gb:AP008226_578801 Thermus thermophilus HB8 genomic DNA, complet...    54   8e-06   
gb:AE017304_436613 Thermus thermophilus HB27 section 4 of 7 of t...    54   8e-06   
gb:PFMAL8P1_1192168 Plasmodium falciparum 3D7 chromosome 8, *** ...    53   1e-05   
gb:AE017355_461964 Bacillus thuringiensis serovar konkukian str....    53   1e-05   
gb:STYSTMF1_195070 Salmonella typhimurium fragment STMF1.>gb:AE0...    53   1e-05   
gb:CR382130_1662556 Yarrowia lipolytica chromosome D of strain C...    53   1e-05   
gb:AF167538_484959 Trichodesmium sp. IMS101 nif gene cluster, pa...    53   1e-05   
gb:AF003700_467306 Cyanothece PCC 8801 NifK (nifK) gene, partial...    53   1e-05   
gb:AE004969_61656 Neisseria gonorrhoeae FA 1090, complete genome.      53   1e-05   
pir|E69845|E69845 thiamin biosynthesis homolog yjbU - Bacillus s...    53   1e-05   Bacillus subtilis
pir|B81010|B81010 thiF protein NMB2062 [imported] - Neisseria me...    52   2e-05   Neisseria meningitidis serogroup B
sp|Q09810|YABA_SCHPO|YABA_SCHPO Hypothetical protein C2G11.10c in chromosom...    52   2e-05   Schizosaccharomyces pombe
sp|Q09765|UBA3_SCHPO|UBA3_SCHPO Ubiquitin-activating enzyme E1 3.>pir|T3836...    52   2e-05   Schizosaccharomyces pombe
gb:CR382125_1657348 Kluyveromyces lactis strain NRRL Y-1140 chro...    52   2e-05   
gb:AY596297_633407 Haloarcula marismortui ATCC 43049 chromosome ...    52   2e-05   
gb:AJ627421_527934 Uncultured crenarchaeote genomic fragment 68f19.    52   2e-05   
gb:AE017026_380986 Bacillus anthracis str. Ames section 3 of 18 ...    52   2e-05   
gb:BX957222_844487 Methanococcus maripaludis S2 complete genome;...    52   3e-05   
gb:AE017013_379584 Bacillus cereus ATCC 14579 section 16 of 18 o...    52   3e-05   
gb:AY683450_1622171 Lemna minor ubiquitin activating enzyme E1 (...    51   4e-05   
gb:AE017279_426066 Bacillus cereus ATCC 10987, section 16 of 18 ...    51   4e-05   
gb:AE016925_359219 Chromobacterium violaceum ATCC 12472 section ...    51   4e-05   
gb:CP000009_864225 Gluconobacter oxydans 621H, complete genome.        51   5e-05   
gb:BA000031_708485 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    51   5e-05   
gb:AE017355_465746 Bacillus thuringiensis serovar konkukian str....    51   5e-05   
gb:TACID3_196603 Thermoplasma acidophilum complete genome; segme...    51   5e-05   
gb:BX248354_761344 Corynebacterium diphtheriae gravis NCTC13129,...    50   7e-05   
gb:AE017039_384899 Bacillus anthracis str. Ames section 16 of 18...    50   7e-05   
pir|T39623|T39623 ubiquitin-activating enzyme e1-like - fission ...    50   7e-05   Schizosaccharomyces pombe
gb:SCUAL1G_1710619 S.cerevisiae genes for ubiquitin activating e...    50   9e-05   
pir|A49890|A49890 fdxH 5'-region hypothetical protein 1 - Plecto...    50   9e-05   Leptolyngbya boryana
sp|P52488|UBA2_YEAST|UBA2_YEAST Ubiquitin-activating enzyme E1-like (Polyme...    50   9e-05   Saccharomyces cerevisiae [brewer's yeast]
sp|P46037|HESA_PLEBO|HESA_PLEBO Protein hesA.>pir|S40167|S40167 hypothetica...    50   9e-05   Leptolyngbya boryana
gb:CR382139_1672216 Debaryomyces hansenii chromosome G of strain...    50   1e-04   
gb:AF038618_1235202 Caenorhabditis elegans cosmid F42G8, complet...    50   1e-04   
gb:AE012841_286175 Chlorobium tepidum TLS section 62 of 194 of t...    50   1e-04   
pir|T32638|T32638 hypothetical protein F42G8.6 - Caenorhabditis ...    50   1e-04   Caenorhabditis elegans [roundworm]
gb:AE017343_1755438 Cryptococcus neoformans var. neoformans JEC2...    49   2e-04   
gb:CNS07EG9_1372888 chromosome II of strain GB-M1 of Encephalito...    49   2e-04   
gb:CP000001_853881 Bacillus cereus ZK, complete genome.                49   2e-04   
gb:AF109295_479778 Staphylococcus carnosus NarQ-like protein gen...    49   2e-04   
gb:AE017340_456530 Idiomarina loihiensis L2TR, complete genome.        49   2e-04   
gb:CR378669_95391 Photobacterium profundum SS9; segment 7/12.          49   2e-04   
pir|F69659|F69659 molybdopterin biosynthesis protein moeB - Baci...    49   2e-04   Bacillus subtilis
gb:AE017353_1760152 Cryptococcus neoformans var. neoformans JEC2...    49   2e-04   
gb:CR380959_1653716 Candida glabrata strain CBS138 chromosome M ...    49   2e-04   
gb:AE016800_335709 Vibrio vulnificus CMCP6 chromosome I section ...    49   2e-04   
pir|F82439|F82439 molybdopterin biosynthesis MoeB protein VCA061...    49   2e-04   Vibrio cholerae
gb:AP001081_1820772 Oryza sativa (japonica cultivar-group) genom...    49   3e-04   
gb:BA000037_724031 Vibrio vulnificus YJ016 DNA, chromosome I, co...    49   3e-04   
gb:AE006106_215583 Pasteurella multocida subsp. multocida str. P...    49   3e-04   
sp|Q9Z1F9|SAE2_MOUSE|SAE2_MOUSE Ubiquitin-like 2 activating enzyme E1B (SUM...    49   3e-04   Mus musculus [mouse]
gb:AF079566_1881422 Homo sapiens ubiquitin-like protein activati...    48   3e-04   
gb:AP004772_1844814 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:AX880168_1478156 Sequence 15073 from Patent EP1074617.              48   3e-04   
gb:AF218864_1252107 Drosophila melanogaster Smt3 activating enzy...    48   3e-04   
gb:AF193553_1249725 Drosophila melanogaster ubiquitin-like prote...    48   3e-04   
gb:AE014296_1135261 Drosophila melanogaster chromosome 3L, compl...    48   3e-04   
pir|T46936|T46936 hypothetical protein DKFZp434H239.1 - human>gb...    48   3e-04   Homo sapiens [man]
pir|T51083|T51083 related to ubiquitin-activating enzyme homolog...    48   3e-04   Neurospora crassa
sp|Q9UBT2|SAE2_HUMAN|SAE2_HUMAN Ubiquitin-like 2 activating enzyme E1B (SUM...    48   3e-04   Homo sapiens [man]
gb:CR382122_1655215 Kluyveromyces lactis strain NRRL Y-1140 chro...    48   5e-04   
gb:BX571864_786372 Photorhabdus luminescens subsp. laumondii TTO...    48   5e-04   
gb:ECPMC7A_132206 E.coli Plasmid pMccC7 mccA,B,C,D,E,F genes.          48   5e-04   
gb:CR925677_118149 Ehrlichia ruminantium str. Gardel, complete g...    48   5e-04   
gb:CR767821_117215 Ehrlichia ruminantium strain Welgevonden, com...    48   5e-04   
gb:CP000029_82448 Staphylococcus epidermidis RP62A, complete gen...    48   5e-04   
sp|O13861|YEXA_SCHPO|YEXA_SCHPO Hypothetical protein C1A6.10 in chromosome ...    48   5e-04   Schizosaccharomyces pombe
gb:BC055614_2551476 Danio rerio ubiquitin-like 1 (sentrin) activ...    47   6e-04   
gb:AE016817_1747051 Ashbya gossypii (= Eremothecium gossypii) AT...    47   6e-04   
gb:AY050426_1562203 Arabidopsis thaliana AT5g19180/T24G5_80 mRNA...    47   6e-04   
gb:AE014188_968165 Plasmodium falciparum 3D7 chromosome 12, comp...    47   6e-04   
gb:BX571965_790217 Burkholderia pseudomallei strain K96243, chro...    47   6e-04   
gb:BA000011_665413 Thermoplasma volcanium GSS1 DNA, complete gen...    47   6e-04   
gb:AE017355_464623 Bacillus thuringiensis serovar konkukian str....    47   6e-04   
gb:AE017035_383620 Bacillus anthracis str. Ames section 12 of 18...    47   6e-04   
pir|D86188|D86188 hypothetical protein [imported] - Arabidopsis ...    47   6e-04   Arabidopsis thaliana [mouse-ear cress]
sp|O65041|ECR1_ARATH|ECR1_ARATH RUB-activating enzyme (Ubiquitin activating...    47   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004651_1842693 Oryza sativa (japonica cultivar-group) genom...    47   8e-04   
gb:CR382132_1665112 Yarrowia lipolytica chromosome F of strain C...    47   8e-04   
gb:BX248355_761787 Corynebacterium diphtheriae gravis NCTC13129,...    47   8e-04   
gb:AE017261_419538 Picrophilus torridus DSM 9790, complete genome.     47   8e-04   
gb:EHU81376_135542 Erwinia herbicola PaaA (paaA), PaaB (paaB), a...    47   8e-04   
gb:AE017344_1756073 Cryptococcus neoformans var. neoformans JEC2...    47   0.001   
gb:AY692781_1622828 Saccharomyces cerevisiae clone FLH158290.01X...    46   0.001   
gb:BX640437_812953 Bordetella bronchiseptica strain RB50, comple...    46   0.001   
gb:BX640423_808552 Bordetella parapertussis strain 12822, comple...    46   0.001   
gb:AE017155_393124 Haemophilus ducreyi strain 35000HP section 5 ...    46   0.001   
gb:AE016776_330174 Pseudomonas putida KT2440 section 3 of 21 of ...    46   0.001   
gb:AE015464_314563 Shewanella oneidensis MR-1 section 13 of 457 ...    46   0.001   
gb:AE013598_296215 Xanthomonas oryzae pv. oryzae KACC10331, comp...    46   0.001   
sp|Q99344|UBA3_YEAST|UBA3_YEAST Ubiquitin-activating enzyme E1 3 (RUB1-acti...    46   0.001   Saccharomyces cerevisiae [brewer's yeast]
gb:CEW02A11_1368807 Caenorhabditis elegans cosmid W02A11, comple...    46   0.002   
gb:BX950851_841574 Erwinia carotovora subsp. atroseptica SCRI104...    46   0.002   
gb:BX640412_805049 Bordetella pertussis strain Tohama I, complet...    46   0.002   
gb:AE017275_424786 Bacillus cereus ATCC 10987, section 12 of 18 ...    46   0.002   
gb:AE017180_399648 Geobacter sulfurreducens PCA, complete genome.      46   0.002   
pir|T26072|T26072 hypothetical protein W02A11.4b - Caenorhabditi...    46   0.002   
pir|H71891|H71891 molybdopterin-synthase sulfurylase - Helicobac...    46   0.002   
gb:AF288694_2061630 Mus musculus Ube1l mRNA, partial cds.              45   0.002   
gb:BX571860_785343 Photorhabdus luminescens subsp. laumondii TTO...    45   0.002   
gb:BX571659_778363 Wolinella succinogenes, complete genome; segm...    45   0.002   
gb:AL935256_551298 Lactobacillus plantarum strain WCFS1 complete...    45   0.002   
gb:AF119361_480547 Frankia sp. EuIK1 NifK (nifK), NifE (nifE), N...    45   0.002   
gb:AF088896_478304 Zymomonas mobilis fosmid clone 42C11, complet...    45   0.002   
gb:AE008692_240930 Zymomonas mobilis subsp. mobilis ZM4, complet...    45   0.002   
gb:AY123045_590415 Erwinia pyrifoliae strain Ep1/96 plasmid pEP3...    45   0.003   
gb:AF264948_493712 Erwinia amylovora plasmid pEA29, complete pla...    45   0.003   
gb:CR628337_114660 Legionella pneumophila str. Lens complete gen...    45   0.003   
pir|H83062|H83062 molybdopterin biosynthesis MoeB protein PA4663...    45   0.003   
pir|C69316|C69316 molybdenum cofactor biosynthesis protein (moeB...    45   0.003   
gb:BC043962_2548374 Xenopus laevis similar to SUMO-1 activating ...    45   0.004   
gb:AF336829_2063622 Rattus norvegicus NEDD8-activating enzyme mR...    45   0.004   
gb:AK048148_1168306 Mus musculus 16 days embryo head cDNA, RIKEN...    45   0.004   
gb:AK032514_1162949 Mus musculus adult male olfactory brain cDNA...    45   0.004   
gb:AK014433_1157951 Mus musculus 18 days pregnant adult female p...    45   0.004   
gb:AE017333_447499 Bacillus licheniformis DSM 13, complete genom...    45   0.004   
gb:AE016827_342633 Mannheimia succiniciproducens MBEL55E, comple...    45   0.004   
gb:BC081199_2562100 Xenopus laevis similar to SUMO-1 activating ...    44   0.005   
gb:BC022853_1978012 Homo sapiens ubiquitin-activating enzyme E1C...    44   0.005   
gb:AB012190_1864390 Homo sapiens mRNA for Nedd8-activating enzym...    44   0.005   
gb:AP002866_1823390 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
gb:AP002866_1823389 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
gb:AX878286_1477379 Sequence 13191 from Patent EP1074617.              44   0.005   
gb:HSM801093_1186053 Homo sapiens mRNA; cDNA DKFZp566J164 (from ...    44   0.005   
gb:CR861356_1185355 Pongo pygmaeus mRNA; cDNA DKFZp459B0311 (fro...    44   0.005   
gb:CR860349_1184427 Pongo pygmaeus mRNA; cDNA DKFZp459D1713 (fro...    44   0.005   
gb:CR859959_1184058 Pongo pygmaeus mRNA; cDNA DKFZp459A0915 (fro...    44   0.005   
gb:BX950851_838987 Erwinia carotovora subsp. atroseptica SCRI104...    44   0.005   
gb:BX571866_787049 Photorhabdus luminescens subsp. laumondii TTO...    44   0.005   
gb:AL646058_545279 Ralstonia solanacearum GMI1000 chromosome, co...    44   0.005   
gb:AE017325_443498 Listeria monocytogenes str. 4b F2365, section...    44   0.005   
gb:AE011838_276956 Xanthomonas axonopodis pv. citri str. 306, se...    44   0.005   
pir|T17306|T17306 hypothetical protein DKFZp566J164.1 - human (f...    44   0.005   
gb:BC071459_2556199 Danio rerio zgc:55696, mRNA (cDNA clone MGC:...    44   0.007   
gb:BC042324_2548135 Danio rerio zgc:55696, mRNA (cDNA clone MGC:...    44   0.007   
gb:BX936398_835206 Yersinia pseudotuberculosis IP32953 genome, c...    44   0.007   
gb:AP006841_570972 Bacteroides fragilis YCH46 DNA, complete genome.    44   0.007   
gb:CR378663_93524 Photobacterium profundum SS9; segment 1/12.          44   0.007   
pir|A83501|A83501 conserved iypothetical protein PA1164 [importe...    44   0.007   
pir|A84169|A84169 molybdenum cofactor biosynthesis protein [impo...    44   0.007   
gb:AE017150_1029892 Trypanosoma brucei chromosome 2, complete se...    44   0.009   
gb:BX571864_786396 Photorhabdus luminescens subsp. laumondii TTO...    44   0.009   
gb:AY255829_602867 Erwinia sp. Ejp 556 plasmid pEJ30, complete s...    44   0.009   
gb:AF064766_475178 Lactococcus lactis putative nucleotide bindin...    44   0.009   
gb:AE012303_281234 Xanthomonas campestris pv. campestris str. AT...    44   0.009   
gb:AE010583_264622 Fusobacterium nucleatum subsp. nucleatum ATCC...    44   0.009   
gb:ECO487788_127526 Escherichia coli pMccC51 plasmid mccABCDE ge...    44   0.009   
gb:CP000026_77583 Salmonella enterica subsp. enterica serovar Pa...    44   0.009   
pir|AE0864|AE0864 conserved hypothetical protein STY3127 [import...    44   0.009   
sp|P45211|MOEB_HAEIN|MOEB_HAEIN Molybdopterin biosynthesis protein moeB.>pi...    44   0.009   
gb:AE017354_459937 Legionella pneumophila subsp. pneumophila str...    43   0.011   
gb:AE017200_403391 Lactobacillus johnsonii NCC 533, section 1 of...    43   0.011   
gb:CR628336_111642 Legionella pneumophila str. Paris complete ge...    43   0.011   
pir|D87711|D87711 molybdopterin biosynthesis protein MoeB [impor...    43   0.011   
gb:AP005066_1847463 Oryza sativa (japonica cultivar-group) genom...    43   0.015   
gb:AE016819_1748973 Ashbya gossypii (= Eremothecium gossypii) AT...    43   0.015   
gb:BX936398_836528 Yersinia pseudotuberculosis IP32953 genome, c...    43   0.015   
gb:AE017180_398957 Geobacter sulfurreducens PCA, complete genome.      43   0.015   
gb:AE016941_363005 Bacteroides thetaiotaomicron VPI-5482, sectio...    43   0.015   
gb:AE016779_330962 Pseudomonas putida KT2440 section 6 of 21 of ...    43   0.015   
gb:CR522870_100530 Desulfotalea psychrophila LSv54 chromosome.         43   0.015   
pir|F64621|F64621 thiamin biosynthesis protein - Helicobacter py...    43   0.015   
gb:AK117731_1815749 Arabidopsis thaliana At2g21470 mRNA for puta...    42   0.019   
gb:AF055287_1764595 Emericella nidulans molybdenum cofactor bios...    42   0.019   
gb:CR382139_1672659 Debaryomyces hansenii chromosome G of strain...    42   0.019   
gb:AY089305_1296961 Drosophila melanogaster AT10573 full insert ...    42   0.019   
gb:AE014134_1128262 Drosophila melanogaster chromosome 2L, compl...    42   0.019   
gb:BA000016_674642 Clostridium perfringens str. 13 DNA, complete...    42   0.019   
pir|AI1205|AI1205 molybdopterin biosynthesis protein MoeB homolo...    42   0.019   
pir|F84601|F84601 probable ubiquitin activating enzyme [imported...    42   0.019   
sp|O95396|MOC3_HUMAN|MOC3_HUMAN Molybdenum cofactor synthesis protein 3 (Mo...    42   0.019   
gb:AJ720107_2502294 Gallus gallus mRNA for hypothetical protein,...    42   0.025   
gb:BX842652_825203 Bdellovibrio bacteriovorus complete genome, s...    42   0.025   
gb:BX569694_776955 Synechococcus sp. WH8102 complete genome; seg...    42   0.025   
gb:CR555306_105957 Azoarcus sp. EbN1 complete genome.                  42   0.025   
sp|Q9ZNW0|MOC3_ARATH|MOC3_ARATH Molybdenum cofactor synthesis protein 3 (Mo...    42   0.025   
gb:AE013599_1131744 Drosophila melanogaster chromosome 2R, compl...    42   0.032   
gb:BA000045_743487 Gloeobacter violaceus PCC 7421 DNA, complete ...    42   0.032   
gb:BA000012_670287 Mesorhizobium loti MAFF303099 DNA, complete g...    42   0.032   
gb:AE017177_397847 Porphyromonas gingivalis W83 section 6 of 8 o...    42   0.032   
gb:CP000031_84471 Silicibacter pomeroyi DSS-3, complete genome.        42   0.032   
gb:CR380950_1649718 Candida glabrata strain CBS138 chromosome D ...    41   0.042   
gb:BX321864_774682 Nitrosomonas europaea ATCC 19718, complete ge...    41   0.042   
gb:AE016859_350552 Pseudomonas syringae pv. tomato str. DC3000 s...    41   0.042   
pir|C81463|T02855 ubiquitin activating enzyme UBAE [imported] - ...    41   0.042   
pir|AF3494|AF3494 molybdopterin biosynthesis moeB protein [impor...    41   0.042   
pir|C85592|C85592 molybdopterin biosynthesis [imported] - Escher...    41   0.042   
sp|P12282|MOEB_ECOLI|MOEB_ECOLI Molybdopterin biosynthesis protein moeB.>pi...    41   0.042   
gb:BC045372_2549214 Danio rerio zgc:55528, mRNA (cDNA clone MGC:...    41   0.055   
gb:AE016757_324953 Escherichia coli CFT073 section 3 of 18 of th...    41   0.055   
gb:CR555306_107599 Azoarcus sp. EbN1 complete genome.                  41   0.055   
gb:AE005674_70358 Shigella flexneri 2a str. 301, complete genome...    41   0.055   
pir|S76179|S76179 hypothetical protein - Synechocystis sp. (stra...    41   0.055   
gb:AP005066_1847464 Oryza sativa (japonica cultivar-group) genom...    40   0.072   
gb:AP005066_1847462 Oryza sativa (japonica cultivar-group) genom...    40   0.072   
gb:AF149851_483526 Pseudomonas stutzeri KC hypothetical protein,...    40   0.072   
gb:BX572100_799061 Prochlorococcus marinus MIT9313 complete geno...    40   0.094   
gb:BX571857_784397 Staphylococcus aureus strain MSSA476, complet...    40   0.094   
gb:AE017148_391341 Helicobacter hepaticus ATCC 51449 section 5 o...    40   0.094   
gb:AE016951_365381 Enterococcus faecalis V583, section 5 of 11 o...    40   0.094   
gb:AE014295_311436 Bifidobacterium longum NCC2705, complete genome.    40   0.094   
pir|AC2169|AC2169 molybdopterin biosynthesis protein [imported] ...    40   0.094   
gb:AY659112_2148122 Synthetic construct Peudomonas aeruginosa cl...    40   0.12    
gb:CR382139_1672680 Debaryomyces hansenii chromosome G of strain...    40   0.12    
gb:BX571856_781785 Staphylococcus aureus subsp. aureus strain MR...    40   0.12    
gb:AP006618_560967 Nocardia farcinica IFM 10152 DNA, complete ge...    40   0.12    
gb:AE014291_307470 Brucella suis 1330 chromosome I, complete seq...    40   0.12    
pir|F83381|F83381 probable molybdopterin biosynthesis protein Mo...    40   0.12    
gb:BA000030_700968 Streptomyces avermitilis MA-4680 genomic DNA,...    39   0.16    
gb:AL646061_545702 Ralstonia solanacearum GMI1000 chromosome, co...    39   0.16    
pir|A70415|A70415 molybdopterin biosynthesis protein MoeB - Aqui...    39   0.16    
gb:AF124161_1770236 Nicotiana plumbaginifolia molybdopterin synt...    39   0.21    
gb:CP000001_854124 Bacillus cereus ZK, complete genome.                39   0.21    
gb:AY552333_627675 Rhizobium etli putative Cro/CI family trancri...    39   0.21    
gb:AE017006_377545 Bacillus cereus ATCC 14579 section 9 of 18 of...    39   0.21    
gb:AE005674_72408 Shigella flexneri 2a str. 301, complete genome...    39   0.21    
gb:CR380955_1651620 Candida glabrata strain CBS138 chromosome I ...    39   0.27    
gb:CR380955_1651572 Candida glabrata strain CBS138 chromosome I ...    39   0.27    
gb:AX885275_1480728 Sequence 1138 from Patent EP1033401.               39   0.27    
gb:PFMAL13_1191554 Plasmodium falciparum 3D7 chromosome 13, *** ...    39   0.27    
gb:CP000025_878933 Campylobacter jejuni RM1221, complete genome.       39   0.27    
gb:BX571861_785508 Photorhabdus luminescens subsp. laumondii TTO...    39   0.27    
gb:BA000016_673097 Clostridium perfringens str. 13 DNA, complete...    39   0.27    
gb:AE017340_456277 Idiomarina loihiensis L2TR, complete genome.        39   0.27    
gb:AE017239_414011 Mycobacterium avium subsp. paratuberculosis s...    39   0.27    
gb:AE017180_401575 Geobacter sulfurreducens PCA, complete genome.      39   0.27    
pir|T26071|T26071 hypothetical protein W02A11.4a - Caenorhabditi...    39   0.27    
pir|D97367|D97367 moeB-like protein (AF149851) [imported] - Agro...    39   0.27    
gb:BX572593_799701 Rhodopseudomonas palustris CGA009 complete ge...    38   0.36    
gb:BA000033_712486 Staphylococcus aureus subsp. aureus MW2 DNA, ...    38   0.36    
gb:AE013188_290026 Thermoanaerobacter tengcongensis MB4, section...    38   0.36    
gb:AE012559_285006 Xylella fastidiosa Temecula1, section 7 of 9 ...    38   0.36    
gb:CP000026_76705 Salmonella enterica subsp. enterica serovar Pa...    38   0.36    
pir|A97012|A97012 dinucleotide-utilizing enzyme involved in moly...    38   0.36    
pir|AI0602|AI0602 molybdopterin biosynthesis MoeB protein [impor...    38   0.36    
sp|Q56067|MOEB_SALTY|MOEB_SALTY Molybdopterin biosynthesis protein moeB.>gb...    38   0.36    
gb:AX064245_1459036 Sequence 527 from Patent WO0100843.                38   0.47    
gb:AF128444_481564 Rhodobacter capsulatus molybdenum cofactor bi...    38   0.47    
gb:AE016861_350957 Pseudomonas syringae pv. tomato str. DC3000 s...    38   0.47    
gb:SCO939122_178850 Streptomyces coelicolor A3(2) complete genom...    38   0.47    
pir|C81307|C81307 probable molybdopterin biosynthesis protein Cj...    38   0.47    
pir|G90025|G90025 molybdopterin biosynthesis protein moeB [impor...    38   0.47    
pir|D82801|D82801 molybdopterin biosynthesis protein XF0466 [imp...    38   0.47    
pir|H91087|H91087 probable enzyme [imported] - Escherichia coli ...    38   0.47    
sp|P51335|YCXH_PORPU|YCXH_PORPU Hypothetical 43.4 kDa protein in rpl9-rpl11...    38   0.47    
gb:CR380957_1652639 Candida glabrata strain CBS138 chromosome K ...    37   0.61    
gb:BX897699_827845 Bartonella henselae strain Houston-1, complet...    37   0.61    
gb:BA000035_714968 Corynebacterium efficiens YS-314 DNA, complet...    37   0.61    
gb:AY458647_620005 Uncultured bacterium 580 clone EBAC000-36A07 ...    37   0.61    
gb:AP006840_568315 Symbiobacterium thermophilum DNA, complete ge...    37   0.61    
gb:AE017166_396179 Prochlorococcus marinus subsp. marinus str. C...    37   0.61    
pir|A69319|A69319 thiamin biosynthesis protein (thiF) homolog - ...    37   0.61    
sp|Q46927|YGDL_ECOLI|YGDL_ECOLI Hypothetical protein ygdL.>pir|H65063|H6506...    37   0.61    
gb:AF510525_1807242 Arabidopsis thaliana SUMO activating enzyme ...    37   0.80    
gb:BA000039_728187 Thermosynechococcus elongatus BP-1 DNA, compl...    37   0.80    
gb:AE016765_327370 Escherichia coli CFT073 section 11 of 18 of t...    37   0.80    
gb:CP000046_92355 Staphylococcus aureus subsp. aureus COL, compl...    37   0.80    
pir|H75294|H75294 molybdopterin biosynthesis MoeB - Deinococcus ...    37   0.80    
pir|C70921|C70921 probable molybdopterin biosynthesis protein mo...    37   0.80    
gb:AX064455_1459141 Sequence 737 from Patent WO0100843.                37   1.0     
gb:SSGMUC2_1445397 Sus scrofa Yorkshire/Chester White/Hampshire ...    37   1.0     
gb:AE013599_1132667 Drosophila melanogaster chromosome 2R, compl...    37   1.0     
gb:AE013599_1132666 Drosophila melanogaster chromosome 2R, compl...    37   1.0     
gb:BX927148_831801 Corynebacterium glutamicum ATCC 13032, IS fin...    37   1.0     
gb:BX640449_816687 Bordetella bronchiseptica strain RB50, comple...    37   1.0     
gb:BX640434_811840 Bordetella parapertussis strain 12822, comple...    37   1.0     
gb:BX640420_807643 Bordetella pertussis strain Tohama I, complet...    37   1.0     
gb:BA000040_729025 Bradyrhizobium japonicum USDA 110 DNA, comple...    37   1.0     
gb:BA000036_717935 Corynebacterium glutamicum ATCC 13032 DNA, co...    37   1.0     
gb:AE015822_318209 Shewanella oneidensis MR-1 section 371 of 457...    37   1.0     
pir|I47141|I47141 gastric mucin (clone PGM-2A) - pig (fragment)        37   1.0     
sp|Q57097|YGDL_HAEIN|YGDL_HAEIN Hypothetical protein HI0118.>pir|C64049|C64...    37   1.0     
gb:CR382125_1658180 Kluyveromyces lactis strain NRRL Y-1140 chro...    36   1.4     
gb:AE015603_315971 Shewanella oneidensis MR-1 section 152 of 457...    36   1.4     
pir|C87011|C87011 probably involved in molybdopterin biosynthesi...    36   1.4     
gb:AE014298_1125241 Drosophila melanogaster chromosome X, comple...    36   1.8     
gb:CP000020_870764 Vibrio fischeri ES114 chromosome I, complete ...    36   1.8     
gb:SME591782_184207 Sinorhizobium meliloti 1021 complete chromos...    36   1.8     
gb:CR543861_104882 Acinetobacter sp. ADP1 complete genome.             36   1.8     
gb:BX248345_760588 Mycobacterium bovis subsp. bovis AF2122/97 co...    35   2.3     
pir|G70594|G70594 probable MOEB- homolog - Mycobacterium tubercu...    35   2.3     
gb:BX950851_839758 Erwinia carotovora subsp. atroseptica SCRI104...    35   3.0     
gb:BA000030_703566 Streptomyces avermitilis MA-4680 genomic DNA,...    35   3.0     
gb:AP008231_581043 Synechococcus elongatus PCC 6301 DNA, complet...    35   3.0     
gb:AE011779_276409 Xanthomonas axonopodis pv. citri str. 306, se...    35   3.0     
gb:LMFL4803_1388105 Leishmania major Friedlin chromosome 19 cosm...    35   4.0     
gb:BA000043_739148 Geobacillus kaustophilus HTA426 DNA, complete...    35   4.0     
gb:STU53178_193832 Salmonella typhimurium molybdopterin biosynth...    35   4.0     
pir|T52532|T52532 molybdopterin synthase sulfurylase moeB [impor...    35   4.0     
gb:CR548612_1375335 Paramecium tetraurelia macronuclear largest ...    34   5.2     
gb:BX571657_777748 Wolinella succinogenes, complete genome; segm...    34   5.2     
gb:AY271621_604675 Pseudmonas fluorescens ATCC 17400 quinolobact...    34   5.2     
gb:AE013598_295214 Xanthomonas oryzae pv. oryzae KACC10331, comp...    34   5.2     
sp|P16720|UL06_HCMVA|UL06_HCMVA Hypothetical protein UL6.>pir|S09769|S09769...    34   5.2     
gb:BC072633_2106608 Mus musculus SREBP cleavage activating prote...    34   6.8     
gb:BC070437_2106272 Mus musculus SREBP cleavage activating prote...    34   6.8     
gb:BC055472_2102067 Mus musculus SREBP cleavage activating prote...    34   6.8     
gb:BC051066_2100607 Mus musculus SREBP cleavage activating prote...    34   6.8     
gb:AK172912_2069846 Mus musculus premature mRNA for mKIAA0199 pr...    34   6.8     
gb:AY359085_1947964 Homo sapiens clone DNA119714 TLR9 (UNQ5798) ...    34   6.8     
gb:BSUB0015_754719 Bacillus subtilis complete genome (section 15...    34   6.8     
gb:AE017012_379265 Bacillus cereus ATCC 14579 section 15 of 18 o...    34   6.8     
pir|AE2585|AE2585 molybdopterin biosynthesis protein [imported] ...    34   6.8     
pir|S17929|S17929 transcription initiation factor sigma hrdA - S...    34   6.8     
sp|P18182|HRDA_STRCO|HRDA_STRCO RNA polymerase principal sigma factor hrdA....    34   6.8     
gb:AY160156_593831 Bisgaard Taxon 37 DNA gyrase gene, partial cds.     33   8.8     
gb:AE016748_322960 Staphylococcus epidermidis ATCC 12228, sectio...    33   8.8     
gb:CP000029_81795 Staphylococcus epidermidis RP62A, complete gen...    33   8.8     
pir|B71923|B71923 3-oxoacyl-[acyl-carrier-protein] reductase (EC...    33   8.8     
pir|A64590|A64590 probable 3-oxoacyl-[acyl-carrier-protein] redu...    33   8.8     


>gb:AB124880_1528099 Nicotiana tabacum mRNA for ubiquitin activating
            enzyme 2, complete cds.
          Length = 1080

 Score =  519 bits (1336), Expect = e-146
 Identities = 257/299 (85%), Positives = 277/299 (92%)
 Frame = +2

Query: 308  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGV 487
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRLF SNVL+SG++GLG 
Sbjct: 51   DVNTNGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNVLVSGLQGLGA 108

Query: 488  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
            EIAKNLILAGVKSVTLHDEGNVELWDLSSNF+F+E+DVGKNRALAS+QKLQELNN+VIIS
Sbjct: 109  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFIFTEEDVGKNRALASIQKLQELNNAVIIS 168

Query: 668  TLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            TLT+ L+KEQLS+FQA VFTDI LEKA+EFDDYCH HQPPIAFIK EV GLFGSVFCDFG
Sbjct: 169  TLTDALTKEQLSNFQAVVFTDISLEKAVEFDDYCHKHQPPIAFIKAEVRGLFGSVFCDFG 228

Query: 848  PEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGK 1027
            PEFTV DVDGEDP TGIIASISNDNPALV C+DDERLEF+DGDL++FSEVRGMTELNDGK
Sbjct: 229  PEFTVADVDGEDPHTGIIASISNDNPALVGCIDDERLEFEDGDLVIFSEVRGMTELNDGK 288

Query: 1028 PRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            PRKIKNARPYSFTIEEDT+ Y AYE GGIVTQVKEPKVLKFKPLRE +KDPGD LLSDF
Sbjct: 289  PRKIKNARPYSFTIEEDTSNYAAYERGGIVTQVKEPKVLKFKPLREAIKDPGDFLLSDF 347



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 5/110 (4%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGV-----KSVTLHDEGNVEL 559
           +  Q++V+G +  ++L  + V + G   LG E  KNL L GV       +T+ D+  +E 
Sbjct: 475 YDAQISVFGNKLQKKLEEAKVFVVGSGALGCEFLKNLALMGVCCGDKGKLTITDDDVIEK 534

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF 709
            +LS  F+F + ++G+ ++  +      +N  + I  L N  S E  S F
Sbjct: 535 SNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIHIEALQNRASPETESVF 584



>gb:AB124879_1528098 Nicotiana tabacum mRNA for ubiquitin activating
            enzyme 1, complete cds.
          Length = 1080

 Score =  516 bits (1330), Expect = e-145
 Identities = 256/299 (85%), Positives = 276/299 (92%)
 Frame = +2

Query: 308  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGV 487
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRLF SNVL SG++GLG 
Sbjct: 51   DVNANGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNVLASGLQGLGA 108

Query: 488  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
            EIAKNLILAGVKSVTLHDEGNVELWDLSSNF+F+E+DVGKNRALAS+QKLQELNN+VIIS
Sbjct: 109  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFIFTEEDVGKNRALASIQKLQELNNAVIIS 168

Query: 668  TLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            TLT+ L+KEQLS+FQA VFTDI LEKA++FDDYCH HQPPIAFIK EV GLFGSVFCDFG
Sbjct: 169  TLTDALTKEQLSNFQAVVFTDISLEKAVKFDDYCHQHQPPIAFIKAEVRGLFGSVFCDFG 228

Query: 848  PEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGK 1027
            PEFT+ DVDGEDP TGIIASISNDNPALV C+DDERLEFQDGDL++FSEVRGMTELNDGK
Sbjct: 229  PEFTIADVDGEDPHTGIIASISNDNPALVGCIDDERLEFQDGDLVIFSEVRGMTELNDGK 288

Query: 1028 PRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            PRKIKNARPYSFTIEEDT+ Y AYE GGIVTQVKEPKVLKFKPLRE +KDPGD LLSDF
Sbjct: 289  PRKIKNARPYSFTIEEDTSNYAAYERGGIVTQVKEPKVLKFKPLREAIKDPGDFLLSDF 347



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 5/110 (4%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGV-----KSVTLHDEGNVEL 559
           +  Q++V+G +  ++L  +   + G   LG E  KNL L GV       +T+ D+  +E 
Sbjct: 475 YDAQISVFGNKLQKKLEEAKAFVVGSGALGCEFLKNLALMGVCCGDKGKLTITDDDVIEK 534

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF 709
            +LS  F+F + ++G+ ++  +      +N  + I  L N  S E  S F
Sbjct: 535 SNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIHIEALQNRASPETESVF 584



>sp|P31251|UBA2_WHEAT Ubiquitin-activating enzyme E1
            2.>gb:WHTE1A_1727622 Wheat ubiquitin activating enzyme
            (E1) mRNA, complete cds.
          Length = 1051

 Score =  460 bits (1183), Expect = e-128
 Identities = 220/276 (79%), Positives = 252/276 (91%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDEDLHSRQLAVYGRETM+ LFGSNVL+SG++GLG EIAKNL+LAGVKSVTLHD+GNVE
Sbjct: 42   EIDEDLHSRQLAVYGRETMKPLFGSNVLVSGLQGLGAEIAKNLVLAGVKSVTLHDDGNVE 101

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            LWDLSSNF  SE+DVG+NRA A VQKLQELNN+V++S LT +L+KE LS FQA VFTDI 
Sbjct: 102  LWDLSSNFFLSENDVGQNRAQACVQKLQELNNAVLVSALTGDLTKEHLSKFQAVVFTDIS 161

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            L+KA+EFDDYCH+HQPPIAFIK+EV GLFGSVFCDFGPEFTVLDVDGE+P TGI+ASISN
Sbjct: 162  LDKAIEFDDYCHSHQPPIAFIKSEVRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISN 221

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNPALV+CVDDERLEFQDGDL+VFSEV GMTELNDGKPRK+KNARPYSF +EEDT+ + A
Sbjct: 222  DNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFFLEEDTSSFGA 281

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIVTQVK PKV+KFKPL+E + +PG+ L+SDF
Sbjct: 282  YVRGGIVTQVKPPKVIKFKPLKEAMSEPGEFLMSDF 317



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 33/145 (22%), Positives = 65/145 (44%), Gaps = 13/145 (8%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-----SVTLHDEGNVEL 559
           +  Q++V+G     +L  + + + G   LG E  KNL L G+      ++T+ D+  +E 
Sbjct: 445 YDAQISVFGSTLQNKLEEAKIFMVGSGALGCEFLKNLALMGISCSQNGNLTVTDDDVIEK 504

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI-- 733
            +LS  F+F + ++G+ ++  +      +N  + +  L N  S E  + F  A + ++  
Sbjct: 505 SNLSRQFLFRDWNIGQPKSTVAATAAMVINPKLHVEALQNRASPETENVFNDAFWENLDA 564

Query: 734 ------RLEKAMEFDDYCHNHQPPI 790
                  +   M  D  C   Q P+
Sbjct: 565 VVNALDNVTARMYIDSRCVYFQKPL 589



>pir|T03964|T03964 probable ubiquitin-protein ligase (EC 6.3.2.19) -
            common tobacco>gb:NTUAEE1_1691931 N.tabaccum mRNA for
            ubiquitin activating enzyme E1.
          Length = 1080

 Score =  459 bits (1182), Expect = e-128
 Identities = 234/299 (78%), Positives = 255/299 (85%)
 Frame = +2

Query: 308  DAVSNGRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGV 487
            D  +NG  T NGKSPID +RNSPDIDEDLHSRQLAVYGRETMRRLF SNVL+SG++GLG 
Sbjct: 51   DVNANGNAT-NGKSPID-ARNSPDIDEDLHSRQLAVYGRETMRRLFASNVLVSGLQGLGA 108

Query: 488  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
            EIAKNLILAGVKSVTLHDEG        +        +G+   L   +KLQELNN+VIIS
Sbjct: 109  EIAKNLILAGVKSVTLHDEGMWNCGIYLAILFLQRKMLGRIGHLLLSRKLQELNNAVIIS 168

Query: 668  TLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            TLT+ L+KEQLS+FQA VFTDI LEKA++FDDYCH HQPPIAFIK EV GLFGSVFCDFG
Sbjct: 169  TLTDALTKEQLSNFQAVVFTDISLEKAVKFDDYCHQHQPPIAFIKAEVRGLFGSVFCDFG 228

Query: 848  PEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGK 1027
            PEFT+ DVDGEDP TGIIASISNDNPALV C+DDERLEFQDGDL++FSEVRGMTELNDGK
Sbjct: 229  PEFTIADVDGEDPHTGIIASISNDNPALVGCIDDERLEFQDGDLVIFSEVRGMTELNDGK 288

Query: 1028 PRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            PRKIKNARPYSFTIEEDT+ Y AYE GGIVTQVKEPKVLKFKPLRE +KDPGD LLSDF
Sbjct: 289  PRKIKNARPYSFTIEEDTSNYAAYERGGIVTQVKEPKVLKFKPLREAIKDPGDFLLSDF 347



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 5/110 (4%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGV-----KSVTLHDEGNVEL 559
           +  Q++V+G +  ++L  +   + G   LG E  KNL L GV       +T+ D+  +E 
Sbjct: 475 YDAQISVFGNKLQKKLEEAKAFVVGSGALGCEFLKNLALMGVCCGDKGKLTITDDDVIEK 534

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF 709
            +LS  F+F + ++G+ ++  +      +N  + I  L N  S E  S F
Sbjct: 535 SNLSRQFLFRDWNIGQAKSTVAAAAASLINPRIHIEALQNRASPETESVF 584



>sp|P20973|UBA1_WHEAT Ubiquitin-activating enzyme E1
            1.>pir|A38373|A38373 ubiquitin-protein ligase (EC
            6.3.2.19) E1 - wheat>gb:WHTUBA1_1727722 T.aestivum
            ubiquitin activating enzyme E1 (UBA1) gene, complete cds.
          Length = 1051

 Score =  459 bits (1182), Expect = e-128
 Identities = 220/276 (79%), Positives = 252/276 (91%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDEDLHSRQLAVYGRETM+RLFGSNVL+SG++GLG EIAKNL+LAGVKSVTLHD+GNVE
Sbjct: 42   EIDEDLHSRQLAVYGRETMKRLFGSNVLVSGLQGLGAEIAKNLVLAGVKSVTLHDDGNVE 101

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            LWDLSSNF  SE+DVG+NRA A VQKLQELNN+V++S LT +L+KE LS FQA VFTDI 
Sbjct: 102  LWDLSSNFFLSENDVGQNRAQACVQKLQELNNAVLVSALTGDLTKEHLSKFQAVVFTDIS 161

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            L+KA+EFDDYCH+ QPPIAFIK+EV GLFGSVFCDFGPEFTVLDVDGE+P TGI+ASISN
Sbjct: 162  LDKAIEFDDYCHSQQPPIAFIKSEVRGLFGSVFCDFGPEFTVLDVDGEEPHTGIVASISN 221

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNPALV+CVDDERLEFQDGDL+VFSEV GMTELNDGKPRK+KNARPYSF +EEDT+ + A
Sbjct: 222  DNPALVSCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPYSFFLEEDTSSFGA 281

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIVTQVK PKV+KFKPL+E + +PG+ L+SDF
Sbjct: 282  YVRGGIVTQVKPPKVIKFKPLKEAMSEPGEFLMSDF 317



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 34/145 (23%), Positives = 66/145 (45%), Gaps = 13/145 (8%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-----SVTLHDEGNVEL 559
           +  Q++V+G +   +L  + + + G   LG E  KNL L G+      ++TL D+  +E 
Sbjct: 445 YDAQISVFGSKLQNKLEEAKIFMVGSGALGCEFLKNLALMGISCSQNGNLTLTDDDVIEK 504

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI-- 733
            +LS  F+F + ++G+ ++  +      +N  + +  L N  S E  + F  A + ++  
Sbjct: 505 SNLSRQFLFRDWNIGQPKSTVAATAAMVINPKLHVEALQNRASPETENVFNDAFWENLDA 564

Query: 734 ------RLEKAMEFDDYCHNHQPPI 790
                  +   M  D  C   Q P+
Sbjct: 565 VVNALDNVTARMYIDSRCVYFQKPL 589



>gb:AB006700_1509915 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MHF15.>gb:ATU40566_1556979 Arabidopsis thaliana
            ubiquitin activating enzyme 2 (UBA2) gene, complete cds.
          Length = 1077

 Score =  458 bits (1178), Expect = e-127
 Identities = 221/279 (79%), Positives = 249/279 (89%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            N+ +IDEDLHSRQLAVYGRETMR+LF SNVLISGM+GLGVEIAKN+ILAGVKSVTLHDE 
Sbjct: 66   NNQEIDEDLHSRQLAVYGRETMRKLFASNVLISGMQGLGVEIAKNIILAGVKSVTLHDEN 125

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
             VELWDLSSNFVF+E+D+GKNRALASV KLQELNN+V +STLT +L+KEQLSDFQ  VF 
Sbjct: 126  VVELWDLSSNFVFTEEDIGKNRALASVHKLQELNNAVAVSTLTGKLTKEQLSDFQVVVFV 185

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
            DI  EKA E DDYCH+HQPPIAFIK +V GLFGS+FCDFGP FTVLDVDGE+P +GIIAS
Sbjct: 186  DISFEKATEIDDYCHSHQPPIAFIKADVRGLFGSLFCDFGPHFTVLDVDGEEPHSGIIAS 245

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            +SN+NP  V+CVDDERLEF+DG+L+VFSEV GMTELNDGKPRKIKN +P+SFT+EEDT+ 
Sbjct: 246  VSNENPGFVSCVDDERLEFEDGNLVVFSEVEGMTELNDGKPRKIKNVKPFSFTLEEDTSS 305

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  Y  GGIVTQVK+PKVL FKPLRE LKDPGD LLSDF
Sbjct: 306  YGQYMKGGIVTQVKQPKVLNFKPLREALKDPGDFLLSDF 344



 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 5/135 (3%)
 Frame = +2

Query: 344 KSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK 523
           K P+D S   P      +  Q++V+G    ++L  + V + G   LG E  KNL L GV 
Sbjct: 457 KEPLDASEFRPQ--NSRYDAQISVFGSTLQKKLEDARVFVVGAGALGCEFLKNLALMGVS 514

Query: 524 -----SVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELS 688
                 +T+ D+  +E  +LS  F+F + ++G+ ++  +      +N+ + I  L N + 
Sbjct: 515 CGTQGKLTVTDDDVIEKSNLSRQFLFRDWNIGQAKSTVAATAAAGINSRLNIDALQNRVG 574

Query: 689 KEQLSDFQAAVFTDI 733
            E  + F  + + ++
Sbjct: 575 PETENVFDDSFWENL 589



>gb:AY090248_1574001 Arabidopsis thaliana At2g30110/T27E13.15 mRNA,
            complete cds.>gb:BT006363_1639250 Arabidopsis thaliana
            At2g30110/T27E13.15 gene, complete cds.
          Length = 1080

 Score =  456 bits (1174), Expect = e-127
 Identities = 222/279 (79%), Positives = 247/279 (88%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            N  +IDEDLHSRQLAVYGRETMRRLF SNVLISGM GLG EIAKNLILAGVKSVTLHDE 
Sbjct: 69   NRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKNLILAGVKSVTLHDER 128

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
             VELWDLSSNFVFSEDDVGKNRA ASVQKLQ+LNN+V++S+LT  L+KE LS FQ  VF+
Sbjct: 129  VVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKSLNKEDLSGFQVVVFS 188

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
            DI +E+A+EFDDYCH+HQPPIAF+K +V GLFGSVFCDFGPEF VLDVDGE+P TGIIAS
Sbjct: 189  DISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAVLDVDGEEPHTGIIAS 248

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            ISN+N A ++CVDDERLEF+DGDL+VFSEV GMTELNDGKPRKIK+ RPYSFT++EDTT 
Sbjct: 249  ISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIKSTRPYSFTLDEDTTN 308

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  Y  GGIVTQVK+PK+L FKPLRE LKDPGD L SDF
Sbjct: 309  YGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDF 347



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 5/133 (3%)
 Frame = +2

Query: 350 PIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-- 523
           P+D S  +P      +  Q++V+G +  ++L  + V   G   LG E  KNL L GV   
Sbjct: 462 PVDSSDFAPR--NSRYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCG 519

Query: 524 ---SVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKE 694
               +T+ D+  +E  +LS  F+F + ++G+ ++  +      +N    I  L N +  E
Sbjct: 520 SQGKLTVTDDDIIEKSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAE 579

Query: 695 QLSDFQAAVFTDI 733
             + F  A + ++
Sbjct: 580 TENVFDDAFWENL 592



>pir|T00587|T00587 probable ubiquitin-protein ligase (EC 6.3.2.19) -
            Arabidopsis thaliana>gb:AC004165_1531513 Arabidopsis
            thaliana chromosome 2 clone T27E13 map m283, complete
            sequence.>gb:ATU80808_1557298 Arabidopsis thaliana
            ubiquitin activating enzyme (UBA1) gene, complete cds.
          Length = 1080

 Score =  456 bits (1174), Expect = e-127
 Identities = 222/279 (79%), Positives = 247/279 (88%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            N  +IDEDLHSRQLAVYGRETMRRLF SNVLISGM GLG EIAKNLILAGVKSVTLHDE 
Sbjct: 69   NRQEIDEDLHSRQLAVYGRETMRRLFASNVLISGMHGLGAEIAKNLILAGVKSVTLHDER 128

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
             VELWDLSSNFVFSEDDVGKNRA ASVQKLQ+LNN+V++S+LT  L+KE LS FQ  VF+
Sbjct: 129  VVELWDLSSNFVFSEDDVGKNRADASVQKLQDLNNAVVVSSLTKSLNKEDLSGFQVVVFS 188

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
            DI +E+A+EFDDYCH+HQPPIAF+K +V GLFGSVFCDFGPEF VLDVDGE+P TGIIAS
Sbjct: 189  DISMERAIEFDDYCHSHQPPIAFVKADVRGLFGSVFCDFGPEFAVLDVDGEEPHTGIIAS 248

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            ISN+N A ++CVDDERLEF+DGDL+VFSEV GMTELNDGKPRKIK+ RPYSFT++EDTT 
Sbjct: 249  ISNENQAFISCVDDERLEFEDGDLVVFSEVEGMTELNDGKPRKIKSTRPYSFTLDEDTTN 308

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  Y  GGIVTQVK+PK+L FKPLRE LKDPGD L SDF
Sbjct: 309  YGTYVKGGIVTQVKQPKLLNFKPLREALKDPGDFLFSDF 347



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 5/133 (3%)
 Frame = +2

Query: 350 PIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-- 523
           P+D S  +P      +  Q++V+G +  ++L  + V   G   LG E  KNL L GV   
Sbjct: 462 PVDSSDFAPR--NSRYDAQISVFGAKFQKKLEDAKVFTVGSGALGCEFLKNLALMGVSCG 519

Query: 524 ---SVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKE 694
               +T+ D+  +E  +LS  F+F + ++G+ ++  +      +N    I  L N +  E
Sbjct: 520 SQGKLTVTDDDIIEKSNLSRQFLFRDWNIGQAKSTVAASAAAVINPRFNIEALQNRVGAE 579

Query: 695 QLSDFQAAVFTDI 733
             + F  A + ++
Sbjct: 580 TENVFDDAFWENL 592



>gb:AP004333_1840369 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0034A04.
          Length = 1045

 Score =  452 bits (1164), Expect = e-126
 Identities = 217/277 (78%), Positives = 244/277 (88%)
 Frame = +2

Query: 374  PDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNV 553
            P+IDEDLHSRQLAVYGRETMRRLF S+VL+SG+ GLG EIAKNL LAGVKSVTLHD  NV
Sbjct: 36   PEIDEDLHSRQLAVYGRETMRRLFASHVLVSGLNGLGAEIAKNLALAGVKSVTLHDVKNV 95

Query: 554  ELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
            E+WDLS+NF  SE+D+GKNRA A V KLQELNN+V++S LT EL+ + LS FQA VFTDI
Sbjct: 96   EMWDLSANFFLSENDIGKNRAAACVSKLQELNNAVLVSALTEELTTDHLSKFQAVVFTDI 155

Query: 734  RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASIS 913
             L+KA EFDDYCH+H PPI+FIK EVCGLFG+VFCDFGPEFTVLDVDGEDP TGIIASIS
Sbjct: 156  GLDKAYEFDDYCHSHCPPISFIKAEVCGLFGTVFCDFGPEFTVLDVDGEDPHTGIIASIS 215

Query: 914  NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYT 1093
            NDNPALV+CVDDERLEFQDGD +VFSEV GM ELNDGKPRK+KNARP+SF IEEDTTKY 
Sbjct: 216  NDNPALVSCVDDERLEFQDGDFVVFSEVHGMAELNDGKPRKVKNARPFSFCIEEDTTKYD 275

Query: 1094 AYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             Y  GGIVTQ+KEPK+L+FK LR+ ++DPGD LLSDF
Sbjct: 276  MYIKGGIVTQIKEPKILRFKSLRDAMRDPGDFLLSDF 312



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 29/115 (25%), Positives = 55/115 (47%), Gaps = 5/115 (4%)
 Frame = +2

Query: 350 PIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-- 523
           P+D     P      +  Q++V+G +  ++L  +N  + G   LG E  KNL L GV   
Sbjct: 427 PLDSEDIKPS--NSRYDAQISVFGSKLQKKLEEANTFVVGSGALGCEFLKNLALMGVSCS 484

Query: 524 ---SVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN 679
               +T+ D+  +E  +LS  F+F + ++ + ++  +      +N ++ I  L N
Sbjct: 485 PKGKLTITDDDVIEKSNLSRQFLFRDWNIRQAKSTVAAAAASAINPNLCIDALQN 539



>sp|P31252|UBA3_WHEAT Ubiquitin-activating enzyme E1
            3.>pir|T06483|T06483 probable ubiquitin-protein ligase
            (EC 6.3.2.19) E1 - wheat>gb:WHTE1B_1727623 Wheat
            ubiquitin activating enzyme (E1) mRNA, complete cds.
          Length = 1053

 Score =  448 bits (1152), Expect = e-124
 Identities = 217/276 (78%), Positives = 243/276 (88%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDEDLHSRQLAVYGRETMRRLF S+VL+SG+ GLG EIAKNL LAGVKSVT+HD   V+
Sbjct: 45   EIDEDLHSRQLAVYGRETMRRLFASDVLVSGLNGLGAEIAKNLALAGVKSVTIHDVKTVK 104

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            +WDLS NF  SEDD+GKNRA A V KLQELNN+V+IS LT EL+ E LS FQA VFTDI 
Sbjct: 105  MWDLSGNFFLSEDDIGKNRAAACVAKLQELNNAVLISALTEELTTEHLSKFQAVVFTDID 164

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            L+KA EFDDYCHNHQPPI+FIK+EVCGLFGSVFCDFGP+FTVLDVDGEDP TGIIASISN
Sbjct: 165  LDKAYEFDDYCHNHQPPISFIKSEVCGLFGSVFCDFGPKFTVLDVDGEDPHTGIIASISN 224

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNPAL++CVDDERLEFQDGDL+VFSEV GMTELNDGKPRK+KNARP+SF+IEEDT+ +  
Sbjct: 225  DNPALISCVDDERLEFQDGDLVVFSEVHGMTELNDGKPRKVKNARPFSFSIEEDTSNFGI 284

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIVTQVKEPKVL FK LR+ + DPG+ LLSDF
Sbjct: 285  YVKGGIVTQVKEPKVLCFKALRDAMTDPGEVLLSDF 320



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 27/100 (27%), Positives = 52/100 (52%), Gaps = 5/100 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK-----SVTLHDEGNVEL 559
           +  Q++V+G +  +++  +N  + G   LG E  KNL L GV       +T+ D+  +E 
Sbjct: 448 YDAQVSVFGSKLQKKMEEANTFVVGSGALGCEFLKNLALMGVSCSSKGKLTITDDDIIEK 507

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN 679
            +LS  F+F + ++G+ ++  +      +N S+ I  L N
Sbjct: 508 SNLSRQFLFRDWNIGQAKSTVAATAASAINPSLHIDALQN 547



>gb:BC047256_2549875 Xenopus laevis ubiquitin activating enzyme, mRNA
            (cDNA clone MGC:52522 IMAGE:5572791), complete cds.
          Length = 1059

 Score =  279 bits (714), Expect = 7e-74
 Identities = 146/279 (52%), Positives = 195/279 (69%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            NS +IDE L+SRQL V G + M+R+  SNVLISGM GLGVEIAKN+ILAGVKSVT+HD+ 
Sbjct: 45   NSTEIDEGLYSRQLYVLGHDAMKRMQNSNVLISGMSGLGVEIAKNIILAGVKSVTIHDQH 104

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
            N +  DLSS F   E D+GKNRA  S  +L ELN  V +S+ T+ L+ E +S FQ  + T
Sbjct: 105  NTDWADLSSQFYLRESDIGKNRAEVSHPRLAELNTYVPVSSSTDPLTDEFMSAFQLVILT 164

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
               LE+ ++  D+CH+H   I FI  +  GLFG +FCDFG E  V+D +GE P + +I+ 
Sbjct: 165  GSSLEEQLQVGDFCHSHD--IKFIVADTKGLFGQLFCDFGKEMVVMDPNGEQPLSAMISM 222

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            I+ DNP +V C+D+ R  F+ GD + F+EVRGMTELN  +P +IK   PY+F+I  DT+ 
Sbjct: 223  ITKDNPGVVTCLDEARHGFETGDFVTFTEVRGMTELNGCEPVEIKVLGPYTFSI-CDTSS 281

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            ++ Y  GGIV+QVK PK + FKPLRE L++P D L++DF
Sbjct: 282  FSDYIRGGIVSQVKMPKKISFKPLREALQEP-DILITDF 319



>gb:AB040073_2461837 Xenopus laevis E1 mRNA for ubiquitin activating
            enzyme, complete cds.
          Length = 1059

 Score =  276 bits (707), Expect = 5e-73
 Identities = 145/279 (51%), Positives = 194/279 (69%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            NS +IDE L+SRQL V G + M+R+  SNVLISGM GLGVEIAKN+ILAGVKSVT+HD+ 
Sbjct: 45   NSTEIDEGLYSRQLYVLGHDAMKRMQNSNVLISGMSGLGVEIAKNIILAGVKSVTIHDQH 104

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
            N +  DLSS F   E D+GKNRA  S  +L ELN  V +S+ T+ L+ E +S FQ  + T
Sbjct: 105  NTDWADLSSQFYLRESDIGKNRAEVSHPRLAELNTYVPVSSSTDPLTDEFMSAFQLVILT 164

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
               LE+ ++  D+CH+H   I FI  +  GLFG +FCDFG E  V+D +GE P + +I+ 
Sbjct: 165  GSSLEEQLQVGDFCHSHD--IKFIVADTKGLFGQLFCDFGKEMVVMDPNGEQPLSAMISM 222

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            I+ DNP +V C+D+ R  F+ GD + F+EVRGMTELN  +P +IK   PY+F+I  DT+ 
Sbjct: 223  ITKDNPGVVTCLDEARHGFETGDFVTFTEVRGMTELNGCEPVEIKVLGPYTFSI-CDTSS 281

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            ++ Y  GGIV+QVK PK + FKPLRE L++  D L++DF
Sbjct: 282  FSDYIRGGIVSQVKMPKKISFKPLREALQE-ADILITDF 319



>gb:BC064684_2553874 Xenopus laevis cDNA clone MGC:68851
            IMAGE:4680115, complete cds.
          Length = 1060

 Score =  274 bits (701), Expect = 2e-72
 Identities = 145/279 (51%), Positives = 191/279 (68%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            NS +IDE L+SRQL V G + M+R+  SNVLISGM GLGVEIAKN+ILAGVKSVT+HD+ 
Sbjct: 46   NSTEIDEGLYSRQLYVLGHDAMKRMQNSNVLISGMSGLGVEIAKNIILAGVKSVTIHDQH 105

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFT 727
            N E  DLSS F   E D+GKNRA  S  +L ELN  V +S+    L+   LS FQ  + T
Sbjct: 106  NTEWTDLSSQFYLRESDIGKNRAEVSHPRLAELNTYVPVSSSMGPLTDHFLSAFQLVILT 165

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
               LE+ ++  D+CH+H   I FI  +  GLFG +FCDFG E  V+D +GE P + +I+ 
Sbjct: 166  ASSLEEQLQIGDFCHSHD--IKFIVADTKGLFGQLFCDFGKEMVVMDPNGEQPLSAMISM 223

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            I+ DNP +V C+D+ R  F+ GD + F+EVRGMTELN  +P +IK   PY+F+I   T+ 
Sbjct: 224  ITKDNPGVVTCLDEARHGFETGDFVTFTEVRGMTELNGCEPVEIKVLGPYTFSI-CGTSS 282

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            ++ Y  GGIV+QVK PK + FKPLRE L++P D L++DF
Sbjct: 283  FSDYIRGGIVSQVKMPKKISFKPLREALQEP-DFLITDF 320



>gb:AB035495_2461636 Carassius auratus mRNA for ubiquitin-activating
            enzyme E1, complete cds.
          Length = 1058

 Score =  262 bits (669), Expect = 1e-68
 Identities = 143/299 (47%), Positives = 199/299 (66%), Gaps = 3/299 (1%)
 Frame = +2

Query: 317  SNGRRTENGKSPIDC---SRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGV 487
            SN  RTE   +P +    + N  +IDE L+SRQL V G E M+R+  S+VLISG++GLGV
Sbjct: 26   SNSVRTELSHTPANGMAKNGNDAEIDEGLYSRQLYVLGHEAMKRMQSSSVLISGLRGLGV 85

Query: 488  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
            EIAKN+IL GVKSVTLHD+G  E  DLSS F   E+D+GKNRA  S  +L ELN+ V ++
Sbjct: 86   EIAKNVILGGVKSVTLHDQGVAEWKDLSSQFYLREEDLGKNRAEVSQTRLAELNSYVPVT 145

Query: 668  TLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            + T  L+ E L+ FQ  V T+  L++ +   D+CH++   I  I  +  GLFG +FCDFG
Sbjct: 146  SYTGALNNEFLTKFQVVVLTNSSLDEQIRLGDFCHSN--GIKLIVADTRGLFGQLFCDFG 203

Query: 848  PEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGK 1027
             E TV D +GE P + +I+ I+ D+  +V C+D+ R  F+ GD + F+EV+GMTELN  +
Sbjct: 204  EEMTVFDTNGEQPLSAMISMITKDSAGVVTCLDEARHGFESGDFVTFTEVQGMTELNGCE 263

Query: 1028 PRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            P +IK   PY+F+I  DT+ ++ Y  GGIVTQVK PK + FK L  ++ +P + LL+DF
Sbjct: 264  PIEIKTLGPYTFSI-CDTSSFSDYVRGGIVTQVKMPKKVAFKSLSSSMAEP-EFLLTDF 320



>gb:BC060674_2552969 Danio rerio ubiquitin-activating enzyme E1 (A1S9T
            and BN75 temperature sensitivity complementing), mRNA
            (cDNA clone MGC:66143 IMAGE:3819484), complete cds.
          Length = 1058

 Score =  255 bits (651), Expect = 1e-66
 Identities = 140/299 (46%), Positives = 195/299 (65%), Gaps = 3/299 (1%)
 Frame = +2

Query: 317  SNGRRTENGKSPIDC---SRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGV 487
            SN  RTE   +P +    + N  +IDE L+SRQL V G + M+R+  SNVLISG++GLGV
Sbjct: 26   SNSVRTELSHTPANGMAKNGNDAEIDEGLYSRQLYVLGHDAMKRMQSSNVLISGLRGLGV 85

Query: 488  EIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
            EIAKN+IL GVKSVTLHD+G  E  DLSS F   E+D+GKNRA  S  +L ELN+ V ++
Sbjct: 86   EIAKNVILGGVKSVTLHDQGVAEWKDLSSQFYLREEDLGKNRADVSQPRLAELNSYVPVT 145

Query: 668  TLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            + T  L+ E L+ FQ  V T+  L++     ++CH++   I  I  +  GLFG +FCDFG
Sbjct: 146  SYTGTLTNEYLTKFQVVVLTNSSLDEQTRIGEFCHSN--GIKLIVADTRGLFGQLFCDFG 203

Query: 848  PEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGK 1027
                V D +GE P + +I+ I+ D+  +V C+D+ R  F+ GD + F+EV+GMTELN   
Sbjct: 204  EVMIVFDTNGEQPLSAMISMITKDSAGVVTCLDEARHGFESGDYVTFTEVQGMTELNGCD 263

Query: 1028 PRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            P +IK   PY+F+I  DT+ ++ Y  GGIVTQVK PK + FK L  ++ +P + LL+DF
Sbjct: 264  PVEIKTLGPYTFSI-CDTSSFSDYVRGGIVTQVKMPKKIAFKSLSSSMAEP-EFLLTDF 320



>gb:BT007751_2150683 Synthetic construct Homo sapiens
            ubiquitin-activating enzyme E1 (A1S9T and BN75
            temperature sensitivity complementing) mRNA, partial cds.
          Length = 1059

 Score =  253 bits (647), Expect = 4e-66
 Identities = 132/276 (47%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CHN    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEDQLRVGEFCHNR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GM ELN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLVASLAEP-DFVVTDF 320



>sp|P22314|UBA1_HUMAN Ubiquitin-activating enzyme E1 (A1S9
            protein).>pir|A38564|A38564 ubiquitin-protein ligase (EC
            6.3.2.19) E1 [similarity] - human>gb:AL513366_1928884
            Human DNA sequence from clone CTD-2522E6 on chromosome X
            Contains the RGN gene for regucalcin (senescence marker
            protein-30) (RC, SMP30), the gene for neuronal protein
            17.3 (P17.3), the RBM10 gene for RNA binding motif
            protein 10 (MGC997, MGC1132, DXS8237E, KIAA0122), an
            inositol 1,3,4-triphosphate 5/6 kinase (ITPK1)
            pseudogene, the UBE1 gene for ubiquitin-activating enzyme
            E1 (A1S9T and BN75 temperature sensitivity complementing)
            (A1S9, A1ST, GXP1, A1S9T, UBE1X, MGC4781), the 5' UTR of
            the PCTK1 gene for PCTAIRE protein kinase 1 and five CpG
            islands, complete sequence.>gb:BC013041_1973924 Homo
            sapiens ubiquitin-activating enzyme E1 (A1S9T and BN75
            temperature sensitivity complementing), transcript
            variant 2, mRNA (cDNA clone MGC:4781 IMAGE:3543021),
            complete cds.>gb:HUMUBIQAA_2037971 Homo sapiens
            ubiquitin-activating enzyme E1 (UBE1) mRNA, complete cds.
          Length = 1058

 Score =  253 bits (647), Expect = 4e-66
 Identities = 132/276 (47%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CHN    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEDQLRVGEFCHNR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GM ELN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLVASLAEP-DFVVTDF 320



>sp|Q29504|UBA1_RABIT Ubiquitin-activating enzyme
            E1.>gb:OCU58653_1442682 Oryctolagus cuniculus
            ubiquitin-activating enzyme E1 mRNA, complete cds.
          Length = 1058

 Score =  253 bits (645), Expect = 7e-66
 Identities = 132/276 (47%), Positives = 186/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNSP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CH+    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEDQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSTMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GMTELN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFESGDFVSFSEVQGMTELNGNQPIEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLSASLAEP-DFVMTDF 320



>gb:HSQAE1_2019854 Human mRNA for ubiquitin activating enzyme E1.
          Length = 1058

 Score =  252 bits (643), Expect = 1e-65
 Identities = 132/276 (47%), Positives = 184/276 (66%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CHN    I  +     GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEDQLRVGEFCHNR--GIKLVVAGTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GM ELN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLVASLAEP-DFVVTDF 320



>gb:BC085791_2109358 Rattus norvegicus cDNA clone MGC:93773
            IMAGE:7109118, complete cds.
          Length = 1058

 Score =  248 bits (632), Expect = 2e-64
 Identities = 129/276 (46%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+ L  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTTQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNSP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE+ +   ++CH+    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEEQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GM +LN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFETGDFVSFSEVQGMVQLNGCQPIEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLPASLAEP-DFVMTDF 320



>gb:AE013599_1130895 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003832_1226776 Drosophila melanogaster
            chromosome 2R, section 18 of 74 of the complete
            sequence.>gb:AY069191_1293921 Drosophila melanogaster
            GH24511 full length cDNA.
          Length = 1191

 Score =  247 bits (631), Expect = 3e-64
 Identities = 135/276 (48%), Positives = 179/276 (64%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G + MRR+  S++L+SG+ GLG+EIAKN+IL GVKS+TLHD     
Sbjct: 194  DIDESLYSRQLYVLGHDAMRRMANSDILLSGLGGLGLEIAKNVILGGVKSITLHDTATCG 253

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            L DLSS F  +E D+GKNRA AS  +L ELNN V   + T  L++E L  F+  V T+  
Sbjct: 254  LHDLSSQFYLTEADIGKNRAEASCAQLAELNNYVRTVSHTGPLTEEFLRKFRVVVLTNSD 313

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
             E+      + H +   IA I  E  GLF  VFCDFG  FT+ D DG  P + +IASI++
Sbjct: 314  GEEQQRIAKFAHEN--GIALIIAETRGLFAKVFCDFGESFTIYDQDGTQPISTMIASITH 371

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            D   +V C+D+ R  F DGD + FSEV+GM ELN  +P KI    PY+F+I  DT+K+  
Sbjct: 372  DAQGVVTCLDETRHGFNDGDYVTFSEVQGMQELNGCQPLKITVLGPYTFSI-GDTSKFGE 430

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y+ GG+ TQVK PK + FKPL +  ++P + L+SDF
Sbjct: 431  YKSGGVATQVKMPKTISFKPLAQATEEP-EFLISDF 465



>sp|Q02053|UBA1_MOUSE Ubiquitin-activating enzyme E1
            1.>pir|JC1254|JC1254 ubiquitin-protein ligase (EC
            6.3.2.19) E1 - mouse>gb:AK088057_1175172 Mus musculus 2
            days neonate thymus thymic cells cDNA, RIKEN full-length
            enriched library, clone:E430002O15
            product:ubiquitin-activating enzyme E1, Chr X, full
            insert sequence.>gb:AK088528_1175456 Mus musculus 2 days
            neonate thymus thymic cells cDNA, RIKEN full-length
            enriched library, clone:E430019K02
            product:ubiquitin-activating enzyme E1, Chr X, full
            insert sequence.>gb:BC058630_2103374 Mus musculus
            ubiquitin-activating enzyme E1, Chr X, mRNA (cDNA clone
            MGC:73441 IMAGE:6402368), complete
            cds.>gb:MUSUBA1_2130755 Mus musculus mRNA for ubiquitin
            activating enzyme E1, complete cds.>gb:BC087200_2565057
            Xenopus laevis hypothetical LOC495876, mRNA (cDNA clone
            MGC:98107 IMAGE:7200147), complete cds.
          Length = 1058

 Score =  247 bits (631), Expect = 3e-64
 Identities = 129/276 (46%), Positives = 184/276 (66%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+ L  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDESLYSRQLYVLGHEAMKMLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTTQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSSFQVVVLTNSP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CH+    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEAQLRVGEFCHSR--GIKLVVADTRGLFGQLFCDFGEEMVLTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            DNP +V C+D+ R  F+ GD + FSEV+GM +LN  +P +IK   PY+F+I  DT+ ++ 
Sbjct: 227  DNPGVVTCLDEARHGFETGDFVSFSEVQGMIQLNGCQPMEIKVLGPYTFSI-CDTSNFSD 285

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK PK + FK L  +L +P D +++DF
Sbjct: 286  YIRGGIVSQVKVPKKISFKSLPASLVEP-DFVMTDF 320



>gb:MMC3HUBE9_2114367 Mus musculus ubiquitin activating enzyme E1
            (Ube1y1) gene, exons 24, 25, and 26 and complete cds.
          Length = 1058

 Score =  247 bits (630), Expect = 4e-64
 Identities = 131/276 (47%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+ L  S+VLISG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 48   DIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVTLHDQGIAQ 107

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V +   T  L +E LS FQ  V T+  
Sbjct: 108  WADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTP 167

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  ++  ++CH+H   I  +  +  GL G +FCDFG E  + D +GE P + +++ I+ 
Sbjct: 168  LEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITK 225

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +NP +V C++D R  F+ GD I F+EV+GM+ELN   P +IK   PY+F+I  DT+ ++ 
Sbjct: 226  ENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLGPYTFSI-CDTSSFSE 284

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK P+ + FKPL  +L +P + +++DF
Sbjct: 285  YIRGGIVSQVKVPRKINFKPLLASLAEP-EFVVTDF 319



>gb:AF150963_2056718 Mus musculus ubiquitin-activating enzyme E1
            (Ube1y1) mRNA, complete cds.
          Length = 1058

 Score =  247 bits (630), Expect = 4e-64
 Identities = 131/276 (47%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+ L  S+VLISG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 48   DIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILCGVKAVTLHDQGIAQ 107

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V +   T  L +E LS FQ  V T+  
Sbjct: 108  WADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTP 167

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  ++  ++CH+H   I  +  +  GL G +FCDFG E  + D +GE P + +++ I+ 
Sbjct: 168  LEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITK 225

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +NP +V C++D R  F+ GD I F+EV+GM+ELN   P +IK   PY+F+I  DT+ ++ 
Sbjct: 226  ENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLGPYTFSI-CDTSSFSE 284

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK P+ + FKPL  +L +P + +++DF
Sbjct: 285  YIRGGIVSQVKVPRKINFKPLLASLAEP-EFVVTDF 319



>gb:AK030031_1161792 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4932416G14
            product:ubiquitin-activating enzyme E1, Chr Y 1, full
            insert sequence.
          Length = 1058

 Score =  247 bits (630), Expect = 4e-64
 Identities = 131/276 (47%), Positives = 185/276 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+ L  S+VLISG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 48   DIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVTLHDQGIAQ 107

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V +   T  L +E LS FQ  V T+  
Sbjct: 108  WADLSSQFCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTP 167

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  ++  ++CH+H   I  +  +  GL G +FCDFG E  + D +GE P + +++ I+ 
Sbjct: 168  LEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQPLSAMVSMITK 225

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +NP +V C++D R  F+ GD I F+EV+GM+ELN   P +IK   PY+F+I  DT+ ++ 
Sbjct: 226  ENPGIVTCLEDSRHGFESGDFISFTEVQGMSELNGIGPIEIKVLGPYTFSI-CDTSSFSE 284

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GGIV+QVK P+ + FKPL  +L +P + +++DF
Sbjct: 285  YIRGGIVSQVKVPRKINFKPLLASLAEP-EFVVTDF 319



>gb:DMRNAUAE_1380074 Drosophila melanogaster mRNA for ubiquitin
            activating enzyme.
          Length = 1008

 Score =  244 bits (624), Expect = 2e-63
 Identities = 135/276 (48%), Positives = 178/276 (64%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G + MRR+  S++L+SG+ GLG+EIAKN+IL GVKS+TLHD     
Sbjct: 11   DIDESLYSRQLYVLGHDAMRRMANSDILLSGLGGLGLEIAKNVILGGVKSITLHDTATCG 70

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            L DLSS F  +E D+ KNRA AS  +L ELNN V   + T  L++E L  F+  V T+  
Sbjct: 71   LHDLSSQFYLTEADIAKNRAEASCAQLAELNNYVRTVSHTGPLTEEFLRKFRVVVLTNSD 130

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
             E+      +   H+  IA I  E  GLF  VFCDFG  FT+ D DG  P + +IASI++
Sbjct: 131  GEEQQRIAKF--GHENGIALIIAETRGLFAKVFCDFGETFTIYDPDGTQPISTMIASITH 188

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            D   +V C+D+ R  F DGDL+ FSEV+GM ELN  +P KI    PY+F+I  DT+K+  
Sbjct: 189  DAQGVVTCLDETRHGFNDGDLLTFSEVQGMQELNGCQPLKITVLGPYTFSI-GDTSKFGE 247

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y  GG+ TQVK PK + FKPL +  ++P + L+SDF
Sbjct: 248  YMSGGVATQVKMPKTISFKPLAQATEEP-EFLISDF 282



>gb:AE017341_1753963 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 1015

 Score =  242 bits (618), Expect = 1e-62
 Identities = 131/277 (47%), Positives = 181/277 (65%), Gaps = 2/277 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            IDE L+SRQL V G E M+++  SNVLI GMKGLGVEIAKN+ LAGVK+VT++D   VE+
Sbjct: 16   IDEGLYSRQLYVLGHEAMKKMATSNVLIVGMKGLGVEIAKNVALAGVKTVTIYDPSAVEI 75

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTL--TNELSKEQLSDFQAAVFTDI 733
             DL + F   E+D+G+ RA  +  +L ELN+ V I  L    E++ E +  +Q  V T+ 
Sbjct: 76   ADLGTQFFLREEDIGRPRAEVTAPRLAELNSYVPIKILPGAGEITPEMIEPYQIVVLTNA 135

Query: 734  RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASIS 913
             + K +E D+YC   Q  I FI  +V GLFGSVF DFG +F  +D  GE+P +G+I  I 
Sbjct: 136  TVRKQVEIDEYC--RQKGIYFIAADVRGLFGSVFNDFGKDFACVDPTGENPLSGMIVEID 193

Query: 914  NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYT 1093
             D  A+V C+D+ R   +DGD + FSE++GM  LN  +PRKI    PY+F+I  DT    
Sbjct: 194  EDEDAIVTCLDETRHGLEDGDFVTFSEIKGMEGLNGCEPRKISVKGPYTFSI-GDTRGLG 252

Query: 1094 AYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             Y+ GG+ TQVK PK+L+FK L+E+L +P +  ++DF
Sbjct: 253  KYKSGGLFTQVKMPKILQFKTLKESLTNP-EFFITDF 288



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 21/87 (24%), Positives = 45/87 (51%), Gaps = 5/87 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q+AV+G+    ++  +   + G   +G E+ KN  + G+ +     + + D   +E  +L
Sbjct: 417 QIAVFGKAFQEKISNTREFLVGSGAIGCEMLKNWSMMGLATGPNGIIHVTDLDTIEKSNL 476

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELN 649
           +  F+F   DVGK +A ++   + ++N
Sbjct: 477 NRQFLFRAKDVGKFKAESAAAAVADMN 503



>gb:CR382122_1655428 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1019

 Score =  237 bits (605), Expect = 3e-61
 Identities = 135/277 (48%), Positives = 180/277 (64%), Gaps = 1/277 (0%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDE L+SRQL V G+E M ++  SNVLI G+KGLGVEIAKN++LAGVKS+TL+D   V 
Sbjct: 10   EIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKGLGVEIAKNVVLAGVKSLTLYDPSAVA 69

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD-I 733
            L DLS+ F  SE D+G+ R   S  KL ELN+ V +  L       QLS+FQ  V TD I
Sbjct: 70   LQDLSTQFFLSEQDIGQARDKVSQAKLAELNSYVPVKVLEGLEDVSQLSEFQVVVVTDTI 129

Query: 734  RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASIS 913
             LE+ ++ ++Y H+H   I FI TE  GLFG+VF D G EFTV+D  GE+P+TGI++ I 
Sbjct: 130  SLEEKVKLNEYTHSH--GIGFISTETRGLFGNVFVDLGEEFTVIDTTGEEPKTGIVSDIE 187

Query: 914  NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYT 1093
            +D    V  +DD R   +DG+ + FSEV G+ +LNDG P K++   P++F I        
Sbjct: 188  SD--GTVTMLDDNRHGLEDGNYVKFSEVEGLEKLNDGTPYKVEVLGPFAFKI-GSVKDLG 244

Query: 1094 AYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             Y+ GG+ T+VK P+ L FK LRE+L  P + L SDF
Sbjct: 245  TYKKGGLFTEVKMPQKLTFKSLRESLATP-EFLYSDF 280



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 8/106 (7%)
 Frame = +2

Query: 356 DCSRNSPDIDEDLHSR---QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS 526
           D  RN+ D  + ++SR   Q++V+G E  +R+    V + G   +G E+ KN  L G+ S
Sbjct: 399 DFPRNA-DTTKPINSRYDNQISVFGLEFQKRIANLKVFLVGSGAIGCEMLKNWALLGLAS 457

Query: 527 -----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELN 649
                + + D  ++E  +L+  F+F   DVG+N++  +   +  +N
Sbjct: 458 GPEGKIIVTDNDSIEKSNLNRQFLFRPKDVGRNKSEVAADAVSAMN 503



>gb:CR382138_1671481 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1021

 Score =  234 bits (598), Expect = 2e-60
 Identities = 133/275 (48%), Positives = 180/275 (65%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            IDE L+SRQL V G+E M ++  +NVLI G+ GLG+EIAKN+ LAGVKS++L+D   VEL
Sbjct: 15   IDEGLYSRQLYVLGKEAMIKMQNANVLIIGLGGLGIEIAKNVALAGVKSLSLYDPHPVEL 74

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DLS+ F  SE DVGK RA +S  KL ELN  V IS + N+LS+  L+ F+  V TDI L
Sbjct: 75   SDLSTQFFLSESDVGKTRAESSSTKLSELNQYVPIS-IVNDLSESTLALFKCIVATDITL 133

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E+ ++ +++ H  +  I FI  ++ GLFG VF DFG  F V+D  GE+  TGI++ I  D
Sbjct: 134  EEQVKLNNFTHPKE--IGFISADIRGLFGQVFVDFGKNFNVIDQTGEEALTGIVSDIEKD 191

Query: 920  NPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTAY 1099
                V  +DD R   QDGD + FSE++GM +LNDG P K++   PY+F I+  +  Y  Y
Sbjct: 192  --GTVTMLDDNRHGLQDGDFVKFSEIQGMDKLNDGSPHKVEVLGPYAFKIKM-SDSYGTY 248

Query: 1100 EGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              GG+  QVK PK L F+PL + LK P + ++SDF
Sbjct: 249  IKGGLYQQVKVPKSLNFEPLTQQLKSP-EYVISDF 282



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVEL 559
           +  Q+AV+G+     +    V + G   +G E+ KN  + G+ S     V + D  ++E 
Sbjct: 415 YDSQIAVFGKPYQETISNLKVFLVGSGAIGCEMLKNWAMMGLGSGPDGKVIITDMDSIEK 474

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELN 649
            +L+  F+F   DVG+N+A  +   +Q +N
Sbjct: 475 SNLNRQFLFRPKDVGRNKADVAATAVQAMN 504



>gb:SPBC211_1719506 S.pombe chromosome II cosmid c211.
          Length = 644

 Score =  233 bits (593), Expect = 8e-60
 Identities = 133/269 (49%), Positives = 177/269 (65%), Gaps = 2/269 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            IDE L+SRQL V G E M+++  SNVLI G KGLGVEIAKN+ LAGVKSVTL+D     +
Sbjct: 15   IDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAGVKSVTLYDPQPTRI 74

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DLSS +  +EDD+G  RA  +V KL ELN  V +S + +ELS E L +F+  V T+  L
Sbjct: 75   EDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVS-VVDELSTEYLKNFKCVVVTETSL 133

Query: 740  EKAMEFDDYCH-NHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
             K +E +D+ H NH   IA+I  +  GLFGS+FCDFG  F   D DG +P TG+IASI++
Sbjct: 134  TKQLEINDFTHKNH---IAYIAADSRGLFGSIFCDFGENFICTDTDGNEPLTGMIASITD 190

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            D   +V  +++ R   ++GD + F+EV+GM  LNDG PRK++   PY+F+I   + K   
Sbjct: 191  D--GVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSI--GSVKDLG 246

Query: 1097 YEG-GGIVTQVKEPKVLKFKPLRETLKDP 1180
              G  G+ TQVK P  + FK LRE+LKDP
Sbjct: 247  SAGYNGVFTQVKVPTKISFKSLRESLKDP 275



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 7/121 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q+AV+G E   ++   +  + G   +G E+ KN  + GV +     +++ D  ++E  +L
Sbjct: 413 QIAVFGSEFQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNL 472

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELS--KEQLSDFQAAVFTDIRLE 742
           +  F+F   DVGK ++  +   +  +N S     LT +++  +E++      +F D   E
Sbjct: 473 NRQFLFRPRDVGKLKSECASTAVSIMNPS-----LTGKITSYQERVGPESEGIFGDEFFE 527

Query: 743 K 745
           K
Sbjct: 528 K 528



>pir|T50344|T50344 poly(A)+ RNA transport protein Ptr3p [imported] -
            fission yeast (Schizosaccharomyces pombe)
          Length = 1011

 Score =  233 bits (593), Expect = 8e-60
 Identities = 133/269 (49%), Positives = 177/269 (65%), Gaps = 2/269 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            IDE L+SRQL V G E M+++  SNVLI G KGLGVEIAKN+ LAGVKSVTL+D     +
Sbjct: 15   IDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAGVKSVTLYDPQPTRI 74

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DLSS +  +EDD+G  RA  +V KL ELN  V +S + +ELS E L +F+  V T+  L
Sbjct: 75   EDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVS-VVDELSTEYLKNFKCVVVTETSL 133

Query: 740  EKAMEFDDYCH-NHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
             K +E +D+ H NH   IA+I  +  GLFGS+FCDFG  F   D DG +P TG+IASI++
Sbjct: 134  TKQLEINDFTHKNH---IAYIAADSRGLFGSIFCDFGENFICTDTDGNEPLTGMIASITD 190

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            D   +V  +++ R   ++GD + F+EV+GM  LNDG PRK++   PY+F+I   + K   
Sbjct: 191  D--GVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSI--GSVKDLG 246

Query: 1097 YEG-GGIVTQVKEPKVLKFKPLRETLKDP 1180
              G  G+ TQVK P  + FK LRE+LKDP
Sbjct: 247  SAGYNGVFTQVKVPTKISFKSLRESLKDP 275



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 7/121 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q+AV+G E   ++   +  + G   +G E+ KN  + GV +     +++ D  ++E  +L
Sbjct: 413 QIAVFGSEFQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNL 472

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELS--KEQLSDFQAAVFTDIRLE 742
           +  F+F   DVGK ++  +   +  +N S     LT +++  +E++      +F D   E
Sbjct: 473 NRQFLFRPRDVGKLKSECASTAVSIMNPS-----LTGKITSYQERVGPESEGIFGDEFFE 527

Query: 743 K 745
           K
Sbjct: 528 K 528



>sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 (Poly(A)+ RNA
            transport protein 3).>pir|T52000|T52000 poly(A)+ RNA
            transport protein Ptr3p - fission yeast
            (Schizosaccharomyces pombe)>gb:D87259_1675052
            Schizosaccharomyces pombe ptr3 gene for poly(A)+ RNA
            transport protein Ptr3p, complete cds.
          Length = 1012

 Score =  233 bits (593), Expect = 8e-60
 Identities = 133/269 (49%), Positives = 177/269 (65%), Gaps = 2/269 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            IDE L+SRQL V G E M+++  SNVLI G KGLGVEIAKN+ LAGVKSVTL+D     +
Sbjct: 15   IDEGLYSRQLYVLGHEAMKQMSQSNVLIIGCKGLGVEIAKNVCLAGVKSVTLYDPQPTRI 74

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DLSS +  +EDD+G  RA  +V KL ELN  V +S + +ELS E L +F+  V T+  L
Sbjct: 75   EDLSSQYFLTEDDIGVPRAKVTVSKLAELNQYVPVS-VVDELSTEYLKNFKCVVVTETSL 133

Query: 740  EKAMEFDDYCH-NHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
             K +E +D+ H NH   IA+I  +  GLFGS+FCDFG  F   D DG +P TG+IASI++
Sbjct: 134  TKQLEINDFTHKNH---IAYIAADSRGLFGSIFCDFGENFICTDTDGNEPLTGMIASITD 190

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            D   +V  +++ R   ++GD + F+EV+GM  LNDG PRK++   PY+F+I   + K   
Sbjct: 191  D--GVVTMLEETRHGLENGDFVKFTEVKGMPGLNDGTPRKVEVKGPYTFSI--GSVKDLG 246

Query: 1097 YEG-GGIVTQVKEPKVLKFKPLRETLKDP 1180
              G  G+ TQVK P  + FK LRE+LKDP
Sbjct: 247  SAGYNGVFTQVKVPTKISFKSLRESLKDP 275



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 30/121 (24%), Positives = 60/121 (49%), Gaps = 7/121 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q+AV+G E   ++   +  + G   +G E+ KN  + GV +     +++ D  ++E  +L
Sbjct: 413 QIAVFGSEFQEKIASLSTFLVGAGAIGCEMLKNWAMMGVATGESGHISVTDMDSIEKSNL 472

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELS--KEQLSDFQAAVFTDIRLE 742
           +  F+F   DVGK ++  +   +  +N S     LT +++  +E++      +F D   E
Sbjct: 473 NRQFLFRPRDVGKLKSECASTAVSIMNPS-----LTGKITSYQERVGPESEGIFGDEFFE 527

Query: 743 K 745
           K
Sbjct: 528 K 528



>gb:CR382131_1663710 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1015

 Score =  228 bits (582), Expect = 1e-58
 Identities = 127/280 (45%), Positives = 179/280 (63%), Gaps = 1/280 (0%)
 Frame = +2

Query: 368  NSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
            N+ +IDE L+SRQL V G E M+++  SNVLI G++GLG+EIAKN++LAGVKS+TL+D G
Sbjct: 12   NAGEIDESLYSRQLYVLGHEAMKKMANSNVLIVGLQGLGIEIAKNIVLAGVKSLTLYDPG 71

Query: 548  NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTL-TNELSKEQLSDFQAAVF 724
              E+ DLS+ F   EDDVGK R   S  +L ELN+ V +  L   +LS+E+++ FQ  V 
Sbjct: 72   KTEVADLSAQFFLREDDVGKRRDQVSQPRLAELNSYVPVHVLEAKDLSEEEVARFQVVVL 131

Query: 725  TDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIA 904
            T+  LE+ +  ++  H     I F+ T+  GLFG++F DFG  F ++D +GE+P +GIIA
Sbjct: 132  TNASLEEQIRVNEITHKQN--IGFVSTDTRGLFGNIFVDFGSSFALIDANGEEPHSGIIA 189

Query: 905  SISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTT 1084
             I  D    VA +D+ R   +DGD + F+EV G+ ++N   PRKIK   PYSF I     
Sbjct: 190  GI--DEEGNVAALDETRHNLEDGDYVKFTEVEGL-DINGDTPRKIKVTGPYSFNI-GSVD 245

Query: 1085 KYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
                Y+ GG+ TQVK P+ + F  L+E L  P + L+SDF
Sbjct: 246  GLGTYKKGGLFTQVKMPQEISFGSLKEQLAKP-ELLISDF 284



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 3/88 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGV-KSVTLH--DEGNVELWD 565
           + RQ+AV+G+E   ++F     + G   +G E+ KN  L G+ K   +H  D   +E  +
Sbjct: 414 YDRQVAVFGKEFTEKIFAVKTFLVGSGAIGCEMLKNWALMGLGKDGEIHVTDNDVIEKSN 473

Query: 566 LSSNFVFSEDDVGKNRALASVQKLQELN 649
           L+  F+F   DVGK++++ + + + E+N
Sbjct: 474 LNRQFLFRPKDVGKHKSVTATEAVAEMN 501



>gb:SCUBA1G_1710621 Yeast UBA1 gene for ubiquitin-activating enzyme.
          Length = 1024

 Score =  221 bits (562), Expect = 3e-56
 Identities = 126/277 (45%), Positives = 178/277 (64%), Gaps = 1/277 (0%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDE L+SRQL V G+E M ++  SNVLI G+KGLGVEIAKN++LAGVKS+T+ D   V+
Sbjct: 13   EIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQ 72

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD-I 733
            L DLS+ F  +E D+G+ R   +  KL ELN  V ++ L +     QLS FQ  V TD +
Sbjct: 73   LADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTV 132

Query: 734  RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASIS 913
             LE  ++ +++CH+    I FI +E  GLFG+ F D G EFTVLD  GE+PRTG+++ I 
Sbjct: 133  SLEDKVKINEFCHS--SGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIE 190

Query: 914  NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYT 1093
             D    V  +DD R   +DG+ + FSEV G+ +LNDG   K++   P++F I     +Y 
Sbjct: 191  PD--GTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEYG 247

Query: 1094 AYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             Y+ GGI T+VK P+ + FK L++ L +P + + SDF
Sbjct: 248  EYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDF 283



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 5/90 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVEL 559
           +  Q+AV+G +  +++  S V + G   +G E+ KN  L G+ S     + + D  ++E 
Sbjct: 417 YDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEK 476

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELN 649
            +L+  F+F   DVGKN++  + + +  +N
Sbjct: 477 SNLNRQFLFRPKDVGKNKSEVAAEAVCAMN 506



>sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1
            1.>pir|S38048|S38048 ubiquitin-protein ligase (EC
            6.3.2.19) - yeast  (Saccharomyces
            cerevisiae)>gb:SCYKL210W_1713190 S.cerevisiae chromosome
            XI reading frame ORF YKL210w.
          Length = 1024

 Score =  221 bits (562), Expect = 3e-56
 Identities = 126/277 (45%), Positives = 178/277 (64%), Gaps = 1/277 (0%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDE L+SRQL V G+E M ++  SNVLI G+KGLGVEIAKN++LAGVKS+T+ D   V+
Sbjct: 13   EIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQ 72

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD-I 733
            L DLS+ F  +E D+G+ R   +  KL ELN  V ++ L +     QLS FQ  V TD +
Sbjct: 73   LADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTV 132

Query: 734  RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASIS 913
             LE  ++ +++CH+    I FI +E  GLFG+ F D G EFTVLD  GE+PRTG+++ I 
Sbjct: 133  SLEDKVKINEFCHS--SGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIE 190

Query: 914  NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYT 1093
             D    V  +DD R   +DG+ + FSEV G+ +LNDG   K++   P++F I     +Y 
Sbjct: 191  PD--GTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI-GSVKEYG 247

Query: 1094 AYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             Y+ GGI T+VK P+ + FK L++ L +P + + SDF
Sbjct: 248  EYKKGGIFTEVKVPRKISFKSLKQQLSNP-EFVFSDF 283



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 5/90 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVEL 559
           +  Q+AV+G +  +++  S V + G   +G E+ KN  L G+ S     + + D  ++E 
Sbjct: 417 YDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEK 476

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELN 649
            +L+  F+F   DVGKN++  + + +  +N
Sbjct: 477 SNLNRQFLFRPKDVGKNKSEVAAEAVCAMN 506



>gb:CR380957_1652525 Candida glabrata strain CBS138 chromosome K
            complete sequence.
          Length = 1014

 Score =  219 bits (559), Expect = 7e-56
 Identities = 128/282 (45%), Positives = 177/282 (62%), Gaps = 1/282 (0%)
 Frame = +2

Query: 362  SRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHD 541
            S+ + +IDE L+SRQL V G+E M ++  SNVLI G++GLGVEIAKN+ LAGVKS+TL D
Sbjct: 2    SKETGEIDESLYSRQLYVLGKEAMLKMQLSNVLIVGLRGLGVEIAKNVALAGVKSLTLFD 61

Query: 542  EGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
                 L DLS+ F  SE D+G+ R   +  KL ELN+ V + TL   L+ + L  FQ  V
Sbjct: 62   PEKAVLQDLSTQFFLSESDIGRRRDEVTRGKLAELNSYVPVKTL-ESLNDDDLKQFQVVV 120

Query: 722  FTD-IRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGI 898
             T+ + LE  ++ ++ CHN    + FI TE  GLFG  F D G EF+V+D  GE+PRTGI
Sbjct: 121  ATETVSLEDKIKMNNICHN--SGVKFIATETRGLFGQAFVDLGDEFSVIDQTGEEPRTGI 178

Query: 899  IASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEED 1078
            ++ I  D    V  +DD R   +DG+ + FSEV+G+ +LNDG   K++   P++F I   
Sbjct: 179  VSDIEPD--GTVTMLDDSRHGLEDGNYVKFSEVQGLEKLNDGTLYKVEVLGPFAFRI-GS 235

Query: 1079 TTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
                  Y+ GGI T+VK PK L FK L+E+L +P + + SDF
Sbjct: 236  VKDLGEYKKGGIFTEVKVPKTLSFKTLQESLSEP-EYVFSDF 276



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVEL 559
           +  Q+AV+G +  R+L  S V + G   +G E+ KN  L G+ S     + + D  ++E 
Sbjct: 411 YDNQIAVFGIDFQRKLANSKVFLVGSGAIGCEMLKNWALMGLGSGPDGRIIVTDNDSIEK 470

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELN 649
            +L+  F+F   DVG +++  + + +  +N
Sbjct: 471 SNLNRQFLFRPKDVGHDKSDVAARAVSSMN 500



>gb:AK049603_1168884 Mus musculus 12 days embryo spinal cord cDNA,
            RIKEN full-length enriched library, clone:C530001N05
            product:MOP-4 homolog [Homo sapiens], full insert
            sequence.>gb:BC063048_2105123 Mus musculus RIKEN cDNA
            5730469D23 gene, mRNA (cDNA clone MGC:66555
            IMAGE:6825308), complete cds.
          Length = 1053

 Score =  218 bits (554), Expect = 3e-55
 Identities = 120/284 (42%), Positives = 174/284 (61%), Gaps = 6/284 (2%)
 Frame = +2

Query: 371  SPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
            S +ID+ L+SRQ  V G   M+++  S V +SGM GLGVEIAKNL+LAG+K++T+HD   
Sbjct: 36   SLEIDDGLYSRQRYVLGDTAMQKMAKSCVFLSGMGGLGVEIAKNLVLAGIKALTIHDTKK 95

Query: 551  VELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLTNELSKEQ----LSDFQ 712
             + WDL +NF   EDDV   +NRA A + ++ ELN  V +S+ +  L +      L  +Q
Sbjct: 96   CQAWDLGTNFFLCEDDVVNERNRAEAVLHRIAELNPYVQVSSSSAPLDETTDLSFLEKYQ 155

Query: 713  AAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRT 892
              V T+I+L    + +++CH+H PPI FI  +V G++  +FCDFG EF V D  GE+P+ 
Sbjct: 156  CVVLTEIKLTLQKKINNFCHSHCPPIKFISADVHGIWSRLFCDFGDEFEVSDTTGEEPKE 215

Query: 893  GIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIE 1072
              I++I+  NP +V C++    + + G  + F E+ GMT LN G  ++I    P+SF+I 
Sbjct: 216  IFISNITQANPGIVTCLESHPHKLETGQFLTFREIHGMTGLN-GSVQQITVISPFSFSI- 273

Query: 1073 EDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
             DTTK   Y  GGI  QVK PK   F+PL   +K P   L++DF
Sbjct: 274  GDTTKLDPYLHGGIAVQVKTPKTFCFEPLESQIKHP-RCLIADF 316



>gb:AL513366_1928885 Human DNA sequence from clone CTD-2522E6 on
            chromosome X Contains the RGN gene for regucalcin
            (senescence marker protein-30) (RC, SMP30), the gene for
            neuronal protein 17.3 (P17.3), the RBM10 gene for RNA
            binding motif protein 10 (MGC997, MGC1132, DXS8237E,
            KIAA0122), an inositol 1,3,4-triphosphate 5/6 kinase
            (ITPK1) pseudogene, the UBE1 gene for
            ubiquitin-activating enzyme E1 (A1S9T and BN75
            temperature sensitivity complementing) (A1S9, A1ST, GXP1,
            A1S9T, UBE1X, MGC4781), the 5' UTR of the PCTK1 gene for
            PCTAIRE protein kinase 1 and five CpG islands, complete
            sequence.
          Length = 271

 Score =  216 bits (551), Expect = 6e-55
 Identities = 108/222 (48%), Positives = 149/222 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 49   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 108

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 109  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 168

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CHN    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 169  LEDQLRVGEFCHNR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK 226

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIK 1042
            DNP +V C+D+ R  F+ GD + FSEV+GM ELN  +P +IK
Sbjct: 227  DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIK 268



>gb:AL513366_1928882 Human DNA sequence from clone CTD-2522E6 on
            chromosome X Contains the RGN gene for regucalcin
            (senescence marker protein-30) (RC, SMP30), the gene for
            neuronal protein 17.3 (P17.3), the RBM10 gene for RNA
            binding motif protein 10 (MGC997, MGC1132, DXS8237E,
            KIAA0122), an inositol 1,3,4-triphosphate 5/6 kinase
            (ITPK1) pseudogene, the UBE1 gene for
            ubiquitin-activating enzyme E1 (A1S9T and BN75
            temperature sensitivity complementing) (A1S9, A1ST, GXP1,
            A1S9T, UBE1X, MGC4781), the 5' UTR of the PCTK1 gene for
            PCTAIRE protein kinase 1 and five CpG islands, complete
            sequence.
          Length = 284

 Score =  216 bits (551), Expect = 6e-55
 Identities = 108/222 (48%), Positives = 149/222 (67%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 63   DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 122

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
              DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 123  WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 182

Query: 737  LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISN 916
            LE  +   ++CHN    I  +  +  GLFG +FCDFG E  + D +GE P + +++ ++ 
Sbjct: 183  LEDQLRVGEFCHNR--GIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTK 240

Query: 917  DNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIK 1042
            DNP +V C+D+ R  F+ GD + FSEV+GM ELN  +P +IK
Sbjct: 241  DNPGVVTCLDEARHGFESGDFVSFSEVQGMVELNGNQPMEIK 282



>gb:HSM803766_2017722 Homo sapiens mRNA; cDNA DKFZp451P021 (from clone
            DKFZp451P021); complete cds.
          Length = 1052

 Score =  214 bits (545), Expect = 3e-54
 Identities = 125/300 (41%), Positives = 182/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  ---NELSKEQLSD-FQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               NE +     D +Q  V T+++L    + +D+C +  PPI FI  +V G++  +FCDF
Sbjct: 140  VPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C++D   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLEDHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK + F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHP-KCLIVDF 316



>gb:AE016819_1749268 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 1013

 Score =  214 bits (544), Expect = 4e-54
 Identities = 123/279 (44%), Positives = 172/279 (61%), Gaps = 1/279 (0%)
 Frame = +2

Query: 371  SPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
            S DIDE L+SRQL V G+E M ++  SNVL+ G+ GLGVEIAKN+ LAGV+S+TL+D   
Sbjct: 4    SDDIDESLYSRQLYVLGKEAMLKMQVSNVLVVGVTGLGVEIAKNVALAGVRSLTLYDPEA 63

Query: 551  VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD 730
            V + DL++ F   E DVG+ R   +  +L ELN+ V +  +   L + +L +FQ  V T+
Sbjct: 64   VTVQDLATQFFLRESDVGQRRDHVTAPRLAELNSYVPV-RVAESLEEARLGEFQVIVATN 122

Query: 731  -IRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
             + L + +  + Y H H   + FI  E  GLFG +F D G +FTV+D  GEDP++GI++ 
Sbjct: 123  TVPLAERLRLNRYAHAH--GVRFIAAETRGLFGQIFVDLGEDFTVIDSTGEDPKSGIVSD 180

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTK 1087
            I  D    V  +DD R   +DGD + F+EV G+  LNDG P K++   P++F I     K
Sbjct: 181  IEAD--GTVTMLDDSRHNLEDGDYVRFTEVDGLEGLNDGTPYKVEVLGPFAFRI-GSVEK 237

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            +  Y+ GGI TQVK P  L FK   E L+DP + L+SDF
Sbjct: 238  FGVYKKGGIFTQVKMPAKLSFKSYEEALRDP-EYLVSDF 275



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 31/112 (27%), Positives = 53/112 (47%), Gaps = 5/112 (4%)
 Frame = +2

Query: 329 RTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLI 508
           RTE   +PI          +  +  Q+AV+G +  R L    + + G   +G E+ KN  
Sbjct: 396 RTEATTAPI----------QSRYDNQIAVFGLDFQRALANLKIFLVGSGAIGCEMLKNWA 445

Query: 509 LAGVKS-----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELN 649
           L GV S     + + D  ++E  +L+  F+F   DVG+N++  +     E+N
Sbjct: 446 LMGVGSGPEGKIMVTDNDSIEKSNLNRQFLFRPKDVGRNKSEVAAAATIEMN 497



>gb:BX908809_1644599 Neurospora crassa DNA linkage group IV Cosmid
            contig 29E8.
          Length = 1038

 Score =  214 bits (544), Expect = 4e-54
 Identities = 125/281 (44%), Positives = 168/281 (59%), Gaps = 5/281 (1%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            +IDE L+SRQL V G E M+R+  SNVLI G+KGLGVEIAKN+ LAGVKS+TLHD     
Sbjct: 30   EIDESLYSRQLYVLGHEAMKRMSASNVLIVGLKGLGVEIAKNVALAGVKSLTLHDPEPAA 89

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVII-----STLTNELSKEQLSDFQAAV 721
              DLS+ F    +DVGK R   +  ++ ELN    +      +L + LS  Q   +Q  V
Sbjct: 90   WADLSAQFFLRPEDVGKPRDQVTAPRVAELNAYTPVHIHQSPSLADNLS--QFDKYQVVV 147

Query: 722  FTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGII 901
             T+   +      +YCH+    I FI     GLFG +FCDFG  FTV+D +GE+P  GI+
Sbjct: 148  LTNQHTDLQTIVGEYCHS--KGIYFIAVNTHGLFGGIFCDFGDNFTVMDTNGENPVNGIV 205

Query: 902  ASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDT 1081
            A I  D   LV+ +D+ R   +DGD + FSEV GM  LN  +PRK+    PY+F+I  D 
Sbjct: 206  AGI--DEEGLVSALDETRHGLEDGDYVTFSEVEGMEGLNGCEPRKVTVKGPYTFSI-GDV 262

Query: 1082 TKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            +    Y+ GG+  QVK PK ++FK +   LKDP + ++SDF
Sbjct: 263  SGLGQYKKGGLYQQVKMPKTIEFKSITNALKDP-EFVISDF 302



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 22/87 (25%), Positives = 46/87 (52%), Gaps = 5/87 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q+AV+G+E   ++      + G   +G E+ KN  + G+ +     +T+ D  ++E  +L
Sbjct: 432 QIAVFGKEFQEKISNVKQFLVGAGAIGCEMLKNWAMIGLGTGPEGKITVTDMDSIEKSNL 491

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELN 649
           +  F+F   DVG+ ++  + +  Q +N
Sbjct: 492 NRQFLFRPKDVGQMKSDCAAKAAQAMN 518



>gb:HSM803322_2017685 Homo sapiens mRNA; cDNA DKFZp451F154 (from clone
            DKFZp451F154); complete cds.
          Length = 1052

 Score =  213 bits (541), Expect = 8e-54
 Identities = 122/300 (40%), Positives = 181/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  NELSKEQ----LSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               ++      L  +Q  V T+++L    + +D+C +  PPI FI  +V G++  +FCDF
Sbjct: 140  APFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C+++   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQTNPGIVTCLENHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK + F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHP-KCLIVDF 316



>gb:BC031637_1980200 Homo sapiens hypothetical protein FLJ10808, mRNA
            (cDNA clone IMAGE:5172175), complete cds.
          Length = 389

 Score =  212 bits (540), Expect = 1e-53
 Identities = 124/300 (41%), Positives = 182/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  ---NELSKEQLSD-FQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               NE +     D +Q  V T+++L    + +D+C +  PPI FI  +V G++  +FCDF
Sbjct: 140  VPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C+++   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK + F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHP-KCLIVDF 316



>gb:AB014773_1864666 Homo sapiens mRNA for MOP-4, complete cds.
          Length = 1052

 Score =  212 bits (540), Expect = 1e-53
 Identities = 124/300 (41%), Positives = 182/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  ---NELSKEQLSD-FQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               NE +     D +Q  V T+++L    + +D+C +  PPI FI  +V G++  +FCDF
Sbjct: 140  VPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C+++   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK + F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHP-KCLIVDF 316



>gb:AX418480_1468164 Sequence 1 from Patent WO0206485.
          Length = 1052

 Score =  212 bits (540), Expect = 1e-53
 Identities = 124/300 (41%), Positives = 182/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  ---NELSKEQLSD-FQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               NE +     D +Q  V T+++L    + +D+C +  PPI FI  +V G++  +FCDF
Sbjct: 140  VPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C+++   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK + F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTVFFESLERQLKHP-KCLIVDF 316



>gb:AK094969_1914275 Homo sapiens cDNA FLJ37650 fis, clone
            BRHIP2000553, weakly similar to UBIQUITIN-ACTIVATING
            ENZYME E1 1.
          Length = 340

 Score =  207 bits (527), Expect = 3e-52
 Identities = 123/300 (41%), Positives = 180/300 (60%), Gaps = 6/300 (2%)
 Frame = +2

Query: 323  GRRTENGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKN 502
            G  + N   PI  S  S +ID+ L+SRQ  V G   M+++  S+V +SGM GLG+EIAKN
Sbjct: 21   GTGSTNKNLPI-MSTASVEIDDALYSRQRYVLGDTAMQKMAKSHVFLSGMGGLGLEIAKN 79

Query: 503  LILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV--GKNRALASVQKLQELNNSVIISTLT 676
            L+LAG+K+VT+HD    + WDL +NF  SEDDV   +NRA A ++ + ELN  V +++ +
Sbjct: 80   LVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSS 139

Query: 677  ---NELSKEQLSD-FQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
               NE +     D +Q  V T+++L    + +D+C +  PPI FI  +V G++  +F DF
Sbjct: 140  VPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFYDF 199

Query: 845  GPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDG 1024
            G EF VLD  GE+P+   I++I+  NP +V C+++   + + G  + F E+ GMT LN G
Sbjct: 200  GDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREINGMTGLN-G 258

Query: 1025 KPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
              ++I    P+SF+I  DTT+   Y  GGI  QVK PK   F+ L   LK P   L+ DF
Sbjct: 259  SIQQITVISPFSFSI-GDTTELEPYLHGGIAVQVKTPKTAFFESLERQLKHP-KCLIVDF 316



>gb:AF288693_2061629 Mus musculus Ube1l (Ube1l) gene, partial cds.
          Length = 775

 Score =  206 bits (525), Expect = 6e-52
 Identities = 113/268 (42%), Positives = 163/268 (60%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+  + VL+ G++GLG E+AKNL+L GV S+TLHD      
Sbjct: 1    MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLTGVGSLTLHDPHPTCW 60

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++    SE+ +G+NRA AS  +L +LN +V IS  + +++++ L  FQ  V TD +L
Sbjct: 61   ADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITEDLLQGFQVVVLTDSKL 120

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E  ++    CH H   + F+  E  GL G +FCDFG +FTVLD    +P T  I  IS  
Sbjct: 121  EDQLKVGPLCHKH--GVRFLMAETRGLVGRLFCDFGEDFTVLDPTEVEPMTAAIQDISQG 178

Query: 920  NPALVAC-VDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
             P +V    D +R  F DGDL++FS++ GM ELN   P+ ++  +  S  I  DTT ++ 
Sbjct: 179  FPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEI-GDTTTFSR 237

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG+VT+VK PK ++ KPL   L  P
Sbjct: 238  YLRGGVVTEVKRPKTVRHKPLDIALLQP 265



>gb:AK089235_1175857 Mus musculus NOD-derived CD11c +ve dendritic
            cells cDNA, RIKEN full-length enriched library,
            clone:F630050P21 product:similar to UBIQUITIN-ACTIVATING
            ENZYME E1 [Homo sapiens], full insert sequence.
          Length = 905

 Score =  206 bits (525), Expect = 6e-52
 Identities = 113/268 (42%), Positives = 163/268 (60%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+  + VL+ G++GLG E+AKNL+L GV S+TLHD      
Sbjct: 1    MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLTGVGSLTLHDPHPTCW 60

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++    SE+ +G+NRA AS  +L +LN +V IS  + +++++ L  FQ  V TD +L
Sbjct: 61   ADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITEDLLQGFQVVVLTDSKL 120

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E  ++    CH H   + F+  E  GL G +FCDFG +FTVLD    +P T  I  IS  
Sbjct: 121  EDQLKVGPLCHKH--GVRFLMAETRGLVGRLFCDFGEDFTVLDPTEVEPMTAAIQDISQG 178

Query: 920  NPALVAC-VDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
             P +V    D +R  F DGDL++FS++ GM ELN   P+ ++  +  S  I  DTT ++ 
Sbjct: 179  FPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEI-GDTTTFSR 237

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG+VT+VK PK ++ KPL   L  P
Sbjct: 238  YLRGGVVTEVKRPKTVRHKPLDIALLQP 265



>gb:AK004894_1152673 Mus musculus adult male liver cDNA, RIKEN
            full-length enriched library, clone:1300004C08
            product:similar to UBIQUITIN-ACTIVATING ENZYME E1 [Homo
            sapiens], full insert sequence.
          Length = 977

 Score =  206 bits (525), Expect = 6e-52
 Identities = 113/268 (42%), Positives = 163/268 (60%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+  + VL+ G++GLG E+AKNL+L GV S+TLHD      
Sbjct: 1    MDEELYSRQLYVLGLPAMQRIQEAKVLLCGLQGLGAEVAKNLVLTGVGSLTLHDPHPTCW 60

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++    SE+ +G+NRA AS  +L +LN +V IS  + +++++ L  FQ  V TD +L
Sbjct: 61   ADLAAQCFLSEESLGRNRAEASQAQLAQLNEAVQISVHSGDITEDLLQGFQVVVLTDSKL 120

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E  ++    CH H   + F+  E  GL G +FCDFG +FTVLD    +P T  I  IS  
Sbjct: 121  EDQLKVGPLCHKH--GVRFLMAETRGLVGRLFCDFGEDFTVLDPTEVEPMTAAIQDISQG 178

Query: 920  NPALVAC-VDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
             P +V    D +R  F DGDL++FS++ GM ELN   P+ ++  +  S  I  DTT ++ 
Sbjct: 179  FPGIVTLRGDTKRHSFHDGDLVIFSDIEGMVELNSCSPQSVRVQKDGSLEI-GDTTTFSR 237

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG+VT+VK PK ++ KPL   L  P
Sbjct: 238  YLRGGVVTEVKRPKTVRHKPLDIALLQP 265



>gb:BT007757_2150689 Synthetic construct Homo sapiens
            ubiquitin-activating enzyme E1-like mRNA, partial cds.
          Length = 1013

 Score =  199 bits (507), Expect = 7e-50
 Identities = 110/268 (41%), Positives = 159/268 (59%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+ G+ VL+SG++GLG E+AKNL+L GV S+TLHD      
Sbjct: 10   LDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCW 69

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++ F+ SE D+ ++RA AS + L +LN +V +   T +++++ L DFQ  V T  +L
Sbjct: 70   SDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQVVVLTAAKL 129

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E+ ++    CH H   + F+  +  GL G +FCDFG +FTV D    +P T  I  IS  
Sbjct: 130  EEQLKVGTLCHKH--GVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQG 187

Query: 920  NPALVACVDDERLE-FQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +P ++          F+DGDL+ FS + GM ELND  PR I      S  I  DTT ++ 
Sbjct: 188  SPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEI-GDTTTFSR 246

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG +T+VK PK ++ K L   L  P
Sbjct: 247  YLRGGAITEVKRPKTVRHKSLDTALLQP 274



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%)
 Frame = +2

Query: 347 SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS 526
           SP DC+      D      Q+AV+G     +L   + L+ G   +G E+ K   L G+ +
Sbjct: 404 SPEDCALRGSRYDG-----QIAVFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGA 458

Query: 527 -----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
                +T+ D  ++E  +LS  F+F   DVG+ +A  +    + LN  + +  LT  L
Sbjct: 459 GNSGGLTVVDMDHIERSNLSRQFLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPL 516



>gb:BC006378_1970240 Homo sapiens ubiquitin-activating enzyme E1-like,
            mRNA (cDNA clone MGC:12713 IMAGE:4299266), complete
            cds.>gb:BT007026_1990464 Homo sapiens
            ubiquitin-activating enzyme E1-like mRNA, complete cds.
          Length = 1012

 Score =  199 bits (507), Expect = 7e-50
 Identities = 110/268 (41%), Positives = 159/268 (59%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+ G+ VL+SG++GLG E+AKNL+L GV S+TLHD      
Sbjct: 10   LDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCW 69

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++ F+ SE D+ ++RA AS + L +LN +V +   T +++++ L DFQ  V T  +L
Sbjct: 70   SDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQVVVLTAAKL 129

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E+ ++    CH H   + F+  +  GL G +FCDFG +FTV D    +P T  I  IS  
Sbjct: 130  EEQLKVGTLCHKH--GVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQG 187

Query: 920  NPALVACVDDERLE-FQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +P ++          F+DGDL+ FS + GM ELND  PR I      S  I  DTT ++ 
Sbjct: 188  SPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEI-GDTTTFSR 246

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG +T+VK PK ++ K L   L  P
Sbjct: 247  YLRGGAITEVKRPKTVRHKSLDTALLQP 274



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%)
 Frame = +2

Query: 347 SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS 526
           SP DC+      D      Q+AV+G     +L   + L+ G   +G E+ K   L G+ +
Sbjct: 404 SPEDCALRGSRYDG-----QIAVFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGA 458

Query: 527 -----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
                +T+ D  ++E  +LS  F+F   DVG+ +A  +    + LN  + +  LT  L
Sbjct: 459 GNSGGLTVVDMDHIERSNLSRQFLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPL 516



>sp|P41226|UBAL_HUMAN Ubiquitin-activating enzyme E1 homolog
            (D8).>gb:AF294032_1895394 Homo sapiens UBE1L protein
            (UBE1L) gene, complete cds.>gb:HUME1URP_2030769 Homo
            sapiens ubiquitin-activating enzyme E1 related protein
            mRNA, complete cds.
          Length = 1011

 Score =  199 bits (507), Expect = 7e-50
 Identities = 110/268 (41%), Positives = 159/268 (59%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+ G+ VL+SG++GLG E+AKNL+L GV S+TLHD      
Sbjct: 10   LDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCW 69

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++ F+ SE D+ ++RA AS + L +LN +V +   T +++++ L DFQ  V T  +L
Sbjct: 70   SDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQVVVLTAAKL 129

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E+ ++    CH H   + F+  +  GL G +FCDFG +FTV D    +P T  I  IS  
Sbjct: 130  EEQLKVGTLCHKH--GVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQG 187

Query: 920  NPALVACVDDERLE-FQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +P ++          F+DGDL+ FS + GM ELND  PR I      S  I  DTT ++ 
Sbjct: 188  SPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEI-GDTTTFSR 246

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG +T+VK PK ++ K L   L  P
Sbjct: 247  YLRGGAITEVKRPKTVRHKSLDTALLQP 274



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%)
 Frame = +2

Query: 347 SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS 526
           SP DC+      D      Q+AV+G     +L   + L+ G   +G E+ K   L G+ +
Sbjct: 403 SPEDCALRGSRYDG-----QIAVFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGA 457

Query: 527 -----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
                +T+ D  ++E  +LS  F+F   DVG+ +A  +    + LN  + +  LT  L
Sbjct: 458 GNSGGLTVVDMDHIERSNLSRQFLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPL 515



>gb:FRU010348_2572058 Fugu rubripes UBE1-like gene, PRGFR2 gene and
            gene encoding calmodulin binding protein kinase, clone
            168J21.
          Length = 891

 Score =  198 bits (503), Expect = 2e-49
 Identities = 117/269 (43%), Positives = 161/269 (59%), Gaps = 2/269 (0%)
 Frame = +2

Query: 371  SPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
            S +IDE  +SRQL V G + M R+  ++VL++GM GLGVEIAKN+IL+GVKSVT+ D+ +
Sbjct: 2    SVEIDEGFYSRQLYVLGHDGMHRMGTASVLVAGMGGLGVEIAKNVILSGVKSVTVQDQSD 61

Query: 551  VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD 730
                DLSS F   E  +G+NRA+  +Q+L +LN  V +S     L  + L  FQ  V TD
Sbjct: 62   TMWTDLSSQFFLKESHLGQNRAMCCIQQLCDLNPRVRVSAHMGPLDHDLLLQFQVVVLTD 121

Query: 731  IRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVL--DVDGEDPRTGIIA 904
              L+    F D+CH H   I  +  +  GLFG +FCDFG EF +L   +  + P+  +I 
Sbjct: 122  SSLDDQKGFGDFCHAH--GIQLVVADTKGLFGQLFCDFGEEFELLYDSIFSKKPKP-VIV 178

Query: 905  SISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTT 1084
             +  +NP +V C  +      DG ++ FSEV+GMTELN   P  IK   P SF+I  DT+
Sbjct: 179  DLWQENPGVVLCAGECPHGLSDGAVVSFSEVQGMTELNSAGPMAIKYLSPCSFSI-CDTS 237

Query: 1085 KYTAYEGGGIVTQVKEPKVLKFKPLRETL 1171
             ++ Y+ GG+ T   EP   KFKPLRE L
Sbjct: 238  DFSEYKCGGVAT--VEPD--KFKPLREAL 262



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
 Frame = +2

Query: 467 GMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQ 631
           G   +G E+ KN+ L G+ +     VT+ D   +E  +L+  F+F   D+GK+++  + +
Sbjct: 451 GAGAIGCELLKNIALIGLGAGGGGLVTVTDMDFIEKSNLNRQFLFRSQDIGKSKSKIAAK 510

Query: 632 KLQELNNSVIISTLTNELSKE 694
            ++E+N  + I+   N L  E
Sbjct: 511 AVREMNPQMNITDHQNRLDPE 531



>pir|T30812|T30812 ubiquitin-protein ligase (EC 6.3.2.19) - Fugu
            rubripes  (fragment)
          Length = 891

 Score =  198 bits (503), Expect = 2e-49
 Identities = 117/269 (43%), Positives = 161/269 (59%), Gaps = 2/269 (0%)
 Frame = +2

Query: 371  SPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
            S +IDE  +SRQL V G + M R+  ++VL++GM GLGVEIAKN+IL+GVKSVT+ D+ +
Sbjct: 2    SVEIDEGFYSRQLYVLGHDGMHRMGTASVLVAGMGGLGVEIAKNVILSGVKSVTVQDQSD 61

Query: 551  VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD 730
                DLSS F   E  +G+NRA+  +Q+L +LN  V +S     L  + L  FQ  V TD
Sbjct: 62   TMWTDLSSQFFLKESHLGQNRAMCCIQQLCDLNPRVRVSAHMGPLDHDLLLQFQVVVLTD 121

Query: 731  IRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVL--DVDGEDPRTGIIA 904
              L+    F D+CH H   I  +  +  GLFG +FCDFG EF +L   +  + P+  +I 
Sbjct: 122  SSLDDQKGFGDFCHAH--GIQLVVADTKGLFGQLFCDFGEEFELLYDSIFSKKPKP-VIV 178

Query: 905  SISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTT 1084
             +  +NP +V C  +      DG ++ FSEV+GMTELN   P  IK   P SF+I  DT+
Sbjct: 179  DLWQENPGVVLCAGECPHGLSDGAVVSFSEVQGMTELNSAGPMAIKYLSPCSFSI-CDTS 237

Query: 1085 KYTAYEGGGIVTQVKEPKVLKFKPLRETL 1171
             ++ Y+ GG+ T   EP   KFKPLRE L
Sbjct: 238  DFSEYKCGGVAT--VEPD--KFKPLREAL 262



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 23/81 (28%), Positives = 44/81 (54%), Gaps = 5/81 (6%)
 Frame = +2

Query: 467 GMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQ 631
           G   +G E+ KN+ L G+ +     VT+ D   +E  +L+  F+F   D+GK+++  + +
Sbjct: 451 GAGAIGCELLKNIALIGLGAGGGGLVTVTDMDFIEKSNLNRQFLFRSQDIGKSKSKIAAK 510

Query: 632 KLQELNNSVIISTLTNELSKE 694
            ++E+N  + I+   N L  E
Sbjct: 511 AVREMNPQMNITDHQNRLDPE 531



>pir|A48195|A48195 ubiquitin-protein ligase E1 homolog - human
          Length = 1058

 Score =  197 bits (501), Expect = 4e-49
 Identities = 109/268 (40%), Positives = 158/268 (58%), Gaps = 1/268 (0%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +DE+L+SRQL V G   M+R+ G+ VL+SG++GLG E+AKNL+L GV S+TLHD      
Sbjct: 57   LDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCW 116

Query: 560  WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             DL++ F+ SE D+ ++RA AS + L +LN +V +   T +++++ L DFQ  V T  +L
Sbjct: 117  SDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQVVVLTAAKL 176

Query: 740  EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
            E+ ++    CH H   + F+  +   L G +FCDFG +FTV D    +P T  I  IS  
Sbjct: 177  EEQLKVGTLCHKH--GVCFLAADTRALVGQLFCDFGEDFTVQDPTEAEPLTAAIQHISQG 234

Query: 920  NPALVACVDDERLE-FQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTA 1096
            +P ++          F+DGDL+ FS + GM ELND  PR I      S  I  DTT ++ 
Sbjct: 235  SPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEI-GDTTTFSR 293

Query: 1097 YEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            Y  GG +T+VK PK ++ K L   L  P
Sbjct: 294  YLRGGAITEVKRPKTVRHKSLDTALLQP 321



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 5/118 (4%)
 Frame = +2

Query: 347 SPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS 526
           SP DC+      D      Q+AV+G     +L   + L+ G   +G E+ K   L G+ +
Sbjct: 450 SPEDCALRGSRYDG-----QIAVFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGA 504

Query: 527 -----VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
                +T+ D  ++E  +LS  F+F   DVG+ +A  +    + LN  + +  LT  L
Sbjct: 505 GNSGGLTVVDMDHIERSNLSRQFLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPL 562



>gb:AY597816_1431786 Bos taurus ubiquitin E1-like enzyme mRNA,
            complete cds.
          Length = 998

 Score =  195 bits (495), Expect = 2e-48
 Identities = 111/277 (40%), Positives = 159/277 (57%), Gaps = 1/277 (0%)
 Frame = +2

Query: 353  IDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVT 532
            +D    S  +D++L+SRQL V G   M+R+ G+ VL+SG++GLG E+AKNL+L GV S+T
Sbjct: 1    MDTLETSKLLDKELYSRQLYVLGLPAMQRIQGAKVLLSGLQGLGAEVAKNLVLMGVGSLT 60

Query: 533  LHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQ 712
            LHD       DL++ F+ SE D+G++RA AS + L ELN +V +S  T +++K+ L DFQ
Sbjct: 61   LHDPHPTCWSDLAAQFLLSEQDLGRSRAEASQKLLAELNGAVQVSVYTGDITKDLLLDFQ 120

Query: 713  AAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRT 892
              V T  RLE+ +     CH H   + F+  +  GL G +FCDFG  FTV D    +P T
Sbjct: 121  VVVLTASRLEEQLRVGTLCHEH--GVCFLVADTRGLVGQLFCDFGENFTVQDPTEAEPLT 178

Query: 893  GIIASISNDNPALVACVDDERL-EFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTI 1069
              I  IS  +P ++   ++     F  GD + FS + GM ELN   PR +      +  I
Sbjct: 179  ANIQHISQGSPGILTLREEAGTHHFHTGDWVTFSGIEGMVELNGCDPRPLHVREDGTLEI 238

Query: 1070 EEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
              DTT ++ Y  GG VT+VK  K +  +PL   L  P
Sbjct: 239  -GDTTAFSCYLRGGAVTEVKRAKTVSHEPLDTALLQP 274



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 5/99 (5%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q AV+G     +L   + L+ G   +G E+ K+  L G+ +     VT+ D  +VEL +L
Sbjct: 417 QTAVFGTNFQEKLSHQHYLLVGAGAVGCELLKSFALMGLGAGDGGGVTVADMDHVELSNL 476

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
           S  F+F   D+ + +A  + +  + LN  + ++ L  +L
Sbjct: 477 SRQFLFRSQDIHRKKAEVAAEATRRLNADLQVTPLNLQL 515



>gb:AE014188_968056 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014848_1229448 Plasmodium falciparum 3D7
            chromosome 12, section 5 of 9 of the complete sequence.
          Length = 1140

 Score =  169 bits (427), Expect = 1e-40
 Identities = 108/302 (35%), Positives = 163/302 (53%), Gaps = 17/302 (5%)
 Frame = +2

Query: 326  RRTENGKSPIDCSRNSPD--------------IDEDLHSRQLAVYGRETMRRLFGSNVLI 463
            +RT+    PI+  ++S                ID DL+SRQL  YG + M +L   N+LI
Sbjct: 11   QRTDESVKPIEFDKSSESWKRSDCLEKMTENKIDTDLYSRQLGTYGFDLMNKLVKLNILI 70

Query: 464  SGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKN--RALASVQKL 637
              +KG+G+E AKNLIL+G +SV ++D    ++ D+  NF  +E DV     R+ A +++L
Sbjct: 71   INVKGVGLECAKNLILSGPQSVCIYDNDICDISDIGVNFYINEKDVEDKSCRSDAVLKEL 130

Query: 638  QELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHN-HQPPIAFIKTEVC 814
            QELNN V I      + K  L +F   +  DI  E  +++++      +  IAF+   + 
Sbjct: 131  QELNNYVHIYNYKGTIEKNWLENFDVVICCDINKEDLIKYNNMIRGIDKKRIAFLSCNIY 190

Query: 815  GLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSE 994
            GL G +F DF  EF   D +GE  ++  ++ IS +    V+   D+   F++GD + FS 
Sbjct: 191  GLCGYIFVDFNKEFICYDSNGEQVKSCNVSKISKELEGKVSFDFDKTSPFEEGDYVQFSN 250

Query: 995  VRGMTELNDGKPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLK 1174
            V GMTE+N+ K  KIKN + Y+F I  DT+ Y+ Y  GGI TQVK+   L F P      
Sbjct: 251  VEGMTEINN-KIYKIKNLKKYTFEI-GDTSLYSEYIKGGICTQVKKHLKLNFYPYEYICV 308

Query: 1175 DP 1180
            +P
Sbjct: 309  NP 310



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 32/132 (24%), Positives = 60/132 (45%), Gaps = 25/132 (18%)
 Frame = +2

Query: 407 LAVYGRETMRRLFGSNVLISGMKGLGVEIAK-------------------------NLIL 511
           + V+G+   ++L   NV + G   LG E AK                         NL  
Sbjct: 490 ITVFGKSFQKKLNNLNVFLVGSGALGCEYAKLFSLLDMCTRNSEQNTNLNQNNIDNNLAC 549

Query: 512 AGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK 691
            G   +T+ D  N+E+ +L+  F+F  + VGK+++L S + +++ NN++ + +L  ++  
Sbjct: 550 CG--KLTITDNDNIEVSNLNRQFLFRREHVGKSKSLVSSEIIKKKNNNMHVQSLETKVGA 607

Query: 692 EQLSDFQAAVFT 727
           E    F    +T
Sbjct: 608 ENEHIFNEEFWT 619



>gb:AC117076_1207861 Dictyostelium discoideum chromosome 2 map
            3323568-3470138 strain AX4, complete sequence.
          Length = 1156

 Score =  162 bits (411), Expect = 1e-38
 Identities = 105/294 (35%), Positives = 160/294 (54%), Gaps = 27/294 (9%)
 Frame = +2

Query: 380  IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
            +D+ L+SRQ  V G   M +L   +V +SG+ G+GVEIAKN+ILAG+KS+TLHD     +
Sbjct: 29   LDDSLYSRQRYVLGDFAMSKLSKGDVFLSGLGGVGVEIAKNIILAGIKSITLHDTKEASI 88

Query: 560  WDLSSNFVFSEDDVGK--NRALASVQKLQELNNSVIISTLTN-ELS------KEQLSDFQ 712
            +DLSS F  + + V +  NRA+ S   LQELN  V ++T+TN  LS         L  F+
Sbjct: 89   YDLSSQFYINPEHVDQKLNRAIISQSHLQELNPYVKVNTITNLSLSDLILNNSNSLLQFK 148

Query: 713  AAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRT 892
              + T+  L   ++ +++C  +   I FI  +  GL G VF DFG EF V D +GE  + 
Sbjct: 149  CIILTESNLNDQIKINEFCKEND--IKFIVPDCYGLGGWVFNDFGDEFKVYDKNGEKLKE 206

Query: 893  GIIASIS----NDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPR---KIKNAR 1051
              I++IS    N N  ++ C+++    F++ D I F E+ GM +LND   +    I N+ 
Sbjct: 207  VFISNISISTQNPNQLIINCMENHIHGFEENDYIQFKEIIGMDQLNDQSKKFKINIINSN 266

Query: 1052 PYSFTIEE-----------DTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
             +S  + +           D      Y+ GGI  Q K  ++LKFK L +++ +P
Sbjct: 267  CFSINLNDNSNNNNSNSNIDIKSLPPYQRGGIAIQTKSIELLKFKSLNKSMIEP 320



>gb:MMUBE1Y2_2124228 Mus musculus ubiquitin-activating enzyme
           (Ube1y) gene, exons 5-6, and partial cds.
          Length = 179

 Score =  160 bits (404), Expect = 6e-38
 Identities = 85/170 (50%), Positives = 111/170 (65%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           DIDE L+SRQL V G E M+ L  S+VLISG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 8   DIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVTLHDQGIAQ 67

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
             DLSS     E+D+GKNRA  S  +L ELN+ V +   T  L +E LS FQ  V T+  
Sbjct: 68  WADLSSQVCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTP 127

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDP 886
           LE  ++  ++CH+H   I  +  +  GL G +FCDFG E  + D +GE P
Sbjct: 128 LEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQP 175



>pir|I49380|I49380 ubiquitin-activating enzyme - mouse (fragment)
          Length = 179

 Score =  160 bits (404), Expect = 6e-38
 Identities = 85/170 (50%), Positives = 111/170 (65%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           DIDE L+SRQL V G E M+ L  S+VLISG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 8   DIDESLYSRQLYVLGHEAMKHLQASSVLISGLQGLGVEIAKNIILGGVKAVTLHDQGIAQ 67

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
             DLSS     E+D+GKNRA  S  +L ELN+ V +   T  L +E LS FQ  V T+  
Sbjct: 68  WADLSSQVCLREEDIGKNRAEISQPRLAELNSYVPVFAYTGPLIEEFLSGFQVVVLTNTP 127

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDP 886
           LE  ++  ++CH+H   I  +  +  GL G +FCDFG E  + D +GE P
Sbjct: 128 LEYQLQVGEFCHSH--GIKLVVADTRGLVGQLFCDFGEEMILTDSNGEQP 175



>pir|T20004|T20004 hypothetical protein C47E12.5 - Caenorhabditis
            elegans>gb:CEC47E12_1361341 Caenorhabditis elegans cosmid
            C47E12, complete sequence.
          Length = 1113

 Score =  157 bits (398), Expect = 3e-37
 Identities = 98/288 (34%), Positives = 152/288 (52%), Gaps = 1/288 (0%)
 Frame = +2

Query: 320  NGRRTENGKSPIDCSRNSPDI-DEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIA 496
            +G + +   +      NS ++ D++L+SRQ+   G   M  L  ++VLISG+  +GVEIA
Sbjct: 82   DGEKMDTSNNAGGVGGNSDELLDKNLYSRQIYTLGESAMVNLRTASVLISGLGSVGVEIA 141

Query: 497  KNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLT 676
            KNLIL GV+ VT+HD    +  DLS+ +   + DVG NRA +  ++L ELN+SV +   T
Sbjct: 142  KNLILGGVRHVTIHDTKLAKWSDLSAQYYLRDADVGHNRATSCYERLAELNDSVNVQVST 201

Query: 677  NELSKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEF 856
            +EL++E +  F   V TD       +   +   H   I  + T+  G+F  +F DFG  F
Sbjct: 202  DELTEEFVKTFDLVVLTDAARTAQRQIAAWTRAHNRRI--LITDARGVFSYIFNDFGDNF 259

Query: 857  TVLDVDGEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRK 1036
             + D  GE  R   I  I +     V  +++     +DGD + FSEV+G+TE+N  +P K
Sbjct: 260  RIDDATGEQVREFFIEHI-DKTTGEVTTLENLFHGLEDGDHVTFSEVKGLTEINGCEPLK 318

Query: 1037 IKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            I       F I +    ++ Y+ GG   QVK P  +   P  ++L +P
Sbjct: 319  ITVKNASKFNIGDFAVSFSDYKEGGRCRQVKVPTSVSHVPFEKSLVEP 366



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 5/115 (4%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS-----VTLHDEGNVELWDL 568
           Q AV+G      LF     + G   +G E+ KNL + GV       + + D   +E+ +L
Sbjct: 503 QAAVFGWPYQECLFRQRWFVVGAGAIGCELLKNLSMMGVACGEGGLIKITDMDQIEISNL 562

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
           +  F+F   DVG  ++  + + +   N+ V I  L   +  E    F    F ++
Sbjct: 563 NRQFLFRRRDVGGKKSECAARAVTAFNSDVRIEALAERVGLETEHIFNDEFFGEL 617



>gb:CNS07EGA_1373003 chromosome III of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).
          Length = 991

 Score =  142 bits (358), Expect = 1e-32
 Identities = 98/284 (34%), Positives = 148/284 (52%), Gaps = 15/284 (5%)
 Frame = +2

Query: 377  DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
            DIDE L+SRQL V G+E M+++ GS VL+ G+ GLG E+ KN+ LAG+  V L D+  V 
Sbjct: 8    DIDESLYSRQLYVVGKEAMKKMMGSKVLVMGLDGLGQEVVKNVCLAGISKVALFDDRAVS 67

Query: 557  LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQA---AVFT 727
              DL S F   ++D+GK R  + V + + +N  V +  +++  S E      A   +   
Sbjct: 68   EEDLCSGFYLRKEDIGKPRDASVVGRFRSMNEYVDVDVVSDVNSFEGYDIVVACNESYGE 127

Query: 728  DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIAS 907
             IRL + M   D C        FI  +V GLF  VFCDFG EF  +D  GE P +G+I  
Sbjct: 128  QIRLNE-MARKDGC-------MFIGCQVRGLFSQVFCDFGAEFVCVDRTGEIPASGMIND 179

Query: 908  ISNDNPALVACVDDERLEFQDGDLIVFSEVRGMTELNDGKPRKIKNARPYSFTIE----- 1072
            IS D   ++  VD +R   +D D+I  ++     +  +GK  ++K   P    ++     
Sbjct: 180  ISED--GVMTVVDGQRHNLEDYDIIKITQ----CDEYEGKYFRVKAVSPTQVMLQSIDGV 233

Query: 1073 ---EDTTKYTAYE----GGGIVTQVKEPKVLKFKPLRETLKDPG 1183
               E+  ++ A +     GG   Q K+P ++ FKPL  T+ +PG
Sbjct: 234  RMFEEEMEFKAEKFKPVYGGDFEQQKKPIMISFKPLGRTIDEPG 277



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 6/109 (5%)
 Frame = +2

Query: 353 IDCSRNSPDIDEDLHSR---QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVK 523
           +D   N P+ D   + R    +   G+  + RLFG +V + G   +G E  KN+++ G+ 
Sbjct: 379 VDVIPNDPEDDGRDYGRYGPMVRCLGKRCVERLFGLHVFMVGAGAIGCEHLKNMVMCGIG 438

Query: 524 S---VTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVI 661
           S   +++ D   +E  +L+  F+F   DV   +A  +V++   LN   +
Sbjct: 439 SNGRISVTDMDAIEQSNLNRQFLFRSGDVSSMKAEIAVREAMLLNEDFL 487



>gb:AL513366_1928880 Human DNA sequence from clone CTD-2522E6 on
           chromosome X Contains the RGN gene for regucalcin
           (senescence marker protein-30) (RC, SMP30), the gene for
           neuronal protein 17.3 (P17.3), the RBM10 gene for RNA
           binding motif protein 10 (MGC997, MGC1132, DXS8237E,
           KIAA0122), an inositol 1,3,4-triphosphate 5/6 kinase
           (ITPK1) pseudogene, the UBE1 gene for
           ubiquitin-activating enzyme E1 (A1S9T and BN75
           temperature sensitivity complementing) (A1S9, A1ST,
           GXP1, A1S9T, UBE1X, MGC4781), the 5' UTR of the PCTK1
           gene for PCTAIRE protein kinase 1 and five CpG islands,
           complete sequence.
          Length = 234

 Score =  139 bits (350), Expect = 1e-31
 Identities = 71/133 (53%), Positives = 93/133 (69%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 100 DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 159

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
             DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS FQ  V T+  
Sbjct: 160 WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTP 219

Query: 737 LEKAMEFDDYCHN 775
           LE  +   ++CHN
Sbjct: 220 LEDQLRVGEFCHN 232



>gb:AL513366_1928883 Human DNA sequence from clone CTD-2522E6 on
           chromosome X Contains the RGN gene for regucalcin
           (senescence marker protein-30) (RC, SMP30), the gene for
           neuronal protein 17.3 (P17.3), the RBM10 gene for RNA
           binding motif protein 10 (MGC997, MGC1132, DXS8237E,
           KIAA0122), an inositol 1,3,4-triphosphate 5/6 kinase
           (ITPK1) pseudogene, the UBE1 gene for
           ubiquitin-activating enzyme E1 (A1S9T and BN75
           temperature sensitivity complementing) (A1S9, A1ST,
           GXP1, A1S9T, UBE1X, MGC4781), the 5' UTR of the PCTK1
           gene for PCTAIRE protein kinase 1 and five CpG islands,
           complete sequence.
          Length = 173

 Score =  121 bits (303), Expect = 3e-26
 Identities = 63/111 (56%), Positives = 81/111 (72%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 63  DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 122

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF 709
             DLSS F   E+D+GKNRA  S  +L ELN+ V ++  T  L ++ LS F
Sbjct: 123 WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGF 173



>gb:AY684131_1622186 Vitis vinifera ubiquitin-activating enzyme mRNA,
            partial cds.
          Length = 188

 Score =  120 bits (302), Expect = 4e-26
 Identities = 57/68 (83%), Positives = 60/68 (88%)
 Frame = +2

Query: 1001 GMTELNDGKPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDP 1180
            GMTELNDGKPRKIKNARPYSFT+EEDTT +  YE GGIVTQVK+PKVL FKPLRE L DP
Sbjct: 1    GMTELNDGKPRKIKNARPYSFTLEEDTTNFGTYEKGGIVTQVKQPKVLNFKPLREALSDP 60

Query: 1181 GDXLLSDF 1204
            GD LLSDF
Sbjct: 61   GDFLLSDF 68



>gb:AL513366_1928881 Human DNA sequence from clone CTD-2522E6 on
           chromosome X Contains the RGN gene for regucalcin
           (senescence marker protein-30) (RC, SMP30), the gene for
           neuronal protein 17.3 (P17.3), the RBM10 gene for RNA
           binding motif protein 10 (MGC997, MGC1132, DXS8237E,
           KIAA0122), an inositol 1,3,4-triphosphate 5/6 kinase
           (ITPK1) pseudogene, the UBE1 gene for
           ubiquitin-activating enzyme E1 (A1S9T and BN75
           temperature sensitivity complementing) (A1S9, A1ST,
           GXP1, A1S9T, UBE1X, MGC4781), the 5' UTR of the PCTK1
           gene for PCTAIRE protein kinase 1 and five CpG islands,
           complete sequence.
          Length = 195

 Score =  114 bits (284), Expect = 5e-24
 Identities = 58/94 (61%), Positives = 72/94 (76%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           DIDE L+SRQL V G E M+RL  S+VL+SG++GLGVEIAKN+IL GVK+VTLHD+G  +
Sbjct: 100 DIDEGLYSRQLYVLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQ 159

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
             DLSS F   E+D+GKNRA  S  +L ELN+ V
Sbjct: 160 WADLSSQFYLREEDIGKNRAEVSQPRLAELNSYV 193



>gb:LMFL6586_1388304 Leishmania major Friedlin chromosome 23 cosmid
            L6586.
          Length = 1044

 Score =  105 bits (263), Expect = 1e-21
 Identities = 66/213 (30%), Positives = 110/213 (51%)
 Frame = +2

Query: 392  LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
            L+SRQ  V G ET  +   ++VL+ G  GL  EI KN++L GVKSV + D+  V + DL 
Sbjct: 11   LYSRQEYVVGSETQAKYGSTHVLVVGATGLSAEIIKNVVLTGVKSVKVLDDAVVTIEDLG 70

Query: 572  SNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAM 751
            +NF    DDVGK R  A  Q  +ELN  V +S+++ +     +      ++T+       
Sbjct: 71   TNFFLRPDDVGKARGAAVAQAAKELNRFVEVSSVSGD-PLLHIPAVHVVIYTNAYTSTLA 129

Query: 752  EFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISNDNPAL 931
              +     ++  + FI  E  G+ G +F D G    ++D DGED  T ++ ++S+D   L
Sbjct: 130  AANKVARENK--VKFISCESRGVCGCIFVDGGESLDIVDTDGEDTVTCVVTAMSSD--GL 185

Query: 932  VACVDDERLEFQDGDLIVFSEVRGMTELNDGKP 1030
            V   +++  E + G  + F+ +  + + N  +P
Sbjct: 186  VTLHEEKNHECEIGSKVYFTGLTELPQANTTEP 218



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 26/100 (26%), Positives = 47/100 (47%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           ++ Q AV G      L      I G   LG E+ KN+ L G   V++ D   +E+ +LS 
Sbjct: 420 YAGQEAVLGHAFQEYLRQQKAFIVGAGALGCELIKNVALMGFGEVSITDMDTIEMSNLSR 479

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKE 694
            F+F    +G+ +++ + +    +N  V I+    ++  E
Sbjct: 480 QFLFRNHHIGRPKSVVAAEAAGHINADVKITAYEAKMGPE 519



>gb:BC079411_2107524 Rattus norvegicus ubiquitin-like 1 (sentrin)
           activating enzyme E1A (predicted), mRNA (cDNA clone
           MGC:94951 IMAGE:7113315), complete cds.
          Length = 349

 Score =  102 bits (254), Expect = 2e-20
 Identities = 60/154 (38%), Positives = 85/154 (55%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VLI GMKGLG EIAKNLILAGVK +T+ D   V   DL +
Sbjct: 22  YDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDLGA 81

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     ++F A   T    + 
Sbjct: 82  QFLIRTGSVGQNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTEFDAVCLTCCSKDV 141

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 142 IIKVDQICHRNS--IKFFTGDVFGYHGYTFANLG 173



>sp|Q9R1T2|SAE1_MOUSE Ubiquitin-like 1 activating enzyme E1A (SUMO-1
           activating enzyme subunit 1).>gb:AK010313_1155670 Mus
           musculus ES cells cDNA, RIKEN full-length enriched
           library, clone:2400010M20 product:ubiquitin-like 1
           (sentrin) activating enzyme E1A, full insert
           sequence.>gb:AK087556_1174976 Mus musculus 0 day neonate
           eyeball cDNA, RIKEN full-length enriched library,
           clone:E130319M10 product:ubiquitin-like 1 (sentrin)
           activating enzyme E1A, full insert
           sequence.>gb:AK090012_1176095 Mus musculus B lymphocyte
           B cells CRL-1669 BCL1 Clone 13.20-3B3 cDNA, RIKEN
           full-length enriched library, clone:G430060A02
           product:ubiquitin-like 1 (sentrin) activating enzyme
           E1A, full insert sequence.>gb:AB024303_2044308 Mus
           musculus mRNA similar to human Sua1, complete
           cds.>gb:BC068164_2106034 Mus musculus ubiquitin-like 1
           (sentrin) activating enzyme E1A, mRNA (cDNA clone
           MGC:93013 IMAGE:30359189), complete cds.
          Length = 350

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 59/154 (38%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VLI GMKGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 23  YDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGA 82

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 83  QFLIQTGSVGRNRAEASLERAQNLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSRDV 142

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 143 IIKVDQICHRNS--IKFFTGDVFGYHGYTFANLG 174



>gb:AY099426_2512340 Xenopus laevis SUMO-1 activating enzyme E1 N
           subunit (Aos) mRNA, Aos-1 allele, complete
           cds.>gb:BC086263_2564836 Xenopus laevis SUMO-1
           activating enzyme E1 N subunit, mRNA (cDNA clone
           MGC:78909 IMAGE:4175466), complete cds.
          Length = 344

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ GM+GLG E+AKNLILAGVK++TL D   V   D  +
Sbjct: 17  YDRQIRLWGLEAQKRLRTSRVLLVGMRGLGAEVAKNLILAGVKALTLLDHEQVSSEDSRA 76

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLT---NELSKEQLSDFQAAVFTDIRLEK 745
            F+     +G+NRA AS+ + + LN  V +   T   N+ S +  + F     T    + 
Sbjct: 77  QFLIPSGSLGQNRAEASLNRARNLNPMVSVEADTENINQKSDDFFTQFDVVCLTSCPSDL 136

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            +  +  CH H   I F   +V G  GS+F D G
Sbjct: 137 LVRVNHICHKHN--IKFFTGDVYGYHGSMFADLG 168



>gb:AF090385_1882423 Homo sapiens SUMO-1-activating enzyme E1 N
           subunit (SUA1) mRNA, complete cds.
          Length = 346

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:AX880028_1478095 Sequence 14933 from Patent EP1074617.
          Length = 299

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:AX878852_1477583 Sequence 13757 from Patent EP1074617.
          Length = 299

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDMEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:CR925978_1185505 Pongo pygmaeus mRNA; cDNA DKFZp459I1120 (from
           clone DKFZp459I1120).
          Length = 346

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:CR861251_1185259 Pongo pygmaeus mRNA; cDNA DKFZp459P123 (from
           clone DKFZp459P123).
          Length = 346

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>sp|Q9UBE0|SAE1_HUMAN Ubiquitin-like 1 activating enzyme E1A (SUMO-1
           activating enzyme subunit 1).>gb:CR861062_1185085 Pongo
           pygmaeus mRNA; cDNA DKFZp459N2015 (from clone
           DKFZp459N2015).>gb:AF046025_1878894 Homo sapiens
           activation of Sentrin/SUMO protein AOS1 (AOS1) mRNA,
           complete cds.>gb:AF110956_1884303 Homo sapiens SUMO-1
           activating enzyme subunit 1 (SAE1) mRNA, complete
           cds.>gb:BC000344_1966634 Homo sapiens SUMO-1 activating
           enzyme subunit 1, mRNA (cDNA clone MGC:8572
           IMAGE:2823028), complete cds.>gb:BC003611_1968923 Homo
           sapiens SUMO-1 activating enzyme subunit 1, mRNA (cDNA
           clone MGC:1437 IMAGE:2988252), complete
           cds.>gb:BC018271_1976477 Homo sapiens SUMO-1 activating
           enzyme subunit 1, mRNA (cDNA clone MGC:16956
           IMAGE:3452340), complete cds.>gb:BT007290_1990728 Homo
           sapiens SUMO-1 activating enzyme subunit 1 mRNA,
           complete cds.
          Length = 346

 Score = 97.1 bits (240), Expect = 7e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:CR860370_1184443 Pongo pygmaeus mRNA; cDNA DKFZp459A1012 (from
           clone DKFZp459A1012).
          Length = 346

 Score = 96.7 bits (239), Expect = 9e-19
 Identities = 57/154 (37%), Positives = 83/154 (53%), Gaps = 3/154 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDVGKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFG 847
            ++ D  CH +   I F   +V G  G  F + G
Sbjct: 139 IVKVDQICHKNS--IKFFTGDVFGYHGYTFANLG 170



>gb:AF161489_1150382 Homo sapiens HSPC140 mRNA, complete cds.
          Length = 346

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 59/164 (35%), Positives = 86/164 (52%), Gaps = 4/164 (2%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E  +RL  S VL+ G+KGLG EIAKNLILAGVK +T+ D   V   D  +
Sbjct: 19  YDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGA 78

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+     VG+NRA AS+++ Q LN  V +   T ++ K+     + F A   T    + 
Sbjct: 79  QFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDV 138

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGP-EFTVLDVD 874
            ++ D  CH +   I F   +  G  G  F + G  EF   + D
Sbjct: 139 IVKVDQICHKNS--IKFFTGDAFGYHGYTFANLGEHEFVEEETD 180



>gb:AF218863_1252106 Drosophila melanogaster Smt3 activating enzyme
           1 (SAE1) mRNA, complete cds.
          Length = 337

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/168 (33%), Positives = 86/168 (51%), Gaps = 3/168 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           + + +L+ RQ+ ++G E+ +RL  + +LI+G+ GLG EI KN+IL+GV SV L D+ +V 
Sbjct: 16  EAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVT 75

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST---LTNELSKEQLSDFQAAVFT 727
             D  S F+   + +  NRA AS+ + + LN  V IS       E + E    F   V  
Sbjct: 76  EEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVVN 135

Query: 728 DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDV 871
               E+ +  D  C +    + FI T+V G FG  F        V DV
Sbjct: 136 GATNEELLRIDTICRD--LGVKFIATDVWGTFGFYFASLQKHSYVEDV 181



>gb:AF193554_1249726 Drosophila melanogaster ubiquitin-like protein
           activating enzyme N subunit mRNA, complete cds.
          Length = 337

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/168 (33%), Positives = 86/168 (51%), Gaps = 3/168 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           + + +L+ RQ+ ++G E+ +RL  + +LI+G+ GLG EI KN+IL+GV SV L D+ +V 
Sbjct: 16  EAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVT 75

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST---LTNELSKEQLSDFQAAVFT 727
             D  S F+   + +  NRA AS+ + + LN  V IS       E + E    F   V  
Sbjct: 76  EEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVVN 135

Query: 728 DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDV 871
               E+ +  D  C +    + FI T+V G FG  F        V DV
Sbjct: 136 GATNEELLRIDTICRD--LGVKFIATDVWGTFGFYFASLQKHSYVEDV 181



>gb:AE014297_1139221 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003696_1221214 Drosophila melanogaster
           chromosome 3R, section 34 of 118 of the complete
           sequence.>gb:AY069589_1294319 Drosophila melanogaster
           LD33652 full length cDNA.
          Length = 337

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 57/168 (33%), Positives = 86/168 (51%), Gaps = 3/168 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           + + +L+ RQ+ ++G E+ +RL  + +LI+G+ GLG EI KN+IL+GV SV L D+ +V 
Sbjct: 16  EAENELYDRQIRLWGLESQKRLRTAKILIAGLCGLGAEITKNIILSGVNSVKLLDDKDVT 75

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST---LTNELSKEQLSDFQAAVFT 727
             D  S F+   + +  NRA AS+ + + LN  V IS       E + E    F   V  
Sbjct: 76  EEDFCSQFLVPRESLNTNRAEASLTRARALNPMVDISADREPLKEKTSEFFGQFDVVVVN 135

Query: 728 DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDV 871
               E+ +  D  C +    + FI T+V G FG  F        V DV
Sbjct: 136 GATNEELLRIDTICRD--LGVKFIATDVWGTFGFYFASLQKHSYVEDV 181



>gb:BC071328_2556070 Danio rerio zgc:86633, mRNA (cDNA clone
           MGC:86633 IMAGE:6893217), complete cds.
          Length = 348

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 58/180 (32%), Positives = 90/180 (50%), Gaps = 3/180 (1%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G +  +RL GS VL+ G++GLG E+AKNLILAGVK +TL D   V      +
Sbjct: 20  YDRQIRLWGLDAQKRLRGSRVLLVGLRGLGAEVAKNLILAGVKGLTLLDHEQVTEESRRA 79

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQ---LSDFQAAVFTDIRLEK 745
            F+   D  G+N A AS+++ Q LN  V +   T  +  +       F A   T    + 
Sbjct: 80  QFLIPVDADGQNHAQASLERAQFLNPMVEVKADTEPVESKPDDFFFQFDAVCLTRCSRDL 139

Query: 746 AMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISNDNP 925
            +  D  C +    I     +V G  G +F D G E+  ++   E P+    ++ +ND P
Sbjct: 140 MVRVDQLCASRN--IKVFCGDVYGYNGYMFSDLGQEYHYVE---EKPKVVKGSNEANDGP 194



>gb:PFMAL13_1191399 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1838

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 56/219 (25%), Positives = 104/219 (47%), Gaps = 14/219 (6%)
 Frame = +2

Query: 377 DIDEDL-------------HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAG 517
           DI+EDL             +SRQ+  +G    +++ GS ++I G+ G+  EI KNL L G
Sbjct: 150 DIEEDLFNSNLNILESEKKYSRQIYTHGYNEEKKIRGSKIIIIGLNGISCEICKNLSLCG 209

Query: 518 VKSVTLHDEGNVELWDLSSNFVFSEDDVGKN-RALASVQKLQELNNSVIISTLTNELSKE 694
           V  + ++D   +   D+ + ++ ++  V +  ++++ V  +Q+LN S  I  +T  L  +
Sbjct: 210 VHEIGIYDNNLLTYEDIDNLYLCNKKLVNEQIKSISCVDNIQKLNESCKIKAITTNL-YD 268

Query: 695 QLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVD 874
            + ++   V  + +    ++ ++YC  ++    FI    CGLFG VF D+G  +   ++D
Sbjct: 269 NILNYDIVVTVNQKTNFNIKLNNYCRENKK--KFICVNTCGLFGRVFIDYGDFYYTNNID 326

Query: 875 GEDPRTGIIASISNDNPALVACVDDERLEFQDGDLIVFS 991
                     +  N N  +        LEF   + IV S
Sbjct: 327 TN-------TTYDNHNNIISDLYKINNLEFLKNNTIVLS 358



>gb:U13875_1401865 Caenorhabditis elegans cosmid C26E6, complete
           sequence.
          Length = 541

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 55/172 (31%), Positives = 87/172 (50%), Gaps = 7/172 (4%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E    +  ++  + G   L  EI K+L+LAGV+S  + D+  VE  D+  
Sbjct: 10  YDRQVRLWGEEGQASIGSTSACVLGSDSLATEILKSLVLAGVQSFYVVDDAKVEQADIGQ 69

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK------EQLSDFQAAVFTDIR 736
           NF    DD+G++RA A+++KL ELN SV  S  +   +       E+L+ F   V  +  
Sbjct: 70  NFFLHADDIGRSRAEATLEKLTELNPSVSGSASSQPPTALAMEDVEKLTTFSVVVAANQN 129

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV-FCDFGPEFTVLDVDGEDPR 889
            E    F    +N + P   IKT   GL G++  C    E T+ +   E+PR
Sbjct: 130 EEIDTTFAKVLYNIRVPFICIKT--FGLIGTIRICI--KEHTIANSHEENPR 177



>gb:CR382131_1664615 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 349

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 47/165 (28%), Positives = 80/165 (48%), Gaps = 4/165 (2%)
 Frame = +2

Query: 362 SRNSPDIDE-DLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLH 538
           + N+   DE  L+ RQ+ ++G E+  R+  S +L+  +  +  EI K+L+LAG+ S+T+ 
Sbjct: 9   TENTISADEVALYDRQIRLWGMESQARMRNSKILLINIGAVANEIVKDLVLAGIGSLTIV 68

Query: 539 DEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN---ELSKEQLSDF 709
           D       D  + F   E D  KNR  +++ ++ +LN  V + T+     +L KE +  F
Sbjct: 69  DAHVTSDADFGAQFFVQEGDENKNRGESALPRISQLNRHVTVETVDKVILDLDKEFVGKF 128

Query: 710 QAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
              V T   L++ +     C   +     I   + GLF   F DF
Sbjct: 129 DLVVITQATLKEIVHITTLC--EETDTTNICVGISGLFSYAFIDF 171



>gb:LES011418_1684456 Lycopersicon esculentum mRNA for ubiquitin
           activating enzyme.
          Length = 317

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 49/156 (31%), Positives = 77/156 (49%), Gaps = 6/156 (3%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           ++ RQ+ V+G +  RRL  S++ +SG+KG  +E  KN++LAGV S+TL+D+  V    LS
Sbjct: 15  IYDRQIRVWGVDAQRRLSKSHIFVSGLKGTVIEFCKNIVLAGVGSLTLNDDRLVTEELLS 74

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELSK---EQLSDFQAAVFTDI 733
           +NF+   D+    GK+ A    + L++ N  V +S     L+    E    F A V +  
Sbjct: 75  ANFLVPSDENVTSGKSLAELCCESLKDFNPMVTVSVEKGVLANFHVEFFQKFDAVVISCC 134

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
            L      +  C      +AF   E     G +F D
Sbjct: 135 SLLTKKSVNAKCRKLPRRVAFYSVECRDSCGEIFVD 170



>gb:AF510524_1807241 Arabidopsis thaliana SUMO activating enzyme 1b
           (SAE1b) mRNA, complete cds.
          Length = 320

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/156 (32%), Positives = 74/156 (47%), Gaps = 6/156 (3%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ V+G    RRL  S+VL+SG+KG   E  KN++LAGV SVTL D+  V     +
Sbjct: 13  LYDRQIRVWGAGAQRRLSKSHVLVSGIKGTVAEFCKNIVLAGVGSVTLLDDRLVTTEVFN 72

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELSK---EQLSDFQAAVFTDI 733
           +NF+   D+   VGK  A      L++ N  V +S    +LS    +    F   V    
Sbjct: 73  ANFLILPDENAYVGKTVAEICCDSLKDFNPMVHVSIEKGDLSTLGVDFFEKFDVVVIGYS 132

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
                   ++ C N    +AF   +  G  G +F D
Sbjct: 133 SRATKKAVNEKCRNLAKDVAFYTVDCRGSCGEIFVD 168



>gb:AF357838_1790808 Solanum tuberosum ubiquitin activating enzyme
            mRNA, partial cds.
          Length = 132

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 33/44 (75%), Positives = 38/44 (86%)
 Frame = +2

Query: 1073 EDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            ++TT+Y AYE GGIVTQVKEPKVLKF PLR+ + DPGD LLSDF
Sbjct: 4    DNTTEYAAYERGGIVTQVKEPKVLKFNPLRKAISDPGDFLLSDF 47



>gb:AB023037_1515382 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFB16.>gb:AB025619_1516416 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MBA10.>gb:AY091012_1574243 Arabidopsis thaliana
           putative ubiquitin activating enzyme (At5g50680) mRNA,
           complete cds.>gb:AY117230_1579271 Arabidopsis thaliana
           putative ubiquitin activating enzyme (At5g50680) mRNA,
           complete cds.
          Length = 320

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 51/156 (32%), Positives = 74/156 (47%), Gaps = 6/156 (3%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ V+G    RRL  S+VL+SG+KG   E  KN++LAGV SVTL D+  V     +
Sbjct: 13  LYDRQIRVWGAGAQRRLSKSHVLVSGIKGTVAEFCKNIVLAGVGSVTLLDDRLVTTEVFN 72

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELSK---EQLSDFQAAVFTDI 733
           +NF+   D+   VGK  A      L++ N  V +S    +LS    +    F   V    
Sbjct: 73  ANFLILPDENAYVGKTVAEICCDSLKDFNPMVHVSIEKGDLSTLGVDFFEKFDVVVIGYS 132

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
                   ++ C N    +AF   +  G  G +F D
Sbjct: 133 SRATKKAVNEKCRNLAKDVAFYTVDCRGSCGEIFVD 168



>gb:AY086686_1571730 Arabidopsis thaliana clone 26820 mRNA, complete
           sequence.
          Length = 318

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 54/166 (32%), Positives = 79/166 (47%), Gaps = 7/166 (4%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ V+G    RRL  S+VL+SG+KG   E  KN++LAGV SVTL D+  V     +
Sbjct: 13  LYYRQIRVWGAGAQRRLSKSHVLVSGIKGTVAEFCKNIVLAGVGSVTLLDDRLVTTEVFN 72

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELSK---EQLSDFQAAVFTDI 733
           +NF+   D+   VGK  A      L++ N  V +S    +LS    +    F   V    
Sbjct: 73  ANFLILPDENAYVGKTVAEICCDSLKDFNPMVHVSIEKGDLSTLGVDFFEKFDVVVIGYS 132

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF-GPEFTVLD 868
                   ++ C N    +AF   +  G  G +F D    ++T LD
Sbjct: 133 SRATKKAVNEKCRNLAKRVAFYTVDCRGSCGEIFVDLQNYKYTKLD 178



>pir|T19082|T19082 hypothetical protein C08B6.9 - Caenorhabditis
           elegans>gb:CEC08B6_1360220 Caenorhabditis elegans cosmid
           C08B6, complete sequence.
          Length = 343

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 10/164 (6%)
 Frame = +2

Query: 383 DEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELW 562
           ++ ++ RQ+ ++G E   ++  S VLI G K LG E+AK L LAGV  + L D   V+  
Sbjct: 7   EQAIYDRQIRLWGMEAQNKIRNSKVLIIGGKQLGAEVAKTLSLAGVDEMHLVDHRLVDTE 66

Query: 563 DLSSNFVF--SEDDVGKNRALASVQKLQELNNSV--------IISTLTNELSKEQLSDFQ 712
           ++  NF++  S D+    +  AS   L  LN +V        ++S   +E+ +E L+ F 
Sbjct: 67  EIGMNFLYDASVDNSKMTKWAASYNFLYNLNRNVKLFIVEEDVLSKNDSEI-EEYLTKFT 125

Query: 713 AAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDF 844
             V  D   E+  + ++ C  H   I FI   + G  G  F DF
Sbjct: 126 LVVVLDESYERTAKVNNICRKHH--IRFISGAIYGWIGYAFFDF 167



>sp|P79064|RA31_SCHPO DNA damage tolerance protein
           rad31.>pir|T45213|T45213 superoxide dismutase [imported]
           - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC4C5_1717926 S.pombe chromosome I cosmid
           c4C5.>gb:SPRAD31_1722024 S.pombe rad31 gene.
          Length = 307

 Score = 70.5 bits (171), Expect = 7e-11
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 7/157 (4%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ ++G    + L  S VL+     L  EIAKNL+L+G+  + + D   V   D+ 
Sbjct: 13  LYDRQIRLWGFNAQQALKQSRVLLITASPLANEIAKNLVLSGIGKLCVLDSMTVYEKDVE 72

Query: 572 SNFVFSEDDVGKNRALASVQKLQELNNSVIIST---LTNELSKEQLSDFQAAVFTDIRLE 742
             F     D+G+ RA    +KL ELN  V I T   L +E+ + ++S F   + T     
Sbjct: 73  EQFFIEASDIGQLRANVFKKKLHELNPLVEIDTDTSLISEIDEGKISKFSMVIATQ---- 128

Query: 743 KAMEFDDYCHNHQPP----IAFIKTEVCGLFGSVFCD 841
             ++++++C  ++       +F  T   GL+G  FCD
Sbjct: 129 --LDYEEFCRINELTRICNASFYATSCFGLYGFAFCD 163



>gb:CR382132_1666102 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 504

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 51/166 (30%), Positives = 78/166 (46%), Gaps = 9/166 (5%)
 Frame = +2

Query: 362 SRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHD 541
           S + P   +  + RQL ++     R L  ++V + G   +  E  KNLIL  V S T+ D
Sbjct: 10  SDSIPSQKDRKYDRQLRLWAASGQRALEDASVCLLGSSPVATETMKNLILPNVGSYTVVD 69

Query: 542 EGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK---------E 694
            GNV   DLS+NF F  D +GK++A ++   L ELN     S L  + SK         +
Sbjct: 70  GGNVTEDDLSANFFFDSDSIGKSKAQSASLLLNELNKDSTGSYLDQKPSKIVASNLSYFD 129

Query: 695 QLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
           Q S   A+V +  +        +Y ++H  P+  I +   G +G V
Sbjct: 130 QFSIIVASVSSFDKYSDLEALSEYLYSHYIPLVVISS--AGFYGYV 173



>gb:HSM801766_1186432 Homo sapiens mRNA; cDNA DKFZp434P241 (from
           clone DKFZp434P241).>gb:AY197612_1938964 Homo sapiens
           protooncogene protein 1 mRNA, complete
           cds.>gb:BC000480_1966759 Homo sapiens amyloid beta
           precursor protein binding protein 1, 59kDa, mRNA (cDNA
           clone MGC:8690 IMAGE:2964638), complete
           cds.>gb:BC013301_1974031 Homo sapiens amyloid beta
           precursor protein binding protein 1, 59kDa, mRNA (cDNA
           clone MGC:4246 IMAGE:2964638), complete
           cds.>gb:HSU50939_2024670 Human amyloid precursor
           protein-binding protein 1 mRNA, complete
           cds.>gb:HUAC004638_2028715 Homo sapiens Chromosome 16
           BAC clone CIT987SK-A-116A10, complete sequence.
          Length = 534

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 48/150 (32%), Positives = 70/150 (46%), Gaps = 8/150 (5%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           + E  + RQL ++G      L  ++V +      G EI KNL+L G+ S T+ D   V  
Sbjct: 8   LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSG 67

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD--------FQA 715
            D  +NF      +GKNRA A+++ LQELN+ V  S +  E S E L D        F  
Sbjct: 68  EDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFV--EESPENLLDNDPSFFCRFTV 125

Query: 716 AVFTDIRLEKAMEFDDYCHNHQPPIAFIKT 805
            V T +    ++   D   N Q P+   +T
Sbjct: 126 VVATQLPESTSLRLADVLWNSQIPLLICRT 155



>gb:AE010684_265644 Methanosarcina acetivorans str. C2A, section 29
           of 534 of the complete genome.>gb:AE010299_906203
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 247

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 34/108 (31%), Positives = 64/108 (59%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           D++ + +SRQ+ ++G E   +L  S VL++G  GLG  I+  L +AGV  + L D  +VE
Sbjct: 3   DLEREKYSRQILLFGEEGQEKLKNSRVLVAGAGGLGSPISTYLAIAGVGKIILADFDSVE 62

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           L +L+  F+  E D+G+ +  ++ +KL  +N  + + T+   +S+  +
Sbjct: 63  LSNLNRQFLHHEKDIGRAKIESAKEKLLSMNPGIEVETIGEMISESNI 110



>gb:AE016818_1747877 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 363

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 44/153 (28%), Positives = 76/153 (49%), Gaps = 3/153 (1%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ ++G     R+  + VL+     LG E+AKNL+L+G+ S+T+ D       DL 
Sbjct: 34  LYDRQIRLWGMAAQARMRNTRVLLVNFGALGGEVAKNLVLSGIGSLTILDNRVAAAEDLG 93

Query: 572 SNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK---EQLSDFQAAVFTDIRLE 742
           S F+ +E+D+G+ RA     +L+++N  V ++     +++   E  +     V TD    
Sbjct: 94  SQFLLAEEDLGRLRAEVGAARLRDMNPRVSLAVDARNVTEQPAEYFAGHDLVVATDCSRA 153

Query: 743 KAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
              + +  C     P  F    + GL+G VF D
Sbjct: 154 DLEKINAACRARGVP--FYAGGLHGLWGYVFVD 184



>gb:RNU90829_2137903 Rattus norvegicus APP-binding protein 1 mRNA,
           complete cds.
          Length = 534

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/150 (32%), Positives = 71/150 (47%), Gaps = 8/150 (5%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           + E  + RQL ++G      L  ++V +      G EI KNL+L G+ S T+ D   V  
Sbjct: 8   LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSG 67

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD--------FQA 715
            D+ +NF   +  +GKNRA A+++ LQELN+ V  S +  E S E L D        F  
Sbjct: 68  EDVGNNFFLQKCSIGKNRAQAAMEFLQELNSDVSGSFV--EESPENLLDNDPSFFCRFTI 125

Query: 716 AVFTDIRLEKAMEFDDYCHNHQPPIAFIKT 805
            V T +     +   D   N Q P+   +T
Sbjct: 126 VVATQLLESTLLRLADVLWNSQIPLLICRT 155



>pir|F88444|F88444 protein C26E6.8 [imported] - Caenorhabditis
           elegans
          Length = 525

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 34/88 (38%), Positives = 54/88 (61%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E    +  ++  + G   L  EI K+L+LAGV+S  + D+  VE  D+  
Sbjct: 10  YDRQVRLWGEEGQASIGSTSACVLGSDSLATEILKSLVLAGVQSFYVVDDAKVEQADIGQ 69

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSV 658
           NF    DD+G++RA A+++KL ELN SV
Sbjct: 70  NFFLHADDIGRSRAEATLEKLTELNPSV 97



>gb:AE010126_259576 Pyrococcus furiosus DSM 3638, section 1 of 173
           of the complete genome.>gb:AE009950_900357 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 230

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 5/151 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E   +L  +NV + G+ GLG  +A  L  AGV ++ L DE   EL +L+ 
Sbjct: 10  YDRQIMIFGIEGQEKLKKANVAVVGVGGLGSPVAYYLAAAGVGTILLIDEQTPELSNLNR 69

Query: 575 NFVFSEDDVGKN-RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI----RL 739
             +  E+D+ KN + +++  KL+  N+++ I T    LS+E + +  + V   +      
Sbjct: 70  QILHWEEDIEKNPKPISAKWKLERFNSNIKIETFVGRLSEENIDEVLSGVDVIVDCLDNF 129

Query: 740 EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
           E     DD+ H    P+  +   V G +G V
Sbjct: 130 ETRYLLDDFAHKKGIPL--VHGAVEGFYGQV 158



>pir|E71224|E71224 probable HESA protein - Pyrococcus
           horikoshii>gb:BA000001_648686 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 230

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 46/151 (30%), Positives = 79/151 (52%), Gaps = 5/151 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E   +L  + V ++G+ GLG  +A  L+ AGV  V L D+   EL +L+ 
Sbjct: 10  YDRQIMLFGVEGQEKLKRAKVAVAGVGGLGSPVAYYLVAAGVGRVLLIDDQIPELSNLNR 69

Query: 575 NFVFSEDDVGKN-RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI----RL 739
             +  E+DVGKN + L++  KL+  N+ V + T   +L++E +++    V   +      
Sbjct: 70  QILHWEEDVGKNPKPLSAKWKLERFNSDVRVETYVGKLTEENVNEVLDGVDVIVDCLDNF 129

Query: 740 EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
           E     DDY H    P+  +   V G++G V
Sbjct: 130 ETRYLLDDYAHKVGIPL--VHGAVEGMYGQV 158



>pir|D75192|D75192 molybdenum cofactor biosynthesis protein (moeb)
           PAB2302 - Pyrococcus abyssi (strain
           Orsay)>gb:CNSPAX01_848827 Pyrococcus abyssi complete
           genome; segment 1/6.
          Length = 230

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 5/151 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E   +L  + V + G+ GLG  +A  L  AGV  + L DE   EL +L+ 
Sbjct: 10  YDRQIMIFGVEGQEKLKKAKVAVVGVGGLGSPVAYYLTAAGVGRILLIDEQVPELSNLNR 69

Query: 575 NFVFSEDDVGKN-RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI----RL 739
             +  E+D+G+N + L++  KL++ N+ V I T   +L++E + D    V   +      
Sbjct: 70  QILHWEEDLGRNPKPLSAKWKLEKFNSDVKIETFVGKLTEENIEDVLHGVDVIVDCLDNF 129

Query: 740 EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
           E     DDY H    P+  +   V GL+G V
Sbjct: 130 ETRYLLDDYAHKVGIPL--VHGAVEGLYGQV 158



>gb:BC019163_2092821 Mus musculus amyloid beta precursor protein
           binding protein 1, mRNA (cDNA clone MGC:29435
           IMAGE:3711115), complete cds.>gb:BC021510_2093516 Mus
           musculus amyloid beta precursor protein binding protein
           1, mRNA (cDNA clone MGC:36437 IMAGE:5347277), complete
           cds.>gb:BC023897_2094307 Mus musculus amyloid beta
           precursor protein binding protein 1, mRNA (cDNA clone
           MGC:36406 IMAGE:5321187), complete
           cds.>gb:BC027124_2095769 Mus musculus amyloid beta
           precursor protein binding protein 1, mRNA (cDNA clone
           MGC:36630 IMAGE:5355631), complete cds.
          Length = 534

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 48/150 (32%), Positives = 70/150 (46%), Gaps = 8/150 (5%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           + E  + RQL ++G      L  ++V +      G EI KNL+L G+ S T+ D   V  
Sbjct: 8   LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNLVSG 67

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD--------FQA 715
            D  +NF   +  +GKNRA A+++ LQELN+ V  S +  E S E L D        F  
Sbjct: 68  EDAGNNFFLQKSSIGKNRAQAAMEFLQELNSDVSGSFV--EESPENLLDNDPSFFCRFTI 125

Query: 716 AVFTDIRLEKAMEFDDYCHNHQPPIAFIKT 805
            V T +     +   D   N Q P+   +T
Sbjct: 126 VVATQLLESTLLRLADVLWNSQIPLLICRT 155



>gb:CR382137_1669639 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 354

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 47/181 (25%), Positives = 87/181 (48%), Gaps = 15/181 (8%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ ++G  T  RL  + +L+  +  +G E+ KNL+L G+ ++ + D   V+  D  
Sbjct: 17  LYDRQIRLWGMATQLRLRSAKILVINLGAVGGEVVKNLVLGGINTLEILDSSKVKEEDFL 76

Query: 572 SNFVF--SEDDVGKNRALASVQKLQELNNSVIISTLTNELS---------KEQLSDFQAA 718
           + F    ++D VG+ +    ++++++LNN V +S  T+ LS            L+ F   
Sbjct: 77  AQFFLPNNDDIVGQLKLPVVIEQIKDLNNRVNLSANTSSLSSIFSDSQETNNYLAKFDLI 136

Query: 719 VFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGL---FGSVFCDFGPEFTVLDVD-GEDP 886
           + T++   + +  ++Y  N   P+      VCGL   FG +  D        + D G  P
Sbjct: 137 IGTELAKSEMLTLNEYTRNLNIPL-----YVCGLHGMFGYIMSDLIHHTATSEKDAGNQP 191

Query: 887 R 889
           R
Sbjct: 192 R 192



>gb:AY072375_1567192 Arabidopsis thaliana ubiquitin activating
           enzyme - like protein (At4g24940) mRNA, complete
           cds.>gb:AY086568_1571615 Arabidopsis thaliana clone
           25830 mRNA, complete sequence.>gb:BT000094_1634372
           Arabidopsis thaliana ubiquitin activating enzyme - like
           protein (At4g24940) mRNA, complete
           cds.>gb:AF510523_1807240 Arabidopsis thaliana SUMO
           activating enzyme 1a (SAE1a) mRNA, complete cds.
          Length = 322

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 46/156 (29%), Positives = 73/156 (46%), Gaps = 6/156 (3%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ V+G    RRL  +++L+SG+KG   E  KN++LAGV SVTL D+    +  L+
Sbjct: 13  LYDRQIRVWGANAQRRLTKAHILVSGIKGTVAEFCKNIVLAGVGSVTLMDDRLANMEALN 72

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELS---KEQLSDFQAAVFTDI 733
           +NF+   D+    GK  A      L++ N  V +S    +LS    +    F   V    
Sbjct: 73  ANFLIPPDENVYSGKTVAEICSDSLKDFNPMVRVSVEKGDLSMLGTDFFEQFDVVVIGYG 132

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
                   ++ C   +  +AF   +     G +F D
Sbjct: 133 SRATKKYVNEKCRKLKKRVAFYTVDCRDSCGEIFVD 168



>pir|T05515|T05515 ubiquitin-activating enzyme homolog F13M23.80 -
           Arabidopsis thaliana>gb:ATCHRIV62_1546376 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           62.>gb:ATF13M23_1548494 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F13M23 (ESSAII project).
          Length = 319

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 46/156 (29%), Positives = 73/156 (46%), Gaps = 6/156 (3%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ V+G    RRL  +++L+SG+KG   E  KN++LAGV SVTL D+    +  L+
Sbjct: 13  LYDRQIRVWGANAQRRLTKAHILVSGIKGTVAEFCKNIVLAGVGSVTLMDDRLANMEALN 72

Query: 572 SNFVFSEDD---VGKNRALASVQKLQELNNSVIISTLTNELS---KEQLSDFQAAVFTDI 733
           +NF+   D+    GK  A      L++ N  V +S    +LS    +    F   V    
Sbjct: 73  ANFLIPPDENVYSGKTVAEICSDSLKDFNPMVRVSVEKGDLSMLGTDFFEQFDVVVIGYG 132

Query: 734 RLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
                   ++ C   +  +AF   +     G +F D
Sbjct: 133 SRATKKYVNEKCRKLKKRVAFYTVDCRDSCGEIFVD 168



>gb:CR382136_1668932 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 519

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 57/200 (28%), Positives = 90/200 (45%), Gaps = 8/200 (4%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G      L  S++ +      G E+ KNL+L G+   T+ D   V    LS 
Sbjct: 9   YDRQLRLWGNSGQSNLESSHICLINATSTGSELLKNLVLPGIGEFTIIDNTEVTESSLSG 68

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSV----IISTLTNELSKEQL---SDFQAAVFTDI 733
           NF  +  D+G N A A V++L+ELN+ V    I ++LTN L  E +     F   + ++ 
Sbjct: 69  NFFLAHQDLGDNTATAMVRELKELNSEVIGNAIENSLTNVLKNESVQFWDSFNIVIISNF 128

Query: 734 RLEKAM-EFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASI 910
             E+ +    D       P+  + T   G +GS+      E TV++    DP       I
Sbjct: 129 VPEEDLNRLKDILWEKNIPLFLVNT--MGFYGSLQLIL-RETTVIET--HDPAKFFDLRI 183

Query: 911 SNDNPALVACVDDERLEFQD 970
            +  P L   VD  +L+  D
Sbjct: 184 DHPWPELQEYVDSIKLDELD 203



>gb:BC023680_2094206 Mus musculus amyloid beta precursor protein
           binding protein 1, mRNA (cDNA clone MGC:36609
           IMAGE:5343341), complete cds.
          Length = 534

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 47/150 (31%), Positives = 70/150 (46%), Gaps = 8/150 (5%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           + E  + RQL ++G      L  ++V +      G EI KNL+L G+ S T+ D   V  
Sbjct: 8   LKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNLVSG 67

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVF----- 724
            D  +NF   +  +GKNRA A+++ LQELN+ V  S +  E S E L D   + F     
Sbjct: 68  EDAGNNFFLQKSSIGKNRAQAAMEFLQELNSDVSGSFV--EESPENLLDNDPSFFCRFTI 125

Query: 725 ---TDIRLEKAMEFDDYCHNHQPPIAFIKT 805
              T +     +   D   N Q P+   +T
Sbjct: 126 VFATQLLESTLLRLADVLWNSQIPLLICRT 155



>gb:AC142210_1744085 Solanum demissum chromosome 11 BAC PGEC589
           genomic sequence, complete sequence.
          Length = 543

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 44/152 (28%), Positives = 72/152 (47%), Gaps = 6/152 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G +    L  +++ +      G E  KNL+L GV S+T+ D   VE+ DL +
Sbjct: 47  YDRQLRIWGEQGQAALEKASICLLNCGPTGSETLKNLVLGGVGSITVVDGSKVEVGDLGN 106

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN------ELSKEQLSDFQAAVFTDIR 736
           NF+  E  VG+++A      LQELN++V    + +      E +    S F   + T + 
Sbjct: 107 NFMVDESSVGESKAKCVCTFLQELNDAVKAKFIEDCPEELIETNPSFFSQFTLVIATQLV 166

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
            +  ++ D  C   +  I  I     GL G V
Sbjct: 167 EDSMVKLDRIC--REANIILIFARSYGLMGLV 196



>gb:AX764247_1474526 Sequence 59 from Patent WO03040681.
          Length = 371

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 35/115 (30%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query: 389 DLH--SRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           +LH  +RQLA+  YG E   RLF ++VL+ G  GLG  + ++L  AGV ++T+ D+  V+
Sbjct: 21  ELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITVIDDDTVD 80

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
           + ++    +F   DVG+ +   + ++L+EL   + ++ L   ++ E   +   +V
Sbjct: 81  ISNIHRQILFGASDVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSV 135



>gb:BX927154_833575 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment 7/10.
          Length = 358

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 35/115 (30%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query: 389 DLH--SRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           +LH  +RQLA+  YG E   RLF ++VL+ G  GLG  + ++L  AGV ++T+ D+  V+
Sbjct: 8   ELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITVIDDDTVD 67

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
           + ++    +F   DVG+ +   + ++L+EL   + ++ L   ++ E   +   +V
Sbjct: 68  ISNIHRQILFGASDVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSV 122



>gb:BA000036_719769 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.
          Length = 378

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 35/115 (30%), Positives = 66/115 (57%), Gaps = 4/115 (3%)
 Frame = +2

Query: 389 DLH--SRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           +LH  +RQLA+  YG E   RLF ++VL+ G  GLG  + ++L  AGV ++T+ D+  V+
Sbjct: 28  ELHRTARQLALPGYGIEQQERLFNAHVLVIGAGGLGCPVMQSLASAGVGTITVIDDDTVD 87

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
           + ++    +F   DVG+ +   + ++L+EL   + ++ L   ++ E   +   +V
Sbjct: 88  ISNIHRQILFGASDVGRPKVEVAAERLKELQPDITVNALHERITPENACELLNSV 142



>gb:AP006878_577269 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 232

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 5/151 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++G E   +L G+ V + G+ GLG  +A  L  AG+ +V L DE   EL +L+ 
Sbjct: 10  YDRQIMIFGEEGQEKLKGAKVAVVGVGGLGSPVAYYLAAAGIGTVLLIDEQTPELSNLNR 69

Query: 575 NFVFSEDDVGKNRALASVQ-KLQELNNSVIISTLTNELSKEQ----LSDFQAAVFTDIRL 739
             +  E+DVG+     S + KL+  N+ + I   T  L+ E     L D    V      
Sbjct: 70  QILHWEEDVGRRSKPESAKWKLERFNSDIKIEAYTGRLTAENIDEVLKDVDIVVDCLDNF 129

Query: 740 EKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
           +     D+Y H  + P+  +   V G+ G V
Sbjct: 130 QTRYLLDEYVHRKRIPL--VHGAVEGMHGQV 158



>gb:AE017180_399207 Geobacter sulfurreducens PCA, complete genome.
          Length = 223

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 33/88 (37%), Positives = 54/88 (61%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           +SRQ+ V+G E  R L  S +LI+G+ GLG  +A+ +  AGV  + L D G V+  DL+ 
Sbjct: 7   YSRQVLVWGEENQRMLERSAILIAGVGGLGATVAQLMARAGVGMLYLADHGVVDWPDLNR 66

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSV 658
             ++ E DVG+ +  A+ +K+  +N +V
Sbjct: 67  QLLYDEGDVGQKKVTAAARKIMAINGAV 94



>gb:AE016962_368098 Coxiella burnetii strain RSA 493, section 3 of 7
           of the complete genome.>gb:AE016828_1008834 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 368

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 4/140 (2%)
 Frame = +2

Query: 383 DEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELW 562
           D   ++R L + GRE    LF + +L  G  GLG  + + L  AG+ ++ + D   VEL 
Sbjct: 7   DIQRYARHLPLIGREGQAHLFAARILCVGAGGLGASVLQYLAAAGIGTIGIVDGDQVELS 66

Query: 563 DLSSNFVFSEDDVGKNRALASVQKLQELNNS----VIISTLTNELSKEQLSDFQAAVFTD 730
           +L    +FS +D+GKN+AL + + L   N S    V    L  + + + L DF+  +   
Sbjct: 67  NLQRQVIFSPEDIGKNKALVASRYLSRFNPSLKTIVREEFLNEDNATKILKDFELVIDCS 126

Query: 731 IRLEKAMEFDDYCHNHQPPI 790
                    +D C   + P+
Sbjct: 127 DNYRTRYLLNDICIQLKKPL 146



>sp|Q06624|RH31_YEAST DNA damage tolerance protein RHC31 (RAD31
           homolog).>pir|S59837|S59837 probable membrane protein
           YPR180w - yeast (Saccharomyces
           cerevisiae)>gb:YSCP9705_1730228 Saccharomyces cerevisiae
           chromosome XVI cosmid 9705.
          Length = 347

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 45/179 (25%), Positives = 89/179 (49%), Gaps = 3/179 (1%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ ++G      +  + VL+  +  +G EI K+++L+G+  +T+ D   V   DL 
Sbjct: 15  LYDRQIRLWGMTAQANMRSAKVLLINLGAIGSEITKSIVLSGIGHLTILDGHMVTEEDLG 74

Query: 572 SNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL---SKEQLSDFQAAVFTDIRLE 742
           S F    +DVG+ +  A+ +++Q+LN  + ++    +L    +E    F   V T+++++
Sbjct: 75  SQFFIGSEDVGQWKIDATKERIQDLNPRIELNFDKQDLQEKDEEFFQQFDLVVATEMQID 134

Query: 743 KAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDPRTGIIASISND 919
           +A++ +        P+    +   GLF  VF D   EF   D   +  R   +  IS++
Sbjct: 135 EAIKINTLTRKLNIPLYVAGSN--GLFAYVFIDL-IEFISEDEKLQSVRPTTVGPISSN 190



>gb:BC068838_2555336 Xenopus laevis hypothetical protein MGC81483,
           mRNA (cDNA clone MGC:81483 IMAGE:6636602), complete cds.
          Length = 533

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 40/115 (34%), Positives = 60/115 (52%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           I E  + RQL ++G      L  ++V +      G EI KNL+L G+   T+ D   V  
Sbjct: 7   IKEQKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGLFTIVDGNVVAG 66

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVF 724
            D+ +NF   ++ +GKNRA  S++ LQELN+ V  + +    S EQL D   + F
Sbjct: 67  EDVGNNFFLQKESIGKNRAQTSMELLQELNDDVTGNFVPE--SPEQLLDKDPSFF 119



>gb:AJ720838_2503025 Gallus gallus mRNA for hypothetical protein,
           clone 27g6.
          Length = 535

 Score = 64.3 bits (155), Expect = 5e-09
 Identities = 41/128 (32%), Positives = 63/128 (49%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           + E  + RQL ++G      L  ++V +      G EI KNL+L G+ S T+ D   V  
Sbjct: 9   LKEQRYDRQLRLWGDHGQEALESAHVCVINATATGTEILKNLVLPGIGSFTIVDGNRVSG 68

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
            D+ +NF   +  +G++RA ++ + LQELNN V  S    E S E L D   + F    L
Sbjct: 69  EDVGNNFFLQKSHIGQSRAQSATELLQELNNDV--SGNFVEESPETLLDNDPSFFNRFNL 126

Query: 740 EKAMEFDD 763
             A +  +
Sbjct: 127 VVATQLSE 134



>gb:AY623106_1618403 Pisum sativum ubiquitin activating enzyme E1
            mRNA, partial cds.
          Length = 204

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 30/39 (76%), Positives = 33/39 (84%)
 Frame = +2

Query: 1088 YTAYEGGGIVTQVKEPKVLKFKPLRETLKDPGDXLLSDF 1204
            Y AYE GGIVTQVK+PKVL FKPLRE L +PG+ LLSDF
Sbjct: 1    YGAYEKGGIVTQVKQPKVLNFKPLREALTNPGEFLLSDF 39



>gb:BC055513_2551381 Danio rerio amyloid beta precursor protein
           binding protein 1, mRNA (cDNA clone MGC:66148
           IMAGE:5410935), complete cds.
          Length = 533

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/91 (37%), Positives = 50/91 (54%)
 Frame = +2

Query: 386 EDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWD 565
           E  + RQL ++G      L  ++V +      G EI KNL+L G+ + T+ D   V   D
Sbjct: 9   EQRYDRQLRLWGDHGQEALENAHVCLINATASGTEILKNLVLPGIGAFTIVDGHKVSGED 68

Query: 566 LSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
           + +NF  S   +GKNRA A+ + LQELN+ V
Sbjct: 69  VGNNFFLSSSAIGKNRAQAATELLQELNSDV 99



>gb:BC050171_2550350 Danio rerio amyloid beta precursor protein
           binding protein 1, mRNA (cDNA clone IMAGE:5914850),
           partial cds.
          Length = 480

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 34/91 (37%), Positives = 50/91 (54%)
 Frame = +2

Query: 386 EDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWD 565
           E  + RQL ++G      L  ++V +      G EI KNL+L G+ + T+ D   V   D
Sbjct: 30  EQKYDRQLRLWGDHGQEALENAHVCLINATASGTEILKNLVLPGIGAFTIVDGHKVSGED 89

Query: 566 LSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
           + +NF  S   +GKNRA A+ + LQELN+ V
Sbjct: 90  VGNNFFLSSSAIGKNRAQAATELLQELNSDV 120



>gb:CR380953_1651043 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 336

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 3/153 (1%)
 Frame = +2

Query: 392 LHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLS 571
           L+ RQ+ ++G      +  + VL+  +  +G E+AKN++L+G+  +T+ D   V   DL 
Sbjct: 11  LYDRQIRLWGLAAQTNMRIAKVLLVNIGSIGTEVAKNIVLSGIGHLTVLDSHIVNETDLG 70

Query: 572 SNFVFSEDDVGKNRALASVQKLQELN---NSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
           S F  + +DVGK R  A   +LQ++N   N V  S      + +    F   + T++   
Sbjct: 71  SQFFLTANDVGKKRVEAVSDRLQDMNPRVNLVFDSADLKSKTDDFYKQFNIIIGTELDFF 130

Query: 743 KAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD 841
           +    +  C     P+    T   G+F  +F D
Sbjct: 131 QRESLNSKCRALNIPLYL--TGSNGMFAYIFVD 161



>gb:AY142853_592036 Heliobacillus mobilis unknown gene.
          Length = 339

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 48/156 (30%), Positives = 75/156 (48%), Gaps = 3/156 (1%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G E  RRL  S VLI+GM  LG  +A  L  AGV  + L D   VE  +L    ++ EDD
Sbjct: 14  GEEGQRRLLSSKVLIAGMGALGTHLANALARAGVGHLLLADRDYVEKSNLQRQVLYDEDD 73

Query: 599 VGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEFD-DYC 769
           V +   +A+A+ +KLQ +N+ + I  +  +L    L      V  D+ ++ +  FD  + 
Sbjct: 74  VERTMPKAIAAKKKLQSINSEINIEAVVTDLGWSNLEPLLEGV--DLVVDGSDNFDLRFL 131

Query: 770 HNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDG 877
            N     A +++ +  ++G V    G    VL   G
Sbjct: 132 LND----ACVRSAIPWIYGGVTGAHGMAMVVLPEQG 163



>gb:AC104433_1737636 Oryza sativa chromosome 3 BAC OJ1754_E06
           genomic sequence, complete sequence.
          Length = 523

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 6/152 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G +    L  +++ +      G E  KNL+L GV SVT+ D   VE  D+ +
Sbjct: 16  YDRQLRIWGDQGQAALEKASICLLTCGPTGTEAMKNLVLGGVGSVTVVDGSKVEQSDMGN 75

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN------ELSKEQLSDFQAAVFTDIR 736
           NF+   + +G++RA +    LQELN++V    +        + +    S F   + T + 
Sbjct: 76  NFLLDAECLGQSRAKSVCSFLQELNDAVNAKFVEESPLALIDTNPSFFSQFTVVIATQLP 135

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
               ++ DD C   +  I  +     GL G V
Sbjct: 136 ERSLLKLDDIC--RKANIVLVAARSYGLTGLV 165



>gb:AC104433_1737635 Oryza sativa chromosome 3 BAC OJ1754_E06
           genomic sequence, complete sequence.
          Length = 531

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 6/152 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G +    L  +++ +      G E  KNL+L GV SVT+ D   VE  D+ +
Sbjct: 16  YDRQLRIWGDQGQAALEKASICLLTCGPTGTEAMKNLVLGGVGSVTVVDGSKVEQSDMGN 75

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTN------ELSKEQLSDFQAAVFTDIR 736
           NF+   + +G++RA +    LQELN++V    +        + +    S F   + T + 
Sbjct: 76  NFLLDAECLGQSRAKSVCSFLQELNDAVNAKFVEESPLALIDTNPSFFSQFTVVIATQLP 135

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
               ++ DD C   +  I  +     GL G V
Sbjct: 136 ERSLLKLDDIC--RKANIVLVAARSYGLTGLV 165



>gb:BA000023_692959 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 287

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 43/138 (31%), Positives = 69/138 (50%), Gaps = 4/138 (2%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           +SRQL V G E  ++L    V + G   LG  + + L   GV  + + D   VE+ +L  
Sbjct: 4   YSRQLLVLGLELQQKLKELKVTVVGCGALGSTLVELLTRIGVGYIKVIDADIVEISNLHR 63

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLT---NELSKEQLSDFQAAVFTDI-RLE 742
             +F+E DVGK +AL   ++ +E+NN V I  +T   +E + E+L      VF  +  L 
Sbjct: 64  TLLFTEKDVGKPKALVCKERAKEINNEVEIEAITDIIDETNVEELVKDSHYVFDALDNLY 123

Query: 743 KAMEFDDYCHNHQPPIAF 796
             +  +D C  H  P+ +
Sbjct: 124 FRLLLNDACVKHSIPLIY 141



>gb:AE017173_396785 Porphyromonas gingivalis W83 section 2 of 8 of
           the complete genome.>gb:AE015924_1032396 Porphyromonas
           gingivalis W83 complete genome.
          Length = 235

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 37/108 (34%), Positives = 64/108 (59%), Gaps = 5/108 (4%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           ++RQ A+   G +  +RL GS+VL+ G  GLG  + + L  AGV  +++ D+  V++ +L
Sbjct: 9   YARQTALPEVGADGQQRLDGSHVLVIGAGGLGCPVLQYLCAAGVGHISVVDDDRVDISNL 68

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLT---NELSKEQLS 703
               +FSE D+G+ +A+A+V +LQ +N+       T    EL+ E L+
Sbjct: 69  QRQVLFSEADLGQPKAIAAVARLQAMNSDCRPEAFTERFTELNAEMLA 116



>gb:AE014186_938416 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014843_1229150 Plasmodium falciparum 3D7
           chromosome 11 section 8 of 8 of the complete sequence.
          Length = 338

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 52/217 (23%), Positives = 99/217 (45%), Gaps = 38/217 (17%)
 Frame = +2

Query: 386 EDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWD 565
           E ++ RQL ++G +   R+  SNVL+ G+ G+ +E+ KNLIL G+ ++T+ D   V+  D
Sbjct: 4   EKIYDRQLRLWGVKAQNRMMKSNVLVVGLSGINIELCKNLILNGI-NITIIDNNIVDEED 62

Query: 566 LSSNFVFSEDDVGKNRALASVQKLQELN----------------NSVIIST----LTNEL 685
           + + F  +E D+ +  ++   ++L+ +N                N++II        NE+
Sbjct: 63  IENIFFLNEHDMKEYMSVPIFKELKSINQLINIKSFIGHINLDTNNIIIEKELMYKDNEI 122

Query: 686 SKEQ-------------LSDFQAAVFT--DIRLEKAMEFDDYCHNHQPPIAFIKTEVCGL 820
            +E+             ++++     +  D  L K  + ++ C  H+  I F      G 
Sbjct: 123 IQEEKIINDCSYDICDYITNYTCVCISCEDYPLYKLTKINEIC--HEKNIGFFANMCHGK 180

Query: 821 FGSVFCDFGP---EFTVLDVDGEDPRTGIIASISNDN 922
           +  +F DFG    E +   +  +D + G      NDN
Sbjct: 181 YAFLFSDFGKHIIEESYYKIKNDDNKKG------NDN 211



>gb:CR628339_116291 Legionella pneumophila str. Lens plasmid pLPL,
           complete sequence.
          Length = 340

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/115 (29%), Positives = 63/115 (54%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+AV G ++ + L  + ++I G+ G+G  +A+ L  AGV  + L D   V+L +L  
Sbjct: 4   YKRQIAVIGEQSQKILSNARIMIVGLGGIGCPVAQYLAAAGVGKLILVDNDKVDLSNLHR 63

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
             +F+E DVG  +A  +   L ++N ++++   TN+       DF  +  +D+ L
Sbjct: 64  QILFNEADVGDYKAEKAKVALSQVNCNIVLEAYTNKFD----VDFGYSSVSDVDL 114



>pir|F90172|F90172 hypothetical protein thiF [imported] - Sulfolobus
           solfataricus>gb:AE006665_221235 Sulfolobus solfataricus
           P2 section 24 of 272 of the complete
           genome.>gb:AE006641_1107083 Sulfolobus solfataricus P2,
           complete genome.
          Length = 333

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 35/102 (34%), Positives = 59/102 (57%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           +SRQL V G    +RL    +LI+G   LG  +A+ L   GVK +T+ D   V++ +L  
Sbjct: 46  YSRQLIVLGLGIQQRLNELKILIAGCGALGTAVAELLARLGVKELTIVDADVVDITNLHR 105

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
             +F E+DVGK +A    +K+  +N+S+ I+ + + L +E +
Sbjct: 106 VHLFDENDVGKPKAEVCAKKISLINSSIKINYIIDILDEENV 147



>gb:CR382125_1657428 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 319

 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 38/134 (28%), Positives = 70/134 (52%), Gaps = 3/134 (2%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           ++VL+  +  +G EI KN++L+G+ S+T+ D  +V   DL + F   +DD+G  R  A+ 
Sbjct: 10  ASVLLINLGAIGNEITKNIVLSGIGSLTILDSHDVTEEDLGAQFFIGKDDIGTKRLEAAR 69

Query: 629 QKLQELNNSVIISTLTNEL---SKEQLSDFQAAVFTDIRLEKAMEFDDYCHNHQPPIAFI 799
           + ++++N  V ++   ++L   +KE  S F   V TD+      + ++       PI   
Sbjct: 70  RHIEDMNPRVKLTVDISDLQSKNKEFFSQFNLIVITDLFPADIEKLNEVTRELNVPI--Y 127

Query: 800 KTEVCGLFGSVFCD 841
              + GL G +F D
Sbjct: 128 VAGINGLSGYIFTD 141



>gb:CR543861_104281 Acinetobacter sp. ADP1 complete genome.
          Length = 270

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 2/125 (1%)
 Frame = +2

Query: 338 NGKSPIDCSRNSPDIDEDLHSRQLAVYGRET--MRRLFGSNVLISGMKGLGVEIAKNLIL 511
           N +  +D   N  D +  L+SRQ+ + G +     +L  +NVLI G  G+G   A+ L  
Sbjct: 2   NDQDNLDLELN--DAEMHLYSRQILLDGWDVDAQEKLKFANVLIVGAGGIGCTSAELLAR 59

Query: 512 AGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK 691
           AGV  +TL D   +E+ +L     F+ +D+G  +A    ++L +LN  +++  + N+L  
Sbjct: 60  AGVGKITLIDSDTIEISNLQRQIAFTPNDLGCFKAEVLAKRLTQLNPHIVVEYIVNKLVS 119

Query: 692 EQLSD 706
           E + +
Sbjct: 120 ENVDE 124



>gb:CR628338_116153 Legionella pneumophila str. Paris plasmid pLPP,
           complete sequence.
          Length = 340

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/117 (29%), Positives = 63/117 (53%)
 Frame = +2

Query: 389 DLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           D + RQ++V G +  + +  + ++I G+ G+G  +A+ L  AGV  + L D+  V+L +L
Sbjct: 2   DRYKRQISVIGEQGQKLINNATIMIVGLGGIGSPVAQYLAAAGVGKLILVDDDKVDLSNL 61

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL 739
               +F+E D+G  +A  +   L ++N +V+I   T         DF  ++ +DI L
Sbjct: 62  HRQILFNESDIGFYKAEKARDVLSKVNKNVVIEAHTKRFD----VDFGYSLVSDIDL 114



>sp|P42744|AXR1_ARATH Auxin-resistance protein
           AXR1.>pir|S35071|S35071 auxin-resistance protein AXR1 -
           Arabidopsis thaliana>gb:AE005172_889540 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATHAXR1122_1553062 Arabidopsis thaliana
           ubiquitin activating enzyme E1-related protein (AXR1)
           mRNA, complete cds.>gb:AY050379_1562158 Arabidopsis
           thaliana At1g05180/YUP8H12_21 mRNA, complete
           cds.>gb:YUP8H12_1731287 Arabidopsis thaliana chromosome
           1 YAC yUP8H12 complete sequence.
          Length = 540

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 6/152 (3%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G      L  +++ +      G E  KNL+L GV S+T+ D   V+  DL +
Sbjct: 24  YDRQLRIWGEVGQAALEEASICLLNCGPTGSEALKNLVLGGVGSITVVDGSKVQFGDLGN 83

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNE------LSKEQLSDFQAAVFTDIR 736
           NF+     VG+++A +    LQELN+SV    +          +    S F   + T + 
Sbjct: 84  NFMVDAKSVGQSKAKSVCAFLQELNDSVNAKFIEENPDTLITTNPSFFSQFTLVIATQLV 143

Query: 737 LEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSV 832
            +  ++ D  C +    +  +++   GL G V
Sbjct: 144 EDSMLKLDRICRDANVKLVLVRS--YGLAGFV 173



>gb:AY591340_1616670 Zea mays putative ubiquitin-activating enzyme
           mRNA, complete cds.
          Length = 492

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 32/88 (36%), Positives = 50/88 (56%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G +    L  +++ +      G E  KNL+L G+ SVT+ D   VE  DL +
Sbjct: 37  YDRQLRIWGDQGQTALEKASICLLNCGPTGTEALKNLVLGGIGSVTVVDGSKVEASDLGN 96

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSV 658
           NF+  E  +G+ RA +    LQELN++V
Sbjct: 97  NFMLDEGCLGQPRAKSICSFLQELNDAV 124



>gb:BT001291_1356064 Drosophila melanogaster AT09990 full insert
           cDNA.
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query: 371 SPDIDEDL--HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDE 544
           SP++ +    + RQ+ ++G      L  + V +  +  +G E AK L+L G+   T+ D 
Sbjct: 8   SPELSDKSKKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADG 67

Query: 545 GNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
             V+  DL +NF      +GK++ALA +Q LQELN  V
Sbjct: 68  STVKEEDLGNNFFLDSSYLGKSKALACMQLLQELNPDV 105



>gb:AE014296_1135771 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003546_1214931 Drosophila melanogaster
           chromosome 3L, section 39 of 83 of the complete
           sequence.
          Length = 524

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 33/98 (33%), Positives = 53/98 (54%), Gaps = 2/98 (2%)
 Frame = +2

Query: 371 SPDIDEDL--HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDE 544
           SP++ +    + RQ+ ++G      L  + V +  +  +G E AK L+L G+   T+ D 
Sbjct: 8   SPELSDKSKKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADG 67

Query: 545 GNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
             V+  DL +NF      +GK++ALA +Q LQELN  V
Sbjct: 68  STVKEEDLGNNFFLDSSYLGKSKALACMQLLQELNPDV 105



>gb:AE016928_360016 Bacteroides thetaiotaomicron VPI-5482, section 3
           of 21 of the complete genome.>gb:AE015928_986504
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 230

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 41/142 (28%), Positives = 70/142 (49%), Gaps = 4/142 (2%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G +  ++L  + VLI G+ GLG  IA  L  AGV  + L D+  V + +L    ++SE +
Sbjct: 13  GEDGQQKLKQAKVLIVGVGGLGSPIALYLTGAGVGCIGLVDDDVVSISNLQRQVLYSEKE 72

Query: 599 VGKNRALASVQKLQELNNSVIIST----LTNELSKEQLSDFQAAVFTDIRLEKAMEFDDY 766
           +GK +A+ + ++L  LN+ + I T    LT E ++E +S +   V            +D 
Sbjct: 73  LGKPKAICAAERLSALNSEITIRTYPTRLTEENAQEIISQYDIVVDGCDNFSTRYLINDI 132

Query: 767 CHNHQPPIAFIKTEVCGLFGSV 832
           C   +    ++   +CG  G V
Sbjct: 133 C--AEMGKVYVYGAICGFEGQV 152



>gb:AE013870_300969 Yersinia pestis KIM section 270 of 415 of the
           complete genome.>gb:AE017132_387202 Yersinia pestis
           biovar Medievalis str. 91001 section 6 of 16 of the
           complete genome.>gb:AE009952_931152 Yersinia pestis KIM
           complete genome.>gb:AE017042_1143768 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 266

 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 41/154 (26%), Positives = 72/154 (46%), Gaps = 6/154 (3%)
 Frame = +2

Query: 347 SPIDCSRNSPDIDEDLHSRQLAVYGRET--MRRLFGSNVLISGMKGLGVEIAKNLILAGV 520
           S +D      D++   ++RQ+ + G +     +L  + VLI G+ GLG   A+ L  AGV
Sbjct: 7   SEVDMLPELSDVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGV 66

Query: 521 KSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
             +TL D   V L +L    +  +  +G  +  ++ Q L E+N  + ++TL  +L  EQL
Sbjct: 67  GHLTLLDFDTVALSNLQRQILHRDSRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQL 126

Query: 701 ----SDFQAAVFTDIRLEKAMEFDDYCHNHQPPI 790
               ++ Q  +     L    + +  CH    P+
Sbjct: 127 LSLIAEHQLVLDCTDNLSTREQLNRLCHTLGKPL 160



>gb:BA000035_716720 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 373

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 2/118 (1%)
 Frame = +2

Query: 374 PDIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEG 547
           PD +    +RQLA+  +G E   RL  S+VL+ G  GLG    ++L  AG+  +T+ D+ 
Sbjct: 14  PDTELRRTARQLALSGWGMEQQERLHRSHVLVIGGGGLGCPAMQSLASAGIGHITVIDDD 73

Query: 548 NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
            V++ ++    +F   DVG+ +     ++L+EL   + ++ L   L+ +   +    V
Sbjct: 74  TVDITNIHRQILFGASDVGRPKVEVVAERLRELQPDITVTALRERLTVDNAVELVGGV 131



>pir|C83827|C83827 molybdopterin biosynthesis moeB [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_655365
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 340

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 35/111 (31%), Positives = 65/111 (58%), Gaps = 4/111 (3%)
 Frame = +2

Query: 386 EDLHSRQL--AVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           E+ +SRQ+  A  G+E  ++L  S VLI G+  LG  +A + + AG+  V + D   VE 
Sbjct: 6   EERYSRQMLFAPIGKEGQQKLQNSAVLIVGIGALGTVLANHFVRAGIGHVRMVDRDYVEA 65

Query: 560 WDLSSNFVFSEDDVGK--NRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
            +L    +F E+DV +   +A+A+ QKLQ++N+ + +  +  +++ E + +
Sbjct: 66  SNLQRQLLFDENDVRECLPKAVAAQQKLQKVNSDIKVEGIVADVTVENIHE 116



>pir|G84732|G84732 probable ubiquitin activating enzyme [imported] -
           Arabidopsis thaliana>gb:AC005700_1532924 Arabidopsis
           thaliana chromosome 2 clone T32F6 map TEn5, complete
           sequence.
          Length = 523

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 31/88 (35%), Positives = 49/88 (55%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQL ++G      L  +++ +      G E  KNL++ G+ S+T+ D   VE+ DL +
Sbjct: 8   YDRQLRIWGELGQSALETASICLLNCGPTGSEALKNLVIGGIGSITIVDGSKVEIGDLGN 67

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSV 658
           NF+     VG++RA      LQELN+SV
Sbjct: 68  NFMVDAKSVGQSRAKTVCGFLQELNDSV 95



>gb:ECTHICEFGH_132837 Escherichia coli thiCEFSGH operon, complete
           cds.
          Length = 250

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 2/112 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +
Sbjct: 3   DRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
           V L +L    +F+ +D+ + ++  S Q+L +LN  + ++ L   L+ E L D
Sbjct: 63  VHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKD 114



>sp|P30138|THIF_ECOLI Adenylyltransferase thiF (EC 2.7.7.-).
          Length = 251

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 36/112 (32%), Positives = 61/112 (54%), Gaps = 2/112 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +
Sbjct: 3   DRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
           V L +L    +F+ +D+ + ++  S Q+L +LN  + ++ L   L+ E L D
Sbjct: 63  VHLSNLQRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKD 114



>gb:AE017353_1760151 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 570

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 35/106 (33%), Positives = 52/106 (49%)
 Frame = +2

Query: 341 GKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGV 520
           G +P+   R  PD     + RQL ++     R L  + VL+ G    G +  KNL+L G+
Sbjct: 30  GTAPVPSYR--PDAKARRYDRQLRLWASAGQRSLEQARVLLVGCDAAGSQSLKNLVLPGI 87

Query: 521 KSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
              T+         D+++NF    D +G N A  SV+ LQELN +V
Sbjct: 88  SQFTILSSKITTAQDVATNFFLHPDSIGSNIAQESVKYLQELNPAV 133



>gb:AP006841_573060 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 233

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ  L   G     +L  + VLI G+ GLG  IA  L  AGV ++ L D+  V L +L
Sbjct: 4   YSRQTMLPEIGEVGQLKLKAAKVLIVGVGGLGSPIALYLAGAGVGTIGLADDDEVSLSNL 63

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
               +++E++VG  +A+ +  ++  LN  + ++     LSKE   D       DI ++  
Sbjct: 64  QRQILYTEEEVGDLKAICASMRISALNREIKVNACPGRLSKENARDLIGQY--DIIVDGC 121

Query: 749 MEF------DDYCHNHQPPIAFIKTEVCGLFGSV 832
             F       D C     P  ++   +CG  G V
Sbjct: 122 DNFATRYLLSDVCSELGKP--YVYGAICGFEGQV 153



>gb:CP000031_84121 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 327

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 46/163 (28%), Positives = 73/163 (44%), Gaps = 8/163 (4%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G E   RL G+ VL+ G  GL       L  AGV  + + D  ++EL +L    +F+E D
Sbjct: 20  GGEGQARLAGARVLVVGAGGLAASALPLLAGAGVGQIDIFDGDHIELSNLHRQTLFAEGD 79

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEF------D 760
           VG+ +A  + ++   LN+ ++++     ++ E +    A   TD+ L+ A  +       
Sbjct: 80  VGRAKAEVAAERCGALNSGIVLTGTKRSITPENV--ILACRDTDLVLDCADSYAASYLLS 137

Query: 761 DYCHNHQPPIAFIKTEVCGLFGSV--FCDFGPEFTVLDVDGED 883
           D C     P+  I   V GL G V  FC   P    +  D  D
Sbjct: 138 DTCQALGKPL--ISASVLGLGGYVGGFCGGAPSLRAVFPDAPD 178



>gb:AE005674_73648 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016990_373155 Shigella flexneri 2a str.
           2457T section 13 of 16 of the complete
           genome.>gb:AE014073_997905 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 251

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 2/112 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +
Sbjct: 3   DRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
           V L +L    +F+ +D+   ++  S Q+L +LN  + ++ L   L+ E L D
Sbjct: 63  VHLSNLQRQILFTTEDINSPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKD 114



>pir|B82369|B82369 thiF protein VC0063 [imported] - Vibrio cholerae
           (strain N16961 serogroup O1)>gb:AE004097_50471 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           section 5 of 251 of the complete
           chromosome.>gb:AE003852_1051245 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 258

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 33/95 (34%), Positives = 50/95 (52%)
 Frame = +2

Query: 407 LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVF 586
           LA  G E  ++L  S VLI G  GLG  +A  L+ AGV  V + D   +EL +L     +
Sbjct: 16  LAELGEEGQQKLLNSRVLIVGCGGLGNVVAPYLVGAGVGQVIIADSDRLELHNLHRQICY 75

Query: 587 SEDDVGKNRALASVQKLQELNNSVIISTLTNELSK 691
            E  +G N+A    + L+ELN+ V +  +  E+ +
Sbjct: 76  HEAQIGHNKAELLARYLRELNSEVRVRVIAREVDE 110



>pir|C65206|C65206 thiF protein - Escherichia coli (strain
           K-12)>gb:ECOUW89_131527 E. coli chromosomal region from
           89.2 to 92.8 minutes.>gb:U00096_202960 Escherichia coli
           K-12 MG1655 complete genome.
          Length = 245

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +V L +L
Sbjct: 3   YSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNL 62

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
               +F+ +D+ + ++  S Q+L +LN  + ++ L   L+ E L D
Sbjct: 63  QRQILFTTEDIDRPKSQVSQQRLTQLNPDIQLTALQQRLTGEALKD 108



>gb:BX936398_836154 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 256

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 39/144 (27%), Positives = 69/144 (47%), Gaps = 6/144 (4%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRET--MRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D++   ++RQ+ + G +     +L  + VLI G+ GLG   A+ L  AGV  +TL D   
Sbjct: 7   DVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDT 66

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL----SDFQAA 718
           V L +L    +  +  +G  +  ++ Q L E+N  + ++TL  +L  EQL    ++ Q  
Sbjct: 67  VALSNLQRQILHRDSRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLV 126

Query: 719 VFTDIRLEKAMEFDDYCHNHQPPI 790
           +     L    + +  CH    P+
Sbjct: 127 LDCTDNLSTREQLNRLCHTLGKPL 150



>pir|AB0182|AB0182 molybdopterin biosynthesis protein [imported] -
           Yersinia pestis (strain CO92)>gb:AJ414148_523310
           Yersinia pestis strain CO92 complete genome; segment
           8/20.
          Length = 255

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 39/144 (27%), Positives = 69/144 (47%), Gaps = 6/144 (4%)
 Frame = +2

Query: 377 DIDEDLHSRQLAVYGRET--MRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D++   ++RQ+ + G +     +L  + VLI G+ GLG   A+ L  AGV  +TL D   
Sbjct: 6   DVEALRYNRQITLRGFDFDGQEKLKAAKVLIVGLGGLGCAAAQYLAAAGVGHLTLLDFDT 65

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL----SDFQAA 718
           V L +L    +  +  +G  +  ++ Q L E+N  + ++TL  +L  EQL    ++ Q  
Sbjct: 66  VALSNLQRQILHRDSRIGMTKVASAAQTLSEINPHLALNTLDKQLDDEQLLSLIAEHQLV 125

Query: 719 VFTDIRLEKAMEFDDYCHNHQPPI 790
           +     L    + +  CH    P+
Sbjct: 126 LDCTDNLSTREQLNRLCHTLGKPL 149



>pir|A86091|A86091 thiamin biosynthesis, thiazole moiety thiF
           [imported] - Escherichia coli (strain O157:H7, substrain
           EDL933)>pir|C91243|C91243 thiamin biosynthesis protein
           ThiF [imported] - Escherichia coli (strain O157:H7,
           substrain RIMD 0509952)>gb:AE005174_69188 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:BA000007_662927
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 245

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 2/106 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +V L +L
Sbjct: 3   YSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDDVHLSNL 62

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
               +F+ +D+ + ++  S Q+L +LN  + ++ L   L+ E L D
Sbjct: 63  QRQILFTTEDIDRPKSQVSHQRLTQLNPDIQLTALQQRLTGEALKD 108



>gb:AY251481_1313095 Schistosoma japonicum IR3 (IR3) mRNA, complete
           cds.
          Length = 299

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = +2

Query: 470 MKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELN 649
           M  L  EIAKN++LAG+ S+T+ D+  V + D  +NF+   D +G+ R+ A+V + Q LN
Sbjct: 1   MNALAAEIAKNIVLAGISSLTIIDDQQVTIEDCENNFLIPHDCLGQKRSDAAVSRTQSLN 60

Query: 650 NSVIISTLTNELSKEQLSDFQAAV-FTDIRLEKAMEFDDYCH-------NHQPPIAFIKT 805
             V + +      KE++ +    +  T+       ++   C          +P +  I  
Sbjct: 61  PMVKLQSSEMGDLKEKIQEHNFIILITECSSTHFKQWSTVCDIVSGIDIGTKPYV--ICA 118

Query: 806 EVCGLFGSVFCD 841
              GLFG VF D
Sbjct: 119 SATGLFGFVFID 130



>gb:CP000020_870210 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 277

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 8/144 (5%)
 Frame = +2

Query: 383 DEDL--HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D+D   +SRQ+ +   G +    L  S VLI G  GLG  +   L  +G+ ++ + D   
Sbjct: 11  DQDFLRYSRQIMLPDIGDKGQITLRNSTVLIIGCGGLGSSVGMYLSASGIGTLIIADGDK 70

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF--QAAVF 724
           VEL +L    V+ ++++ +N+A+A   +L+ LN +  I  ++++L++ +LS F  Q  V 
Sbjct: 71  VELSNLQRQVVYRDNNLNQNKAMAMAHQLKGLNGTTHIEVISHKLTEPELSRFINQVDVV 130

Query: 725 TDI--RLEKAMEFDDYCHNHQPPI 790
            D    L    E +  C  H  P+
Sbjct: 131 LDCSDNLPTRHETNAACVKHNVPL 154



>gb:BA000038_725181 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 258

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 33/100 (33%), Positives = 56/100 (56%)
 Frame = +2

Query: 401 RQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNF 580
           RQ    G+E +++   S++LI G  GLG   ++ L  AGV  +TL D+  VEL +L    
Sbjct: 19  RQFDFEGQEALKQ---SSILILGAGGLGCAASQYLATAGVGKLTLIDDDIVELSNLQRQV 75

Query: 581 VFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           +  + D+G+ +  ++ Q L+ELN  + + T+   LS  +L
Sbjct: 76  LHHDADIGRKKVESAAQSLRELNPHIEVVTVAQRLSDSEL 115



>gb:AE017283_430303 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 281

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 42/138 (30%), Positives = 69/138 (50%), Gaps = 5/138 (3%)
 Frame = +2

Query: 308 DAVSNGRRTENGKSPI-DCSRNSPDIDEDL--HSRQLAV--YGRETMRRLFGSNVLISGM 472
           DAVS   R  NG   + D    +  I+ DL  ++R + +  +G+E  RRL  S VL+ G 
Sbjct: 9   DAVS---RATNGHDAVEDMGSTTSLINRDLIRYARHIVLPGFGQEAQRRLRDSRVLVVGA 65

Query: 473 KGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNN 652
            GLG  +   L  AGV  +T+ D+  V+  +L    +  + DVG+ +AL++   +Q LN 
Sbjct: 66  GGLGSPVLLYLSAAGVGYLTILDDDVVDESNLQRQVIHRQADVGRPKALSAKDAVQRLNT 125

Query: 653 SVIISTLTNELSKEQLSD 706
            ++   +   L  +   D
Sbjct: 126 HLVAEAVVARLGTDNALD 143



>gb:AE017266_422034 Bacillus cereus ATCC 10987, section 3 of 18 of
           the complete genome.>gb:AE017194_1060453 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 339

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 43/167 (25%), Positives = 82/167 (49%), Gaps = 10/167 (5%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   +  G E  +++   +VLI G   LG   A+  + AGV +VT+ D   V+  +L
Sbjct: 5   YSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
               +++E DV  N  +A+A+ ++L+E+N+ V +  L  +++ E+L +    V  D+ ++
Sbjct: 65  QRQQLYAESDVKNNLPKAVAAKKRLEEINSEVRVEALVQDVTAEELEELVTNV--DVMID 122

Query: 743 KAMEFD------DYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVL 865
               F+      D    H  P          ++G+    +G  +T+L
Sbjct: 123 ATDNFETRFIVNDIAQKHSIP---------WIYGACVGSYGLSYTIL 160



>gb:AE016809_338284 Vibrio vulnificus CMCP6 chromosome II section 2
           of 6 of the complete sequence.>gb:AE016796_1048008
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 250

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 33/100 (33%), Positives = 56/100 (56%)
 Frame = +2

Query: 401 RQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNF 580
           RQ    G+E +++   S++LI G  GLG   ++ L  AGV  +TL D+  VEL +L    
Sbjct: 11  RQFDFEGQEALKQ---SSILILGAGGLGCAASQYLATAGVGKLTLIDDDIVELSNLQRQV 67

Query: 581 VFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           +  + D+G+ +  ++ Q L+ELN  + + T+   LS  +L
Sbjct: 68  LHHDADIGRKKVESAAQSLRELNPHIEVVTVAQRLSDSEL 107



>gb:CP000026_78635 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 252

 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     E  ++L  S+VLI G+ GLG   A  L  AG+ ++TL D+ +
Sbjct: 3   DRDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           V L +L    +F+ DD+ ++++  + Q L  LN  + + +L   L  E L
Sbjct: 63  VHLSNLQRQILFTTDDIARSKSQVAQQHLTRLNPDIELVSLQQRLKGEAL 112



>gb:AE017356_1760263 Cryptococcus neoformans var. neoformans JEC21
           chromosome 14, complete sequence.
          Length = 322

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 15/158 (9%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD--VGKNRALA 622
           S VLI  ++ L  E  KNL+LAG+  + + D   V   DL S F+F E+D  VGK R  A
Sbjct: 4   STVLILSLRSLAHETIKNLVLAGIGRLIVADSDVVTEEDLGSGFLFREEDNAVGKLRTDA 63

Query: 623 SVQKLQELNNSVIISTL-----------TNELSKEQLSDFQAAVFTDIRLEKAMEFDDYC 769
           +++++Q LN  V +S +             E+ K++  D    V  D+ +++    D   
Sbjct: 64  ALEQIQSLNPLVTLSKIGMDSFEGEEDKVAEILKKEAVD--VVVTCDLSVKENERID--A 119

Query: 770 HNHQPPIAFIKTEVCGLFGSVFCDFGP--EFTVLDVDG 877
              +    F      G  G VF D G   E+ V  +DG
Sbjct: 120 AARKASSLFYAAGTYGFTGYVFADLGESYEYVVNSIDG 157



>gb:APU47055_582400 Anabaena PCC7120 nitrogen fixation proteins
           (nifE, nifN, nifX, nifW) genes, complete cds, and
           nitrogenase (nifK) and hesA genes, partial cds.
          Length = 159

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 36/125 (28%), Positives = 67/125 (53%), Gaps = 2/125 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ+ +  +G    +RL  + VL++G+ GLG   A  L +AGV  + L   G++ L D+
Sbjct: 12  YSRQMMLPNFGEAAQKRLKSATVLVTGVGGLGGTAALYLAVAGVGRLILVRGGDLRLDDM 71

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
           +   + ++D VGK R   + + LQ +N  + I T+ + ++ E +     +   D+ L+ A
Sbjct: 72  NRQVLMTDDWVGKPRVFKAKETLQAINPDIQIETIHDYITSENVDSLVQS--ADMALDCA 129

Query: 749 MEFDD 763
             F +
Sbjct: 130 HNFTE 134



>gb:AE013388_291863 Methanosarcina mazei strain Goe1, section 170 of
           379 of the complete genome.>gb:AE008384_965972
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 244

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 27/107 (25%), Positives = 59/107 (55%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           ++ + +SRQ+ ++G E   +L  + V ++G  GLG  ++  L +AG+  + L D   V+ 
Sbjct: 4   MEREKYSRQILLFGEEGQEKLKAAKVFVAGAGGLGSPVSTYLAIAGIGKIILADFDTVDS 63

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
            +L+  F+  E DVG+ +  ++ +KL  +N  + +  +   L++  +
Sbjct: 64  TNLNRQFLHYEKDVGRAKVESAKEKLLLMNPLIEVEIIKEMLTESNI 110



>pir|E72538|E72538 probable HESA protein APE1594 - Aeropyrum pernix
           (strain K1)>gb:BA000002_652338 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 267

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 38/119 (31%), Positives = 60/119 (50%), Gaps = 2/119 (1%)
 Frame = +2

Query: 380 IDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           +D +++SRQL + G     RL  S V + G+ GLG   A  L  +GV  + L D   VE 
Sbjct: 18  LDLNVYSRQLGLLGVRGQLRLSSSKVAVVGLGGLGNLAAAYLAASGVGRLILVDRDVVEP 77

Query: 560 WDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF--QAAVFTD 730
            +L+   ++ + DVG+ +A+A+ ++L ELN    I  +   L      D   +A V  D
Sbjct: 78  SNLNRQVLYGKGDVGRYKAVAAAERLGELNPEAEIEPVPEALDPALAEDLAREADVIVD 136



>sp|P46048|HEA2_ANAVA Protein hesA, vegetative.>pir|S70247|S70247
           hypothetical protein 1 (fdxH2 5' region) - Anabaena
           variabilis>gb:AVFDXNIFW_583589 A.variabilis fdxB, fdxH2
           and nifW2 genes.
          Length = 265

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 35/134 (26%), Positives = 71/134 (52%), Gaps = 2/134 (1%)
 Frame = +2

Query: 368 NSPDIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHD 541
           N    + + + RQ+ +  +G+E  +RL  + VL++G+ GLG   A  L +AGV  + L  
Sbjct: 3   NLTSTELERYRRQIILPGFGQEAQQRLKSATVLVTGVGGLGGTAALYLAIAGVGRLILVR 62

Query: 542 EGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
            G + L D++   + S+D VGK R   + ++L+++N  V +  + + ++ + +     + 
Sbjct: 63  GGELRLDDMNRQILMSDDWVGKPRVFKAKKRLEDINPDVEVEAIFDYVTPDNVDSLIQS- 121

Query: 722 FTDIRLEKAMEFDD 763
             D+ L+ A  F +
Sbjct: 122 -ADVALDCAHNFGE 134



>gb:HSA1S9_2000505 Human A1S9 mRNA for A1S9 protein of unknown
            function.
          Length = 803

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 31/67 (46%), Positives = 45/67 (67%)
 Frame = +2

Query: 1004 MTELNDGKPRKIKNARPYSFTIEEDTTKYTAYEGGGIVTQVKEPKVLKFKPLRETLKDPG 1183
            M ELN  +P +IK   PY+F+I  DT+ ++ Y  GGIV+QVK PK + FK L  +L +P 
Sbjct: 1    MVELNGNQPMEIKVLGPYTFSIC-DTSNFSDYIRGGIVSQVKVPKKISFKSLVASLAEP- 58

Query: 1184 DXLLSDF 1204
            D +++DF
Sbjct: 59   DFVVTDF 65



>gb:BA000032_709711 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 249

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = +2

Query: 401 RQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNF 580
           RQ    G+E +++   S+VLI G  GLG   ++ L  AGV  +TL D+  VEL +L    
Sbjct: 19  RQFDFEGQEALKQ---SSVLILGAGGLGCASSQYLATAGVGRITLIDDDIVELSNLQRQV 75

Query: 581 VFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           +  + D+G+ +  ++   L+ELN  V ++T+   L   QL
Sbjct: 76  LHHDTDIGRKKVDSAADALRELNPHVEVNTVAKRLDDAQL 115



>gb:AE016770_328915 Escherichia coli CFT073 section 16 of 18 of the
           complete genome.>gb:AE014075_959499 Escherichia coli
           CFT073 complete genome.
          Length = 256

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 2/112 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     +  ++L  S VLI G+ GLG   A  L  AGV ++ L D+ +
Sbjct: 8   DRDFMRYSRQILLDDIALDGQQKLLDSQVLIIGLGGLGTPAALYLAGAGVGTLVLADDDD 67

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
           V L +L    +F+ +D+   ++  S Q+L +LN  + +  L   L+ E L D
Sbjct: 68  VHLSNLQRQILFTTEDIDLPKSQVSQQRLTQLNPDIQLMALQQRLTGETLKD 119



>pir|T38643|T38643 conserved hypothetical protein SPAC323.06c -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC323_1717731 S.pombe chromosome I cosmid
           c323.
          Length = 500

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 38/140 (27%), Positives = 68/140 (48%), Gaps = 8/140 (5%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           + RQ+ ++  E    +  S+V +     +G E  KNLIL G+ S  + D+ +V+      
Sbjct: 10  YDRQVRLWKAEGQNAIEKSHVCLLYANTVGCEALKNLILPGIGSFAVVDDTSVDFSMDGM 69

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD--------FQAAVFTD 730
           NF    D  GK+RA  +   LQ+LN +V +  L  E+S E L D        F   + ++
Sbjct: 70  NFFIQYDQEGKSRARCTASLLQQLNPNVEMEYL--EMSPEALIDKNIEYFSKFSVVLSSN 127

Query: 731 IRLEKAMEFDDYCHNHQPPI 790
           ++ +     ++Y  +H+ P+
Sbjct: 128 LKEKPLFRLEEYLRSHKIPL 147



>pir|AH0932|AH0932 thiamin biosynthesis protein [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016845_347441 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 12 of 16 of
           the complete genome.>gb:AL627279_543776 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 15/20.>gb:AE014613_984773
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 252

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 2/110 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     E  ++L  S+VLI G+ GLG   A  L  AG+ ++TL D+ +
Sbjct: 3   DRDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGTLTLADDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
           V L +L    +F+ DD+ ++++  + Q L  LN  + + +L   L  + L
Sbjct: 63  VHLSNLQRQILFTTDDIARSKSQVAQQHLTRLNPDIELVSLQQRLKGDAL 112



>pir|C81953|C81953 ThiF protein NMA0373 [imported] - Neisseria
           meningitidis  (strain Z2491 serogroup
           A)>gb:NMA2Z2491_153328 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 2/7.
          Length = 256

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 28/89 (31%), Positives = 49/89 (55%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G E  ++L  +++L+ G  GLG      L  +G+ ++T+ D   VEL +L     F E D
Sbjct: 26  GIEGQQKLSAAHILVVGCGGLGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGD 85

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNEL 685
           VGK +  A   +L+ +N++V + T+  +L
Sbjct: 86  VGKLKTEALADRLRHINHTVDVRTINEKL 114



>gb:AE017282_428928 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 248

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 37/115 (32%), Positives = 55/115 (47%), Gaps = 9/115 (7%)
 Frame = +2

Query: 404 QLAVYGRETMR---------RLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           QL  Y R+ M          RL G++ LI G+ GLG   A  L  AGV  + + D   V+
Sbjct: 5   QLLRYSRQIMLPEVDAGGQDRLLGASALIVGLGGLGSPAAMYLASAGVGRLVISDFDAVD 64

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
           L +L     F   D+G+++A A   +L+ +N  V I  +   LS   L ++  AV
Sbjct: 65  LSNLQRQIAFDTADIGRSKAEACAGRLRRMNPDVRIEPVAERLSAAALEEWAGAV 119



>gb:AE009801_255854 Pyrobaculum aerophilum strain IM2 section 56 of
           201 of the complete genome.>gb:AE009441_898480
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 246

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 39/159 (24%), Positives = 76/159 (47%)
 Frame = +2

Query: 389 DLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           D +SRQ+ V G E  +++  ++V + G+ GLG  IA+ +   G K + L D   V + D+
Sbjct: 5   DRYSRQIPVIGEEGQKKIGRTSVAVFGVGGLGTLIARYVAGGGFKKLVLVDFDTVSIPDI 64

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
               +++  DVGK +A  + + L  +N  V +  +   +S +      + V  DI ++  
Sbjct: 65  HRQILYTSHDVGKPKAEVAARVLSAVNPEVEVVPVAEPISPDLADRIMSEV--DIAVD-- 120

Query: 749 MEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVL 865
              D++   H    A ++     + G+V   +G   T++
Sbjct: 121 -ALDNWASRHVVNAAAVRKGKALIHGAVQEWYGHVTTII 158



>gb:AE017346_1757224 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 662

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 29/102 (28%), Positives = 56/102 (54%), Gaps = 1/102 (0%)
 Frame = +2

Query: 410 AVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFS 589
           A+ G E  +++  + VL+ G  G+G E+ KNL+L G  ++ + D   ++L +L+  F+F 
Sbjct: 9   ALLGPEVYKKVRETKVLVVGAGGIGCELLKNLVLVGFANIEIIDLDTIDLSNLNRQFLFR 68

Query: 590 EDDVGKNRALASVQKLQELN-NSVIISTLTNELSKEQLSDFQ 712
           + D+ K++AL +       N NS I     +   K+ ++D +
Sbjct: 69  KPDISKSKALVAAATAHHFNPNSGININARHGNVKDSVNDLE 110



>gb:AE017000_375697 Bacillus cereus ATCC 14579 section 3 of 18 of
           the complete genome.>gb:AE016877_1015947 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 339

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 35/126 (27%), Positives = 68/126 (53%), Gaps = 4/126 (3%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   +  G E  +++   +VLI G   LG   A+  + AGV  +T+ D   V+  +L
Sbjct: 5   YSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGKITIVDRDYVDWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
               +++E DV  N  +A+A+ ++L+E+N+ V I  L  +++ E+L +    +  D+ ++
Sbjct: 65  QRQQLYAESDVKNNLPKAIAAKKRLEEINSDVTIEALVQDVTAEELEEL--VINVDVIID 122

Query: 743 KAMEFD 760
               F+
Sbjct: 123 ATDNFE 128



>gb:AE015685_316816 Shewanella oneidensis MR-1 section 234 of 457 of
           the complete genome.>gb:AE014299_952413 Shewanella
           oneidensis MR-1 complete genome.
          Length = 300

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 41/130 (31%), Positives = 64/130 (49%), Gaps = 2/130 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +   G   + +L   +V+I G  GLG   A+ L  AG+ S+TL D+  
Sbjct: 13  DKDFIRYSRQIFLPEVGEAGLLQLKQCHVVIIGCGGLGQLAAQYLACAGIGSITLVDDDR 72

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD 730
           VEL +L    +F+E D+G+ +A  + QKL  L     +      L+ +      A V T 
Sbjct: 73  VELSNLPRQLLFNEADIGQYKAWVAKQKLAVLAPDCQLFAFVQMLTLDSAESLLAHVATA 132

Query: 731 IRLEKAMEFD 760
            R + A+  D
Sbjct: 133 NRQQSALLLD 142



>pir|S11900|S11900 hypothetical protein 1 - Anabaena
           sp.>gb:ASHESAB_582707 Anabaena hesA and hesB genes.
          Length = 266

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 33/116 (28%), Positives = 61/116 (52%)
 Frame = +2

Query: 416 YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSED 595
           +G    +RL  + VL++G+ GLG   A  L +AGV  + L   G++ L D++   + ++D
Sbjct: 6   FGEAAQKRLKSATVLVTGVGGLGGTAALYLAVAGVGRLILVRGGDLRLDDMNRQVLMTDD 65

Query: 596 DVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEFDD 763
            VGK R   + + LQ +N  + I T+ + ++ E +     +   D+ L+ A  F +
Sbjct: 66  WVGKPRVFKAKETLQAINPDIQIETIHDYITSENVDSLVQS--ADMALDCAHNFTE 119



>pir|AE0455|AE0455 thiamin biosynthesis protein ThiF [imported] -
           Yersinia pestis (strain CO92)>gb:AE013650_298820
           Yersinia pestis KIM section 50 of 415 of the complete
           genome.>gb:AE017138_388851 Yersinia pestis biovar
           Medievalis str. 91001 section 12 of 16 of the complete
           genome.>gb:AJ414158_525498 Yersinia pestis strain CO92
           complete genome; segment 18/20.>gb:BX936398_834933
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_929003 Yersinia pestis KIM
           complete genome.>gb:AE017042_1145417 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 265

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 13/117 (11%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQL +   G E  R+L G++VLI G+ GLG   A  L  AGV  + L D+  ++L +L
Sbjct: 15  YSRQLLLEDIGPEGQRKLKGASVLIVGLGGLGSPAALYLAAAGVGQLLLADDDQLDLTNL 74

Query: 569 SSNFVFSEDDVGK-----------NRALASVQKLQELNNSVIISTLTNELSKEQLSD 706
               ++   D+G+           N+A  + + LQ+LN  + I  L   L+ + L+D
Sbjct: 75  QRQILYRTADIGQTLSNPTSSVSHNKARLAQRHLQQLNPQIRIVALDTRLTGQVLTD 131



>sp|P18500|HESA_ANASP Protein hesA.>pir|AE1985|AE1985 HesA protein
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682423 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 252

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 33/116 (28%), Positives = 61/116 (52%)
 Frame = +2

Query: 416 YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSED 595
           +G    +RL  + VL++G+ GLG   A  L +AGV  + L   G++ L D++   + ++D
Sbjct: 6   FGEAAQKRLKSATVLVTGVGGLGGTAALYLAVAGVGRLILVRGGDLRLDDMNRQVLMTDD 65

Query: 596 DVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEFDD 763
            VGK R   + + LQ +N  + I T+ + ++ E +     +   D+ L+ A  F +
Sbjct: 66  WVGKPRVFKAKETLQAINPDIQIETIHDYITSENVDSLVQS--ADMALDCAHNFTE 119



>gb:BX897675_1644354 Neurospora crassa DNA linkage group IV BAC
           clone B2E7.
          Length = 547

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 46/97 (47%), Gaps = 2/97 (2%)
 Frame = +2

Query: 374 PDIDEDLHSRQLAVYGRETMRRLFGSNVLI--SGMKGLGVEIAKNLILAGVKSVTLHDEG 547
           P   E  + RQL ++       L  +N+L+  SG   +GVE  KNLIL G+    +HD  
Sbjct: 16  PSDKERKYDRQLRLWAASGQAALESANILLVNSGAGTVGVETLKNLILPGIGRFVIHDNA 75

Query: 548 NVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
            V+  DL  NF   +   GK RA      L ELN  V
Sbjct: 76  LVDEADLGVNFFLDDSCYGKPRAQCLASLLGELNPEV 112



>gb:U40187_1403273 Caenorhabditis elegans cosmid F11H8, complete
           sequence.
          Length = 430

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 26/77 (33%), Positives = 46/77 (59%)
 Frame = +2

Query: 413 VYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSE 592
           V G E    L  + +L+ G  GLG E+ KNL L+G +++ + D   +++ +L+  F+F E
Sbjct: 31  VPGPENFEALQNTKILVIGAGGLGCELLKNLALSGFRTIEVIDMDTIDVSNLNRQFLFRE 90

Query: 593 DDVGKNRALASVQKLQE 643
            DVGK++A  +   +Q+
Sbjct: 91  SDVGKSKAEVAAAFVQQ 107



>gb:PPU65651_1395663 Physarum polycephalum ubiquitin-activating
           enzyme (ubaA) mRNA, partial cds.
          Length = 427

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 29/84 (34%), Positives = 53/84 (63%)
 Frame = +2

Query: 374 PDIDEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNV 553
           PD  E+ HS++L       +++ F  +VL+ G  GLG EI KNL L+G +++ + D   +
Sbjct: 21  PDTQENPHSKKL-------LQQDF--HVLVIGAGGLGCEILKNLALSGFRNIDVIDMDTI 71

Query: 554 ELWDLSSNFVFSEDDVGKNRALAS 625
           ++ +L+  F+F + DVG ++A+A+
Sbjct: 72  DISNLNRQFLFRQSDVGNSKAIAA 95



>gb:CP000020_871785 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 249

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 15/149 (10%)
 Frame = +2

Query: 389 DLHSRQLAVYGRETMRRLF---------GSNVLISGMKGLGVEIAKNLILAGVKSVTLHD 541
           +L   ++  Y R+ + R F          S++LI G  GLG   ++ L  AGV ++TL D
Sbjct: 3   ELTDNEMLRYNRQIILRNFDFDGQEALKASSILIIGAGGLGCASSQYLAAAGVGTLTLVD 62

Query: 542 EGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAV 721
           +  VEL +L    +  ++ +G  + +++   L  +N +  I+T+   LS ++L  F A+ 
Sbjct: 63  DDTVELSNLQRQVLHCDETIGVKKVMSAKMALNRINPNCHINTVDKRLSDDELRSFIAS- 121

Query: 722 FTDIRLEKAMEFDD------YCHNHQPPI 790
             D+ L+     D        CH  + P+
Sbjct: 122 -HDLVLDGTDNVDTRNQLNRLCHESKTPL 149



>pir|T16037|T16037 hypothetical protein F11H8.1 - Caenorhabditis
           elegans
          Length = 437

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 26/77 (33%), Positives = 46/77 (59%)
 Frame = +2

Query: 413 VYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSE 592
           V G E    L  + +L+ G  GLG E+ KNL L+G +++ + D   +++ +L+  F+F E
Sbjct: 31  VPGPENFEALQNTKILVIGAGGLGCELLKNLALSGFRTIEVIDMDTIDVSNLNRQFLFRE 90

Query: 593 DDVGKNRALASVQKLQE 643
            DVGK++A  +   +Q+
Sbjct: 91  SDVGKSKAEVAAAFVQQ 107



>gb:BA000043_737203 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 341

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 4/126 (3%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   A  G E  +++ G +V++ G   LG   A+ L+ AG+  +T+ D   VE  +L
Sbjct: 5   YSRQQLFAPIGEEGQKKIRGKHVVLVGAGALGTGNAEALVRAGIGKLTIIDRDYVEWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
               ++SE D  +   +A+A+ ++L+++N+ V I  +  +   E+L         D+ ++
Sbjct: 65  QRQQLYSEADAKERLPKAIAAKRRLEQINSEVEIEAIVGDAGPEELETIALKQRPDLWID 124

Query: 743 KAMEFD 760
               FD
Sbjct: 125 ATDNFD 130



>gb:AP008226_578801 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 271

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 37/117 (31%), Positives = 64/117 (54%), Gaps = 6/117 (5%)
 Frame = +2

Query: 389 DLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELW 562
           D + RQ+ +   G E   RL  ++V++ G  GLGV + + L+ AGV  V + +   VE+ 
Sbjct: 9   DRYHRQMILPQVGPEGQERLKRASVVVVGAGGLGVPVLQYLVAAGVGRVGVVEMDRVEVS 68

Query: 563 DLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST----LTNELSKEQLSDFQAAV 721
           +L    +++ +DVG+ +AL + ++LQ LN  V +      LT+E + E L  +   V
Sbjct: 69  NLHRQVLYTTEDVGEPKALVAQKRLQALNPLVRVEAYPVRLTSENALEILRPYDLVV 125



>gb:AE017304_436613 Thermus thermophilus HB27 section 4 of 7 of the
           complete genome.>gb:AE017221_1078591 Thermus
           thermophilus HB27 complete genome.
          Length = 271

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 37/117 (31%), Positives = 64/117 (54%), Gaps = 6/117 (5%)
 Frame = +2

Query: 389 DLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELW 562
           D + RQ+ +   G E   RL  ++V++ G  GLGV + + L+ AGV  V + +   VE+ 
Sbjct: 9   DRYHRQMILPQVGPEGQERLKRASVVVVGAGGLGVPVLQYLVAAGVGRVGVVEMDRVEVS 68

Query: 563 DLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST----LTNELSKEQLSDFQAAV 721
           +L    +++ +DVG+ +AL + ++LQ LN  V +      LT+E + E L  +   V
Sbjct: 69  NLHRQVLYTTEDVGEPKALVAQKRLQALNPLVRVEAYPVRLTSENALEILRPYDLVV 125



>gb:PFMAL8P1_1192168 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1218

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 5/132 (3%)
 Frame = +2

Query: 452 NVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQ 631
           N+L+ G  GLG E+ KNLI   +K++ + D   VE+ +L     FS DD+GK +      
Sbjct: 14  NILVVGCGGLGNEVIKNLIFLHIKNICIVDYDIVEVSNLQRQLFFSHDDIGKYKVDVISY 73

Query: 632 KLQE--LNNSVIISTLTNELSKEQLS---DFQAAVFTDIRLEKAMEFDDYCHNHQPPIAF 796
           K++E  ++ ++ I +  N + +   S   DF   +     ++  +  ++  +N +  I +
Sbjct: 74  KIKETYMHENICIKSYKNHIEEFDTSFFEDFDYIIGCLDNIKGRIYLNNIIYNLRKDIIY 133

Query: 797 IKTEVCGLFGSV 832
           I   + G  G+V
Sbjct: 134 IDGGIEGFKGNV 145



>gb:AE017355_461964 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.>gb:CP000001_851268 Bacillus
           cereus ZK, complete genome.
          Length = 339

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 33/108 (30%), Positives = 62/108 (57%), Gaps = 4/108 (3%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   +  G E  +++   +VLI G   LG   A+  + AGV +VT+ D   V+  +L
Sbjct: 5   YSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSD 706
               +++E DV  N  +A+A+ ++L+E+N+ V +  L  +++ E+L +
Sbjct: 65  QRQQLYAESDVENNLPKAVAAKKRLEEINSEVRVKALVQDVTAEELEE 112



>gb:STYSTMF1_195070 Salmonella typhimurium fragment
           STMF1.>gb:AE008894_245763 Salmonella typhimurium LT2,
           section 198 of 220 of the complete
           genome.>gb:AE006468_1002845 Salmonella typhimurium LT2,
           complete genome.
          Length = 252

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 39/124 (31%), Positives = 64/124 (51%), Gaps = 2/124 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           D D   +SRQ+ +     E  ++L  S+VLI G+ GLG   A  L  AG+  +TL D+ +
Sbjct: 3   DHDFMRYSRQILLGDIAIEGQQKLLNSHVLIVGLGGLGSPAALYLAGAGIGKLTLVDDDD 62

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTD 730
           V L +L    +F+ DD+   +A A+  +L +LN    +  L   L+ + L +  A    D
Sbjct: 63  VHLSNLQRQILFTTDDIAHPKAQAAKLRLAQLNPGSKLIVLQQRLTGDVLKN--AVAHAD 120

Query: 731 IRLE 742
           + L+
Sbjct: 121 VVLD 124



>gb:CR382130_1662556 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 605

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/92 (29%), Positives = 52/92 (56%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSS 574
           HS     +G+E +  +  S+VL+ G  G+G E+ KNL+L G   +T+ D   V+L +L+ 
Sbjct: 7   HSDLERTFGKEAVATIASSHVLLVGAGGVGCEMLKNLVLLGFGKITVLDLDTVDLSNLNR 66

Query: 575 NFVFSEDDVGKNRALASVQKLQELNNSVIIST 670
            F+F  + + + +++ +    Q+ N  V I++
Sbjct: 67  QFLFGHEHIKQPKSVVARATAQKFNPHVDITS 98



>gb:AF167538_484959 Trichodesmium sp. IMS101 nif gene cluster,
           partial sequence.
          Length = 273

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 33/125 (26%), Positives = 65/125 (52%), Gaps = 2/125 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ+ +  +G E  +RL  +  +++G+ GLG  +A  L +AG+  + L   G + L D+
Sbjct: 13  YSRQMMLPGFGEEAQQRLKSTTAVVTGVGGLGGTVALYLAVAGIGKLILVRGGELRLDDM 72

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
           +   + ++D VGK R   + + L  +N  + I  +   ++ E +     +   DI ++ A
Sbjct: 73  NRQILMTDDWVGKVRVDKAKETLSAINPDIEIEAVPEYVTAENVDPLVQS--ADIAIDCA 130

Query: 749 MEFDD 763
             FD+
Sbjct: 131 HNFDE 135



>gb:AF003700_467306 Cyanothece PCC 8801 NifK (nifK) gene, partial
           cds; and NifE (nifE), NifN (nifN), NifX (nifX), NifW
           (nifW), HesA (hesA), HesB (hesB), and Fdx (fdx) genes,
           complete cds; and unknown genes.
          Length = 188

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 34/128 (26%), Positives = 68/128 (53%), Gaps = 2/128 (1%)
 Frame = +2

Query: 380 IDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNV 553
           I+ + +SRQ+ +  +G +  ++L  S  L++G+ GLG  +A  L +AG+  + L   G +
Sbjct: 6   IELERYSRQMQLPGFGEKGQKQLKASTALVTGVGGLGGTVALYLAVAGIGKLILVRGGEL 65

Query: 554 ELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
              DL+   + ++D VGK R   + + L ++N  V I  + + ++ E + +       DI
Sbjct: 66  RRDDLNRQILMTDDWVGKPRVFKAKETLSKINPDVEIEAVYDYVTPENVDELVQQ--ADI 123

Query: 734 RLEKAMEF 757
            L+ + +F
Sbjct: 124 ALDCSFDF 131



>gb:AE004969_61656 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 256

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 28/89 (31%), Positives = 48/89 (53%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G E  ++L  +++L+ G  GLG      L  +GV ++T+ D   VEL +L     F E D
Sbjct: 26  GIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVGTLTIADSDTVELHNLQRQVAFDEGD 85

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNEL 685
           VGK +A     +L+ +N++V +  +  +L
Sbjct: 86  VGKPKAETLAGRLKRINHTVDVRAVNEKL 114



>pir|E69845|E69845 thiamin biosynthesis homolog yjbU - Bacillus
           subtilis>gb:BSUB0007_753135 Bacillus subtilis complete
           genome (section 7 of 21): from 1209742 to 1410982.
          Length = 336

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 48/168 (28%), Positives = 83/168 (49%), Gaps = 4/168 (2%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   A  G    ++L  +  +I G   LG   A+ L+ AGV SV + D   VE  +L
Sbjct: 5   YSRQELFAPIGPSGQKKLKEARAVIIGAGALGTASAEMLVRAGVGSVKIADRDYVEWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
               +++EDDV K   +A A+ ++L+ +N+ V ++ L  +++ E +  F+      I ++
Sbjct: 65  QRQQLYTEDDVKKEMPKAAAAERRLRSINSDVDVTGLVMDVTAENI--FELIRDASIIVD 122

Query: 743 KAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVLDVDGEDP 886
            A  F+     +    A +K  +  L+G+    +G  FTV  V G  P
Sbjct: 123 AADNFETRLIVND---AAVKEGIPFLYGACVGSYGLTFTV--VPGSTP 165



>pir|B81010|B81010 thiF protein NMB2062 [imported] - Neisseria
           meningitidis  (strain MC58 serogroup
           B)>gb:AE002556_47438 Neisseria meningitidis serogroup B
           strain MC58 section 198 of 206 of the complete
           genome.>gb:AE002098_897551 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 256

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 28/89 (31%), Positives = 48/89 (53%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G E  ++L  +++L+ G  GLG      L  +GV ++T+ D   VEL +L     F E D
Sbjct: 26  GIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVGTLTIADSDTVELHNLQRQVAFDEGD 85

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNEL 685
           VGK +  A   +L+ +N++V +  +  +L
Sbjct: 86  VGKLKTEALAGRLKRINHTVNVRAVNEKL 114



>sp|Q09810|YABA_SCHPO Hypothetical protein C2G11.10c in chromosome
           I.>pir|S62465|S62465 probable molybdopterin synthase
           sulfurylase - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC2G11_1717640 S.pombe chromosome I cosmid
           c2G11.
          Length = 401

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 9/130 (6%)
 Frame = +2

Query: 338 NGKSPIDCSRNSPDIDEDLHSRQLAVYGRETMRRLFG---------SNVLISGMKGLGVE 490
           N +  I CS N  ++  D +SR    YGR+ +    G         S+VL+ G  GLG  
Sbjct: 2   NPQEKIICSSNGLELSLDEYSR----YGRQMLLSEIGLPGQLSLKRSSVLVIGAGGLGCP 57

Query: 491 IAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIST 670
             + L+ AG+ ++ + D   V+  +L    + S    G ++A+++ Q L++LN +VII+T
Sbjct: 58  AMQYLVAAGIGTLGIMDGDVVDKSNLHRQIIHSTSKQGMHKAISAKQFLEDLNPNVIINT 117

Query: 671 LTNELSKEQL 700
                S   L
Sbjct: 118 YLEFASASNL 127



>sp|Q09765|UBA3_SCHPO Ubiquitin-activating enzyme E1
           3.>pir|T38368|S62414 probable ubiquitin activating
           enzyme - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC24H6_1717387 S.pombe chromosome I cosmid
           c24H6.
          Length = 444

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 23/96 (23%), Positives = 55/96 (57%)
 Frame = +2

Query: 425 ETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVG 604
           ET++  F S +LI G  GLG EI K+L L+G + +++ D   +++ +L+  F+F+E ++ 
Sbjct: 37  ETLKSAFSSKILIIGAGGLGCEILKDLALSGFRDLSVIDMDTIDITNLNRQFLFNESNID 96

Query: 605 KNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQ 712
           + +A  +   + +   S +++    ++  + +  ++
Sbjct: 97  EPKANVAASMIMKRIPSTVVTPFYGKIQDKTIEFYK 132



>gb:CR382125_1657348 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 624

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 25/93 (26%), Positives = 54/93 (58%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G+E+  +L    VL+ G  G+G E+ K+LIL  +  + + D   ++L +L+  F+F + D
Sbjct: 12  GKESFEKLRDMKVLLVGAGGIGCELLKDLILLEIGEIHIVDLDTIDLSNLNRQFLFRKRD 71

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNELSKEQ 697
           + + ++  +++ +Q  +NS ++S   N +  E+
Sbjct: 72  IKQPKSNTAMKAVQRFSNSKLVSYQNNIMDTEK 104



>gb:AY596297_633407 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 271

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 8/179 (4%)
 Frame = +2

Query: 374 PDIDE---DLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLH 538
           PD+D    D +SR + +   G E    L  ++VL+ G  GLG  + + L  AG+  + + 
Sbjct: 3   PDLDPEQLDRYSRHIIMNDVGPEGQATLLDTDVLVIGAGGLGAPVLQYLAAAGIGRLGIV 62

Query: 539 DEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAA 718
           D+  VE  +L    +  +DDVG+++  ++ + +  LN  V +      L++E  +D  A 
Sbjct: 63  DDDVVERSNLQRQVIHKDDDVGRSKVDSAAEFVTGLNPDVTVDRHELRLARENATDLVAD 122

Query: 719 VFTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCD---FGPEFTVLDVDGEDP 886
              DI ++ +  F            F+  + C L G+ F     F  E  V    G+ P
Sbjct: 123 Y--DIVVDASDNF---------ATRFLVNDACTLSGTPFSHGAIFQFEGQVTTFSGDSP 170



>gb:AJ627421_527934 Uncultured crenarchaeote genomic fragment 68f19.
          Length = 448

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 31/107 (28%), Positives = 62/107 (57%), Gaps = 4/107 (3%)
 Frame = +2

Query: 383 DEDL--HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           +EDL  +SRQ+ +   G   + +L  + V + G+ G+G  +   L   GV  + + D   
Sbjct: 98  NEDLQRYSRQIMLEEIGFVGLEKLRKAKVCVVGVGGIGNPVVTQLTAMGVGKLKIVDRDI 157

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSK 691
           +E+ +L    +++E+D+GK +  A+ ++L+++N+SV I  L N ++K
Sbjct: 158 IEISNLHRQHLYTENDLGKVKVEAAKERLEKINSSVEIEALPNSVTK 204



>gb:AE017026_380986 Bacillus anthracis str. Ames section 3 of 18 of
           the complete genome.>gb:AE017225_406102 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450835 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1010691 Bacillus
           anthracis str. Ames complete genome.
          Length = 339

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 33/108 (30%), Positives = 61/108 (56%), Gaps = 4/108 (3%)
 Frame = +2

Query: 395 HSRQ--LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ   +  G E  +++   +VLI G   LG   A+  + AGV +VT+ D   V+  +L
Sbjct: 5   YSRQELFSPIGEEGQQKIRKKHVLIIGAGALGSANAEMFVRAGVGTVTIVDRDYVDWSNL 64

Query: 569 SSNFVFSEDDVGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSD 706
               ++ E DV  N  +A+A+ ++L+E+N+ V +  L  +++ E+L +
Sbjct: 65  QRQQLYVESDVENNLPKAVAAKKRLEEINSEVRVKALVQDVTAEELEE 112



>gb:BX957222_844487 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 239

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 28/134 (20%), Positives = 69/134 (51%), Gaps = 2/134 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+ +  +G    ++L  + V + G+ GLG  +++ L  AGV ++ L D   VEL +L
Sbjct: 6   YKRQILMDDFGELGQKKLLDATVTVVGVGGLGTVVSQYLAAAGVGNLKLVDYQEVELSNL 65

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
           +   +  E D+G  + +++ +KL+ +N+ + I     ++++  + +    +      E  
Sbjct: 66  NRQILHFEKDIGIKKVISAKEKLESINSEINIEIYPEKVNENHIKNSDVIIDCLDNFEAR 125

Query: 749 MEFDDYCHNHQPPI 790
              +++ + ++ P+
Sbjct: 126 YLLNNFSNKYKIPL 139



>gb:AE017013_379584 Bacillus cereus ATCC 14579 section 16 of 18 of
           the complete genome.>gb:AE016877_1019834 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 337

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 40/168 (23%), Positives = 80/168 (47%), Gaps = 8/168 (4%)
 Frame = +2

Query: 386 EDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           ++ +SRQ+     G E  R++   +VLI G   LG   A+ ++ AGV  VT+ D   VE 
Sbjct: 2   QERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKVTIADRDYVEW 61

Query: 560 WDLSSNFVFSEDDVG--KNRALASVQKLQELNNSV----IISTLTNELSKEQLSDFQAAV 721
            +L    +++E+D    K +A+A+ + L+ +N+ V    +++ +T +  +E ++D    +
Sbjct: 62  SNLQRQQLYTEEDAKQYKPKAIAAAEHLKAINSEVEINPVVTDVTVQEMEELVNDVDLIL 121

Query: 722 FTDIRLEKAMEFDDYCHNHQPPIAFIKTEVCGLFGSVFCDFGPEFTVL 865
                 E  +  +D    +  P          ++G     +G  +T+L
Sbjct: 122 DATDNFETRLLINDISQKYNIP---------WIYGGCVGSYGVTYTIL 160



>gb:AY683450_1622171 Lemna minor ubiquitin activating enzyme E1
           (UBA2) mRNA, partial cds.
          Length = 225

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 35/143 (24%), Positives = 66/143 (46%), Gaps = 11/143 (7%)
 Frame = +2

Query: 395 HSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKS---VTLHDEGNVELWD 565
           +  Q++V+G +  ++L  + V + G   LG E  KNL L GV S   + + D+  +E  +
Sbjct: 28  YDAQISVFGSKLQKKLEQAKVFLVGAGALGCEFLKNLALMGVSSNGELIVTDDDIIEKSN 87

Query: 566 LSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRL-- 739
           LS  F+F + ++G+ ++  +      +N  + +  L N +S +    F  A +  + L  
Sbjct: 88  LSRQFLFRDWNIGQPKSTVAAAAAAAINPGLQVEALQNRVSPDTEDVFNDAFWESLDLVV 147

Query: 740 ------EKAMEFDDYCHNHQPPI 790
                 +  M  D  C   Q P+
Sbjct: 148 NALDNVKARMYVDQKCVYFQKPL 170



>gb:AE017279_426066 Bacillus cereus ATCC 10987, section 16 of 18 of
           the complete genome.>gb:AE017194_1064485 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 337

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 34/129 (26%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = +2

Query: 386 EDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           ++ +SRQ+     G E  R++   +VLI G   LG   A+ ++ AGV  +T+ D   VE 
Sbjct: 2   QERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEW 61

Query: 560 WDLSSNFVFSEDDVG--KNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
            +L    +++E+D    K +A+A+ + L+ +N+ V I+ +  +++ +++ +    V  D+
Sbjct: 62  SNLQRQQLYTEEDATQYKPKAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVNGV--DL 119

Query: 734 RLEKAMEFD 760
            L+    F+
Sbjct: 120 ILDATDNFE 128



>gb:AE016925_359219 Chromobacterium violaceum ATCC 12472 section 16
           of 16 of the complete genome.>gb:AE016825_1044373
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 253

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 36/121 (29%), Positives = 55/121 (45%), Gaps = 9/121 (7%)
 Frame = +2

Query: 383 DEDLHSRQLAVYGRETM---------RRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTL 535
           D +L    L  Y R  +         RRL  +  LI G  GLG   A  L  AGV  +T+
Sbjct: 3   DRELDDEALLRYSRHILLPEIDIAGQRRLLAARALIVGAGGLGSPAALYLASAGVGRITI 62

Query: 536 HDEGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQA 715
            D+  VEL +L          +G+ +A ++ +++  LN ++    L   LS ++L D  A
Sbjct: 63  VDDDAVELSNLQRQIAHDTASLGQGKAASAARRMLALNPTIEARPLAERLSGQRLMDEVA 122

Query: 716 A 718
           A
Sbjct: 123 A 123



>gb:CP000009_864225 Gluconobacter oxydans 621H, complete genome.
          Length = 265

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 29/102 (28%), Positives = 55/102 (53%), Gaps = 2/102 (1%)
 Frame = +2

Query: 368 NSPDIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHD 541
           N  D + + +SR + +   G     RL G++VL+ G  GLG  + + L  +G+  + + D
Sbjct: 13  NFSDHELERYSRHILLPQVGAIGQARLRGASVLVVGAGGLGAPLLQQLAASGIGRIGIMD 72

Query: 542 EGNVELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIIS 667
           +  V+L +L    ++  DD+G  +  A+ ++L+ LN  V +S
Sbjct: 73  DDRVDLSNLQRQVLYGTDDIGAFKVEAAAKRLKALNPLVTVS 114



>gb:BA000031_708485 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 260

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 2/104 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+++   G     RL  S+VL+ G  GLG   +  L  AGV  + + D+ +V+  +L
Sbjct: 10  YQRQVSLPEIGESGQARLGQSHVLLIGCGGLGSAASLYLAAAGVGKLVVIDDDHVDSSNL 69

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
               ++ E D+   +  A  Q+L+ LN+ + + T+T  L + QL
Sbjct: 70  QRQVIYREGDIELAKTEAMAQQLRHLNSMIQVRTITKRLDQAQL 113



>gb:AE017355_465746 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.>gb:CP000001_855071 Bacillus
           cereus ZK, complete genome.
          Length = 337

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 34/129 (26%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = +2

Query: 386 EDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           ++ +SRQ+     G E  R++   +VLI G   LG   A+ ++ AGV  +T+ D   VE 
Sbjct: 2   QERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEW 61

Query: 560 WDLSSNFVFSEDDVG--KNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
            +L    +++E+D    K +A+A+ + L+ +N+ V I+ +  +++ +++ +    V  D+
Sbjct: 62  SNLQRQQLYTEEDAKQYKPKAVAAAEHLKAINSEVEINPVVTDVTVQEMEELVKDV--DL 119

Query: 734 RLEKAMEFD 760
            L+    F+
Sbjct: 120 ILDATDNFE 128



>gb:TACID3_196603 Thermoplasma acidophilum complete genome; segment
           3/5.
          Length = 261

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 26/95 (27%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           ++RQ+ +  + ++ + ++  + +L+ G+ G+G  IA  L+ +GVK V L D   V   +L
Sbjct: 8   YARQMVLRQFDKDDIAKIRRARILVVGLGGVGSLIADLLVRSGVKKVVLIDRDYVSSSNL 67

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTL 673
               ++SE+D+G ++  A+ ++LQ++N  V +  +
Sbjct: 68  YRQTLYSEEDIGDSKVEAAKRRLQKVNTEVEVEAI 102



>gb:BX248354_761344 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 1/8.
          Length = 337

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 2/106 (1%)
 Frame = +2

Query: 377 DIDEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGN 550
           +++    +RQL +  +G E   RL    VL+ G  GLG    ++L  AGV S+ L D   
Sbjct: 5   ELERQRVARQLRLPGFGIEQQERLNNGRVLVIGAGGLGSPALQSLAAAGVGSIRLVDNDT 64

Query: 551 VELWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELS 688
           V++ ++    +F   DVG+++   + ++L+ +   + I   T  L+
Sbjct: 65  VDVSNIQRQILFGVGDVGRSKVHVAAERLRAIQPGIRIDARTERLT 110



>gb:AE017039_384899 Bacillus anthracis str. Ames section 16 of 18 of
           the complete genome.>gb:AE017225_409993 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454746 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1014604 Bacillus
           anthracis str. Ames complete genome.
          Length = 337

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 34/129 (26%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = +2

Query: 386 EDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           ++ +SRQ+     G E  R++   +VLI G   LG   A+ ++ AGV  +T+ D   VE 
Sbjct: 2   QERYSRQILFSGVGEEGQRKIREKHVLIIGAGALGAANAEAIVRAGVGKITIADRDYVEW 61

Query: 560 WDLSSNFVFSEDDVG--KNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
            +L    +++E+D    K +A+A+ + L+ +N+ V I+ +  +++ +++ +    V  D+
Sbjct: 62  SNLQRQQLYTEEDAKQYKPKAVAAAEYLKAINSEVEINPVVTDVTVQEMEELVKDV--DL 119

Query: 734 RLEKAMEFD 760
            L+    F+
Sbjct: 120 ILDATDNFE 128



>pir|T39623|T39623 ubiquitin-activating enzyme e1-like - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPBC16H5_1719189
           S.pombe chromosome II cosmid c16H5.
          Length = 628

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 24/93 (25%), Positives = 51/93 (54%)
 Frame = +2

Query: 425 ETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVG 604
           E +R    + VL+ G  G+G E+ KNL+++GVK V + D   ++L +L+  F+F +  V 
Sbjct: 18  EALRNFKSAKVLLVGAGGIGCELLKNLLMSGVKEVHIIDLDTIDLSNLNRQFLFRKKHVK 77

Query: 605 KNRALASVQKLQELNNSVIISTLTNELSKEQLS 703
           + +A+ + +     N +V +      + +++ +
Sbjct: 78  QPKAIVAAKTASSFNPNVKLEAYHANIKEDRFN 110



>gb:SCUAL1G_1710619 S.cerevisiae genes for ubiquitin activating
           enzyme-like protein and transfer RNA-Gly.
          Length = 294

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 22/86 (25%), Positives = 50/86 (58%)
 Frame = +2

Query: 407 LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVF 586
           + + G ++ ++L  S  L+ G  G+G E+ K++IL     + + D   ++L +L+  F+F
Sbjct: 41  VTIIGEDSYKKLRSSRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSNLNRQFLF 100

Query: 587 SEDDVGKNRALASVQKLQELNNSVII 664
            + D+ + ++  +V+ +Q  NNS ++
Sbjct: 101 RQKDIKQPKSTTAVKAVQHFNNSKLV 126



>pir|A49890|A49890 fdxH 5'-region hypothetical protein 1 -
           Plectonema boryanum  (PCC 73110)
          Length = 277

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 17/167 (10%)
 Frame = +2

Query: 395 HSRQLAVYG--RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+ + G   +  RRL     L++G+ GLG   A  L +AG+  + L   G + L D+
Sbjct: 12  YRRQMMLPGFDEDAQRRLKSFTALVTGVGGLGGTAALYLAVAGIGKLILVRGGELRLDDM 71

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
           +   + + D VG+ R   + + L+++N  V +  + + ++ + +     +  TDI L+ A
Sbjct: 72  NRQVLMTHDTVGQPRVFKAKETLEKINPDVEVEAVFDYITPDNVDHLVRS--TDITLDCA 129

Query: 749 MEF------DDYCHNHQPPI---------AFIKTEVCGLFGSVFCDF 844
             F      ++ C  ++ P+         A++ T + G  G + C F
Sbjct: 130 HNFAERDLLNEACVRYRKPMVEAAMDGMEAYLTTILPGQTGCLTCLF 176



>sp|P52488|UBA2_YEAST Ubiquitin-activating enzyme E1-like
           (Polymerase-interacting protein 2).>pir|A57178|A57178
           ubiquitin-activating enzyme homolog UBA2 - yeast
           (Saccharomyces cerevisiae)>gb:SCD9509_1707570
           Saccharomyces cerevisiae chromosome IV cosmids 9481,
           9509, 9926, 9461, and lambda 3641.>gb:SCU17263_1709940
           Saccharomyces cerevisiae Pip2p (PIP2) gene, complete
           cds.>gb:SCUBA2GN_1710622 S.cerevisiae gene for Uba2
           protein.
          Length = 636

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 22/86 (25%), Positives = 50/86 (58%)
 Frame = +2

Query: 407 LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVF 586
           + + G ++ ++L  S  L+ G  G+G E+ K++IL     + + D   ++L +L+  F+F
Sbjct: 8   VTIIGEDSYKKLRSSRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSNLNRQFLF 67

Query: 587 SEDDVGKNRALASVQKLQELNNSVII 664
            + D+ + ++  +V+ +Q  NNS ++
Sbjct: 68  RQKDIKQPKSTTAVKAVQHFNNSKLV 93



>sp|P46037|HESA_PLEBO Protein hesA.>pir|S40167|S40167 hypothetical
           protein 1 - Plectonema boryanum>gb:PBFDX_157383
           P.boryanum fdxH, fdxB genes and ORFs 1 and 2.
          Length = 277

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 17/167 (10%)
 Frame = +2

Query: 395 HSRQLAVYG--RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+ + G   +  RRL     L++G+ GLG   A  L +AG+  + L   G + L D+
Sbjct: 12  YRRQMMLPGFDEDAQRRLKSFTALVTGVGGLGGTAALYLAVAGIGKLILVRGGELRLDDM 71

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
           +   + + D VG+ R   + + L+++N  V +  + + ++ + +     +  TDI L+ A
Sbjct: 72  NRQVLMTHDTVGQPRVFKAKETLEKINPDVEVEAVFDYITPDNVDHLVRS--TDITLDCA 129

Query: 749 MEF------DDYCHNHQPPI---------AFIKTEVCGLFGSVFCDF 844
             F      ++ C  ++ P+         A++ T + G  G + C F
Sbjct: 130 HNFAERDLLNEACVRYRKPMVEAAMDGMEAYLTTILPGQTGCLTCLF 176



>gb:CR382139_1672216 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 437

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 23/64 (35%), Positives = 40/64 (62%)
 Frame = +2

Query: 425 ETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVG 604
           +  + L  S +L+ G  GLG EI KNL L G +++ L D   +++ +L+  F+F  +D+G
Sbjct: 34  QASKSLTTSAILVIGAGGLGCEILKNLALTGFRNIHLIDMDTIDISNLNRQFLFRPNDIG 93

Query: 605 KNRA 616
           K++A
Sbjct: 94  KSKA 97



>gb:AF038618_1235202 Caenorhabditis elegans cosmid F42G8, complete
           sequence.
          Length = 402

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 2/103 (1%)
 Frame = +2

Query: 383 DEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           D   +SRQL V  +G    + L   NVLI G  GLG  +A  L  AG+ ++ + D  ++ 
Sbjct: 14  DAGRYSRQLLVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIGIVDYDHIS 73

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
           L +L     + ED VGK++A A    ++  N+ + +      L
Sbjct: 74  LDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSL 116



>gb:AE012841_286175 Chlorobium tepidum TLS section 62 of 194 of the
           complete genome.>gb:AE006470_933343 Chlorobium tepidum
           TLS complete genome.
          Length = 247

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 2/109 (1%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           ++R LA+   G     +L  S VL+ G  GLG   A  L  AGV ++ L D   V+L +L
Sbjct: 13  YARHLALPEVGEAGQEKLLHSKVLVIGAGGLGSPAAFYLAAAGVGTIGLMDGDTVDLSNL 72

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQA 715
               + +   VG N+  ++ ++L+ L+ S+ I T    L KE  ++  A
Sbjct: 73  QRQILHTTASVGANKTASAQERLKALDPSIRIETHPFRLRKENATEILA 121



>pir|T32638|T32638 hypothetical protein F42G8.6 - Caenorhabditis
           elegans
          Length = 353

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 2/103 (1%)
 Frame = +2

Query: 383 DEDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVE 556
           D   +SRQL V  +G    + L   NVLI G  GLG  +A  L  AG+ ++ + D  ++ 
Sbjct: 14  DAGRYSRQLLVDDFGVSGQKNLKNLNVLIVGAGGLGCPVATYLGAAGIGTIGIVDYDHIS 73

Query: 557 LWDLSSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNEL 685
           L +L     + ED VGK++A A    ++  N+ + +      L
Sbjct: 74  LDNLHRQVAYKEDQVGKSKAQALADNIKLQNSDLNVQVHNTSL 116



>gb:AE017343_1755438 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 428

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 22/61 (36%), Positives = 39/61 (63%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           + +L+ G  GLG EI +NL L+G   + + D   +++ +L+  F+F E DVGK++AL + 
Sbjct: 48  AKILVIGAGGLGCEILQNLALSGFNDIHVIDMDTIDISNLNRQFLFREADVGKSKALVAA 107

Query: 629 Q 631
           +
Sbjct: 108 E 108



>gb:CNS07EG9_1372888 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 429

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 27/94 (28%), Positives = 50/94 (53%)
 Frame = +2

Query: 455 VLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQK 634
           +L+ G  G+G E+ K L    ++S+TL D   V+L +L+  F F+ DD+GK++A  +   
Sbjct: 6   ILVVGCGGIGCELLKLLAREKLESITLVDSDTVDLSNLNRQFFFNRDDIGKSKATVAAGI 65

Query: 635 LQELNNSVIISTLTNELSKEQLSDFQAAVFTDIR 736
            ++LN    +  +  +     +++F A  F   R
Sbjct: 66  FKKLNERCDVFPICAD-----ITEFDARFFAGYR 94



>gb:CP000001_853881 Bacillus cereus ZK, complete genome.
          Length = 338

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 8/157 (5%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G+E +R     +VLI G   LG   A++ + AG+  +T+ D   VE  +L    ++SE+D
Sbjct: 18  GQEKIRN---KHVLIVGAGALGSASAESFVRAGIGKLTIIDRDYVEWSNLQRQQLYSEED 74

Query: 599 VGKN--RALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKAMEFDDYCH 772
             +   +A+A+  +L++LN+ V I T   +   E L      V  D+ ++    FD    
Sbjct: 75  AREKLPKAIAAKNRLEKLNSEVQIDTFVMDACAENLEGLLENV--DVIIDATDNFD---- 128

Query: 773 NHQPPIAFI------KTEVCGLFGSVFCDFGPEFTVL 865
                I FI      K  +  ++GS    +G  +T++
Sbjct: 129 -----IRFIINDLSQKYNIPWVYGSCVGSYGMSYTII 160



>gb:AF109295_479778 Staphylococcus carnosus NarQ-like protein gene,
           partial cds; galactose operon, complete sequence; and
           molybdenum cofactor biosynthetic gene cluster, complete
           sequence.>gb:A67171_1450242 Sequence 11 from Patent
           EP0805205.
          Length = 333

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 33/126 (26%), Positives = 65/126 (51%), Gaps = 4/126 (3%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SRQ+     G E   ++   +VLI GM  LG  +A  L+ AGV+ +T+ D   +E  +L
Sbjct: 5   YSRQILFKNIGVEGQEKISQKHVLIIGMGALGTHLADGLVRAGVRKLTIVDRDYIEFSNL 64

Query: 569 SSNFVFSEDDVGK--NRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLE 742
               +++E+D  +   + +A+ ++L E+ + + I    ++++   L +   A   D+ L+
Sbjct: 65  QRQTMYTENDAKEALPKVIAAKERLTEIRSDIEIDAYIDQVNPPFLEEH--AQHVDLILD 122

Query: 743 KAMEFD 760
               FD
Sbjct: 123 ATDNFD 128



>gb:AE017340_456530 Idiomarina loihiensis L2TR, complete genome.
          Length = 252

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 27/85 (31%), Positives = 45/85 (52%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G    +RL  S+VLI G+ GLG   ++ L  +GV  +TL D   + L +L    ++S D 
Sbjct: 20  GETGQQRLLKSHVLIIGLGGLGCPASQYLASSGVGQITLVDHDTISLSNLQRQTLYSSDG 79

Query: 599 VGKNRALASVQKLQELNNSVIISTL 673
           +G ++A  +   L  LN  + I+ +
Sbjct: 80  IGLSKAWQAGHSLSRLNPDIRITAI 104



>gb:CR378669_95391 Photobacterium profundum SS9; segment 7/12.
          Length = 248

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 4/134 (2%)
 Frame = +2

Query: 401 RQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNF 580
           RQ    G+E ++    +++LI G  GLG    + L  AGV  +TL D+  VE+ +L    
Sbjct: 19  RQFDFDGQEALK---DASMLILGAGGLGCASTQYLAAAGVGKLTLIDDDKVEVSNLQRQV 75

Query: 581 VFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDF--QAAVFTDI--RLEKA 748
           + +++ VG+ +  ++ Q L  +N    I T+   LS ++L     Q  +  D    +E  
Sbjct: 76  LHTDNTVGQLKVESAKQALTTINPYTSIDTIAQRLSDDELLPLIKQHTIVLDCSDNVETR 135

Query: 749 MEFDDYCHNHQPPI 790
            + +  CH  + P+
Sbjct: 136 NQLNRLCHQTKTPL 149



>pir|F69659|F69659 molybdopterin biosynthesis protein moeB -
           Bacillus subtilis>gb:AF012285_468606 Bacillus subtilis
           mobA-nprE gene region.>gb:BSUB0008_753392 Bacillus
           subtilis complete genome (section 8 of 21): from 1410943
           to 1602922.
          Length = 339

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 49/175 (28%), Positives = 79/175 (45%), Gaps = 8/175 (4%)
 Frame = +2

Query: 386 EDLHSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVEL 559
           E+ +SRQ+     G E  +RL  S+VLI G   LG   A+ L  AGV ++T+ D   VE 
Sbjct: 2   EERYSRQIRFKQIGEEGQKRLADSHVLIVGAGALGTAGAEGLSRAGVGTITIIDRDYVEW 61

Query: 560 WDLSSNFVFSEDD--VGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDI 733
            +L    +++E D  +   +A+A+ + L  +N+ + I     E + E L           
Sbjct: 62  SNLQRQQLYTESDAKLRMPKAMAAKEHLSAINSEIHIEAYVTEGTAETLEPL-------- 113

Query: 734 RLEKAMEFDDYCHNHQPPIAF----IKTEVCGLFGSVFCDFGPEFTVLDVDGEDP 886
            +EKA    D   N +  +       KT+   ++G+     G   TV  + GE P
Sbjct: 114 -IEKADVVIDATDNFETRMLINDLAQKTKTPWVYGACVSSQGMFMTV--IPGETP 165



>gb:AE017353_1760152 Cryptococcus neoformans var. neoformans JEC21
           chromosome 13, complete sequence.
          Length = 560

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 30/92 (32%), Positives = 46/92 (50%)
 Frame = +2

Query: 383 DEDLHSRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELW 562
           +  +HS +L  +     R L  + VL+ G    G +  KNL+L G+   T+         
Sbjct: 34  ERSVHSVRL--WASAGQRSLEQARVLLVGCDAAGSQSLKNLVLPGISQFTILSSKITTAQ 91

Query: 563 DLSSNFVFSEDDVGKNRALASVQKLQELNNSV 658
           D+++NF    D +G N A  SV+ LQELN +V
Sbjct: 92  DVATNFFLHPDSIGSNIAQESVKYLQELNPAV 123



>gb:CR380959_1653716 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 632

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 24/89 (26%), Positives = 50/89 (56%)
 Frame = +2

Query: 398 SRQLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSN 577
           S  + + G E  ++L  +  L+ G  G+G E+ K+L+L  V  + + D   ++L +L+  
Sbjct: 6   SNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLMEVGEIHVVDLDTIDLSNLNRQ 65

Query: 578 FVFSEDDVGKNRALASVQKLQELNNSVII 664
           F+F + D+ K ++  +V  +Q  +NS ++
Sbjct: 66  FLFRQKDIKKPKSAIAVNAVQSFSNSKLV 94



>gb:AE016800_335709 Vibrio vulnificus CMCP6 chromosome I section 4
           of 11 of the complete sequence.>gb:AE016795_1045433
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 278

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 8/140 (5%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+A+  +G      L  ++VLI G  GLG   A  L  AGV  + L D+  VE  +L
Sbjct: 10  YQRQIALTEFGESGQANLLQAHVLIIGCGGLGNAAALYLAAAGVGHLVLVDDDVVEESNL 69

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
                F +  +   +  A  ++L++LN  + + T+++ L +E+L+     +  DI L+  
Sbjct: 70  QRQIAFRQQHLASPKVDALAEQLKQLNAELRVRTISHRLDEERLN--LEVMLADIVLDCT 127

Query: 749 MEF------DDYCHNHQPPI 790
             F      +  C N + P+
Sbjct: 128 DNFPSRQLINQACLNQRTPL 147



>pir|F82439|F82439 molybdopterin biosynthesis MoeB protein VCA0618
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004391_53749 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome II, section 48 of 93 of the
           complete chromosome.>gb:AE003853_1050695 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 254

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 30/98 (30%), Positives = 50/98 (51%)
 Frame = +2

Query: 407 LAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVF 586
           L  +  E   +L  S VLI G  GLG    + L  AG+  +TL D+  VEL +L    + 
Sbjct: 20  LKAFDFEGQEKLKQSTVLILGAGGLGCASGQYLATAGIGHITLVDDDVVELSNLQRQVLH 79

Query: 587 SEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQL 700
            + D+G+ +  ++   L+ LN  + + T+   LS ++L
Sbjct: 80  HDADIGRAKVDSAADSLRLLNPHLQVETIQARLSDDEL 117



>gb:AP001081_1820772 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0693B08.
          Length = 451

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 24/70 (34%), Positives = 44/70 (62%)
 Frame = +2

Query: 455 VLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQK 634
           VL+ G  GLG E+ K+L L+G K++ + D   +++ +L+  F+F   DVGK++A  + ++
Sbjct: 49  VLVVGAGGLGCELLKDLALSGFKNIHVIDMDTIDVSNLNRQFLFRVQDVGKSKAEVAAKR 108

Query: 635 LQELNNSVII 664
           + E  + V I
Sbjct: 109 VMERVSGVNI 118



>gb:BA000037_724031 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 282

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 8/140 (5%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           + RQ+A+  +G      L  ++VLI G  GLG   A  L  AGV  + L D+  VE  +L
Sbjct: 14  YQRQIALTEFGESGQANLLQAHVLIIGCGGLGNAAALYLAAAGVGHLVLVDDDVVEESNL 73

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSVIISTLTNELSKEQLSDFQAAVFTDIRLEKA 748
                F +  +   +  A  ++L++LN  + + T++  L +E+L+     +  DI L+  
Sbjct: 74  QRQIAFRQQHLASPKVDALAEQLKQLNAELRVRTISQRLDEERLN--LEVMLADIVLDCT 131

Query: 749 MEF------DDYCHNHQPPI 790
             F      +  C N + P+
Sbjct: 132 DNFPSRQLINQACLNQRTPL 151



>gb:AE006106_215583 Pasteurella multocida subsp. multocida str. Pm70
           section 73 of 204 of the complete
           genome.>gb:AE004439_1118313 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 238

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +2

Query: 419 GRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDD 598
           G+ET+++   S +LI G+ GLG   ++ L  AGV  +TL D   V L +L    +  +  
Sbjct: 25  GQETLKQ---SKMLIVGLGGLGCAASQYLTTAGVGHLTLLDFDTVSLSNLQRQVLHDDSR 81

Query: 599 VGKNRALASVQKLQELNNSVIISTLTNELSKEQLSD----FQAAVFTDIRLEKAMEFDDY 766
           +   +  ++   LQ LN  + I T+  +LS E+L++    F   +     +E   + D  
Sbjct: 82  LAMPKVDSAKLSLQRLNPHIQIDTINAKLSTEKLAEIIPHFDVILDCTDNIEIRNQLDQV 141

Query: 767 CHNHQPPI 790
           C   + P+
Sbjct: 142 CQQAKVPL 149



>sp|Q9Z1F9|SAE2_MOUSE Ubiquitin-like 2 activating enzyme E1B (SUMO-1
           activating enzyme subunit 2) (Anthracycline-associated
           resistance ARX).>gb:BC054768_2101808 Mus musculus
           ubiquitin-like 1 (sentrin) activating enzyme E1B, mRNA
           (cDNA clone MGC:64757 IMAGE:6415071), complete
           cds.>gb:MMU35833_2120982 Mus musculus
           anthracycline-associated resistance (Arx) mRNA, complete
           cds.
          Length = 638

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 22/76 (28%), Positives = 43/76 (56%)
 Frame = +2

Query: 422 RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV 601
           RE    + G  VL+ G  G+G E+ KNL+L G   + L D   +++ +L+  F+F +  V
Sbjct: 9   RELAEAVSGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV 68

Query: 602 GKNRALASVQKLQELN 649
           G+++A  + + + + +
Sbjct: 69  GRSKAQVAKESVLQFH 84



>gb:AF079566_1881422 Homo sapiens ubiquitin-like protein activating
           enzyme (UBA2) mRNA, complete cds.>gb:AF090384_1882422
           Homo sapiens SUMO-1-activating enzyme E1 C subunit
           (UBA2) mRNA, complete cds.
          Length = 640

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 38/65 (58%)
 Frame = +2

Query: 422 RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV 601
           RE    + G  VL+ G  G+G E+ KNL+L G   + L D   +++ +L+  F+F +  V
Sbjct: 9   RELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV 68

Query: 602 GKNRA 616
           G+++A
Sbjct: 69  GRSKA 73



>gb:AP004772_1844814 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0415B12.
          Length = 274

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 29/90 (32%), Positives = 50/90 (55%), Gaps = 2/90 (2%)
 Frame = +2

Query: 395 HSRQLAV--YGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDL 568
           +SR L +  +G E  R+L  S++L+ G  GLG  +A  L   GV  + + D  +VEL +L
Sbjct: 81  YSRHLLLPDFGVEGQRKLSQSSILVVGAGGLGSPVALYLAACGVGCLGIVDGDDVELNNL 140

Query: 569 SSNFVFSEDDVGKNRALASVQKLQELNNSV 658
               +  E  VGK++  ++    +E+N+S+
Sbjct: 141 HRQIIHKEAFVGKSKVKSAADACREINSSI 170



>gb:AX880168_1478156 Sequence 15073 from Patent EP1074617.
          Length = 640

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 38/65 (58%)
 Frame = +2

Query: 422 RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV 601
           RE    + G  VL+ G  G+G E+ KNL+L G   + L D   +++ +L+  F+F +  V
Sbjct: 9   RELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV 68

Query: 602 GKNRA 616
           G+++A
Sbjct: 69  GRSKA 73



>gb:AF218864_1252107 Drosophila melanogaster Smt3 activating enzyme
           2 (SAE2) mRNA, complete cds.
          Length = 700

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           S VL+ G  G+G E+ KNL+L+G   + + D   ++L +L+  F+F  + VGK++A  + 
Sbjct: 20  SKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVAR 79

Query: 629 QKLQELN 649
           +     N
Sbjct: 80  ESALSFN 86



>gb:AF193553_1249725 Drosophila melanogaster ubiquitin-like protein
           activating enzyme (Uba2) mRNA, complete cds.
          Length = 700

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           S VL+ G  G+G E+ KNL+L+G   + + D   ++L +L+  F+F  + VGK++A  + 
Sbjct: 20  SKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVAR 79

Query: 629 QKLQELN 649
           +     N
Sbjct: 80  ESALSFN 86



>gb:AE014296_1135261 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003556_1215397 Drosophila melanogaster
           chromosome 3L, section 29 of 83 of the complete
           sequence.>gb:AY113361_1299309 Drosophila melanogaster
           LD22577 full insert cDNA.
          Length = 700

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/67 (32%), Positives = 39/67 (58%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           S VL+ G  G+G E+ KNL+L+G   + + D   ++L +L+  F+F  + VGK++A  + 
Sbjct: 20  SKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLNRQFLFHREHVGKSKARVAR 79

Query: 629 QKLQELN 649
           +     N
Sbjct: 80  ESALSFN 86



>pir|T46936|T46936 hypothetical protein DKFZp434H239.1 -
           human>gb:HSM801873_1186529 Homo sapiens mRNA; cDNA
           DKFZp434H239 (from clone DKFZp434H239).
          Length = 640

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 38/65 (58%)
 Frame = +2

Query: 422 RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV 601
           RE    + G  VL+ G  G+G E+ KNL+L G   + L D   +++ +L+  F+F +  V
Sbjct: 9   RELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV 68

Query: 602 GKNRA 616
           G+++A
Sbjct: 69  GRSKA 73



>pir|T51083|T51083 related to ubiquitin-activating enzyme homolog
           UBA2 [imported] - Neurospora crassa>gb:NCB2A19_1689971
           Neurospora crassa DNA linkage group II BAC clone B2A19.
          Length = 641

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 24/72 (33%), Positives = 43/72 (59%)
 Frame = +2

Query: 449 SNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASV 628
           + VL+ G  G+G E+ KNL+L G   V + D   ++L +L+  F+F  + + K++AL + 
Sbjct: 29  ARVLMVGAGGIGCELLKNLVLTGFGEVHVVDLDTIDLSNLNRQFLFRHEHIKKSKALVAK 88

Query: 629 QKLQELNNSVII 664
           +  Q+ N +V I
Sbjct: 89  EAAQKFNPAVKI 100



>sp|Q9UBT2|SAE2_HUMAN Ubiquitin-like 2 activating enzyme E1B (SUMO-1
           activating enzyme subunit 2) (Anthracycline-associated
           resistance ARX) (HRIHFB2115).>gb:AF110957_1884304 Homo
           sapiens SUMO-1 activating enzyme subunit 2 (SAE2) mRNA,
           complete cds.>gb:BC003153_1968731 Homo sapiens SUMO-1
           activating enzyme subunit 2, mRNA (cDNA clone MGC:4115
           IMAGE:2905977), complete cds.>gb:BT009781_1990918 Homo
           sapiens SUMO-1 activating enzyme subunit 2 mRNA,
           complete cds.>gb:CR456756_1992963 Homo sapiens full open
           reading frame cDNA clone RZPDo834B024D for gene UBA2,
           SUMO-1 activating enzyme subunit 2; complete cds, incl.
           stopcodon.>gb:HSU35832_2023764 Human
           anthracycline-associated resistance ARX mRNA, complete
           cds.
          Length = 640

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 22/65 (33%), Positives = 38/65 (58%)
 Frame = +2

Query: 422 RETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDV 601
           RE    + G  VL+ G  G+G E+ KNL+L G   + L D   +++ +L+  F+F +  V
Sbjct: 9   RELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHV 68

Query: 602 GKNRA 616
           G+++A
Sbjct: 69  GRSKA 73



>gb:CR382122_1655215 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 313

 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 24/64 (37%), Positives = 37/64 (57%)
 Frame = +2

Query: 455 VLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRALASVQK 634
           +LI G  GLG EI K L L G+  + + D   +EL +L+  F+FS  D+GK +A  + + 
Sbjct: 8   ILILGAGGLGCEIVKTLALYGLPELHIVDMDTIELTNLNRQFLFSTRDIGKPKASVAAEA 67

Query: 635 LQEL 646
           +  L
Sbjct: 68  INRL 71



>gb:BX571864_786372 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 6/17.
          Length = 352

 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = +2

Query: 437 RLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRA 616
           R+  S V I G  G+G  I+  L  +GV  +TL D+  +EL +L+   +FS++D+G+ + 
Sbjct: 114 RIKKSTVTIIGCGGIGNHISYLLSTSGVGKITLIDDDTIELSNLTRQVLFSQNDIGRKKT 173

Query: 617 LASVQKLQELNNSVIISTLT------NELSKEQLSD 706
               ++L + N+   I T+       N+L K   SD
Sbjct: 174 EVLERELNKRNSETNIETINMFISSINDLYKIPRSD 209



>gb:ECPMC7A_132206 E.coli Plasmid pMccC7 mccA,B,C,D,E,F genes.
          Length = 350

 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 24/79 (30%), Positives = 45/79 (56%)
 Frame = +2

Query: 437 RLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFVFSEDDVGKNRA 616
           +L  + V+I G  G+G  ++  L  +G+  + L D   +E  +L+   +FSEDDVGKN+ 
Sbjct: 112 KLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKT 171

Query: 617 LASVQKLQELNNSVIISTL 673
               ++L + N+ + +S +
Sbjct: 172 EVIKRELLKRNSEISVSEI 190



>gb:CR925677_118149 Ehrlichia ruminantium str. Gardel, complete
           genome.
          Length = 260

 Score = 47.8 bits (112), Expect = 5e-04
 Identities = 25/90 (27%), Positives = 51/90 (56%)
 Frame = +2

Query: 404 QLAVYGRETMRRLFGSNVLISGMKGLGVEIAKNLILAGVKSVTLHDEGNVELWDLSSNFV 583
           ++ V G++   +L  S+VLI G  GLG  +   L  +G+ S+ L D   +++ +L+   +
Sbjct: 13  EVGVVGQD---KLCNSSVLIVGCGGLGSTVIPLLAASGIGSLILSDSDKIQISNLNRQII 69

Query: 584 FSEDDVGKNRALASVQKLQELNNSVIISTL 673
           + E DV  ++ + + + +  LN++V + TL
Sbjct: 70  YKESDVSNSKVVTAAKFVSMLNSAVNVRTL 99


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,126,284,151
Number of Sequences: 1806583
Number of extensions: 22419756
Number of successful extensions: 80432
Number of sequences better than 10.0: 496
Number of HSP's better than 10.0 without gapping: 77300
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 80235
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 96580049916
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)