BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3709
         (1298 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P31542|CLAB_LYCES|CLAB_LYCES ATP-dependent Clp protease ATP-binding subu...   536   e-151   Solanum lycopersicum
sp|P31541|CLAA_LYCES|CLAA_LYCES ATP-dependent Clp protease ATP-binding subu...   521   e-146   Solanum lycopersicum
gb:AF043539_1763745 Spinacia oleracea ClpC protease (clpC) mRNA,...   509   e-143   
sp|P35100|CLPA_PEA|CLPA_PEA ATP-dependent Clp protease ATP-binding subuni...   501   e-140   Pisum sativum [garden pea]
gb:AB017063_1513334 Arabidopsis thaliana genomic DNA, chromosome...   493   e-138   
pir|T52292|T52292 endopeptidase Clp (EC 3.4.21.92) ATP-binding c...   486   e-136   Arabidopsis thaliana [mouse-ear cress]
gb:AY056787_1563836 Arabidopsis thaliana AT3g48870/T21J18_140 mR...   474   e-132   
pir|T52456|T52456 endopeptidase Clp ATP-binding chain C [importe...   474   e-132   Arabidopsis thaliana [mouse-ear cress]
pir|T49283|T49283 AtClpC - Arabidopsis thaliana>gb:AX765872_1474...   473   e-132   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00240_1697237 Oryza sativa genomic DNA, chromosome 4, BAC...   469   e-131   
pir|S37557|S37557 endopeptidase Clp ATP-binding chain A, chlorop...   454   e-126   Brassica napus [oilseed rape]
sp|P46523|CLPA_BRANA|CLPA_BRANA ATP-dependent Clp protease ATP-binding subu...   454   e-126   Brassica napus [oilseed rape]
pir|S76330|S76330 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   404   e-111   Synechocystis sp. PCC 6803
gb:BA000039_726092 Thermosynechococcus elongatus BP-1 DNA, compl...   403   e-111   
pir|S71553|S71553 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   402   e-110   Synechococcus sp.
gb:AP008231_580948 Synechococcus elongatus PCC 6301 DNA, complet...   401   e-110   
gb:AE017164_395563 Prochlorococcus marinus subsp. marinus str. C...   399   e-110   
pir|AH2180|AH2180 endopeptidase Clp ATP-binding chain [imported]...   399   e-110   Nostoc sp. PCC 7120
gb:BA000045_742139 Gloeobacter violaceus PCC 7421 DNA, complete ...   397   e-109   
sp|P51332|CLPC_PORPU|CLPC_PORPU ATP-dependent Clp protease ATP-binding subu...   397   e-109   Porphyra purpurea
gb:BX569691_775840 Synechococcus sp. WH8102 complete genome; seg...   396   e-109   
gb:BX572098_798403 Prochlorococcus marinus MIT9313 complete geno...   394   e-108   
sp|O78410|CLPC_GUITH|CLPC_GUITH ATP-dependent Clp protease ATP-binding subu...   393   e-108   Guillardia theta
gb:AY673996_1621408 Gracilaria tenuistipitata var. liui chloropl...   392   e-108   
gb:BX572092_796714 Prochlorococcus marinus MED4 complete genome;...   391   e-107   
sp|Q9TM05|CLPC_CYACA|CLPC_CYACA ATP-dependent Clp protease ATP-binding subu...   385   e-105   Cyanidium caldarium
gb:AB002583_1508807 Cyanidioschyzon merolae chloroplast DNA, com...   372   e-102   
pir|AE2051|AE2051 endopeptidase Clp ATP-binding chain [imported]...   332   8e-90   Nostoc sp. PCC 7120
gb:AP006618_556806 Nocardia farcinica IFM 10152 DNA, complete ge...   306   5e-82   
gb:AP006840_570319 Symbiobacterium thermophilum DNA, complete ge...   306   6e-82   
gb:BA000030_702584 Streptomyces avermitilis MA-4680 genomic DNA,...   305   1e-81   
pir|T36384|T36384 probable ATP-binding proteinase - Streptomyces...   305   1e-81   Streptomyces coelicolor
gb:BA000030_700486 Streptomyces avermitilis MA-4680 genomic DNA,...   305   2e-81   
gb:AE000516_23831 Mycobacterium tuberculosis CDC1551, complete g...   303   4e-81   
sp|O06286|CLPC_MYCTU|CLPC_MYCTU Probable ATP-dependent Clp protease ATP-bin...   302   9e-81   Mycobacterium tuberculosis
gb:AE017228_411166 Mycobacterium avium subsp. paratuberculosis s...   301   1e-80   
gb:BX248359_763248 Corynebacterium diphtheriae gravis NCTC13129,...   300   4e-80   
gb:MLPUTATP_148776 Mycobacterium leprae DNA for putative atp ope...   298   2e-79   
pir|S11163|S11163 endopeptidase Clp ATP-binding chain C - Mycoba...   298   2e-79   Mycobacterium leprae
sp|P24428|CLPC_MYCLE|CLPC_MYCLE Probable ATP-dependent Clp protease ATP-bin...   298   2e-79   Mycobacterium leprae
gb:BA000043_736655 Geobacillus kaustophilus HTA426 DNA, complete...   296   6e-79   
gb:AE016822_341056 Leifsonia xyli subsp. xyli str. CTCB07, compl...   295   1e-78   
gb:BA000035_717310 Corynebacterium efficiens YS-314 DNA, complet...   295   1e-78   
gb:BA000036_720405 Corynebacterium glutamicum ATCC 13032 DNA, co...   295   2e-78   
pir|G83662|G83662 class III stress response-related ATPase clpC ...   294   3e-78   Bacillus halodurans
gb:BA000028_694480 Oceanobacillus iheyensis HTE831 DNA, complete...   292   1e-77   
sp|P37571|CLPC_BACSU|CLPC_BACSU Negative regulator of genetic competence cl...   292   1e-77   Bacillus subtilis
gb:CP000001_850713 Bacillus cereus ZK, complete genome.               291   3e-77   
gb:AE016998_375140 Bacillus cereus ATCC 14579 section 1 of 18 of...   290   4e-77   
gb:AE017333_446040 Bacillus licheniformis DSM 13, complete genom...   289   8e-77   
gb:AE017283_430068 Propionibacterium acnes KPA171202, complete g...   289   8e-77   
gb:AE017024_380377 Bacillus anthracis str. Ames section 1 of 18 ...   289   8e-77   
gb:AE016850_348589 Tropheryma whipplei str. Twist, section 1 of ...   288   2e-76   
gb:AE017322_442682 Listeria monocytogenes str. 4b F2365, section...   285   1e-75   
gb:LMU40604_141661 Listeria monocytogenes ClpC ATPase (mec) gene...   285   1e-75   
pir|AI1103|AI1103 endopeptidase Clp ATP-binding chain C [importe...   285   1e-75   Listeria monocytogenes
gb:AX065707_1459767 Sequence 51 from Patent WO0100842.                285   1e-75   
pir|AI1465|AI1465 endopeptidase Clp ATP-binding chain C [importe...   285   1e-75   Listeria innocua
sp|P49574|CLPC_ODOSI|CLPC_ODOSI ATP-dependent Clp protease ATP-binding subu...   284   2e-75   
gb:AP006627_562448 Bacillus clausii KSM-K16 DNA, complete genome.     282   1e-74   
gb:CP000027_79071 Dehalococcoides ethenogenes 195, complete genome.   280   4e-74   
gb:AF497482_516550 Micromonospora echinospora calicheamicin bios...   276   5e-73   
gb:AE013175_289893 Thermoanaerobacter tengcongensis MB4, section...   275   1e-72   
gb:AE014295_310749 Bifidobacterium longum NCC2705, complete genome.   275   1e-72   
gb:AE015945_321644 Clostridium tetani E88, section 10 of 10 of t...   273   7e-72   
pir|C97292|C97292 ATPases with chaperone activity clpC, two ATP-...   272   1e-71   Clostridium acetobutylicum
gb:BA000033_710772 Staphylococcus aureus subsp. aureus MW2 DNA, ...   272   1e-71   
pir|F89819|F89819 endopeptidase [imported] - Staphylococcus aure...   272   1e-71   Staphylococcus aureus subsp. aureus N315
gb:BX294144_768783 Pirellula sp. strain 1 complete genome; segme...   265   1e-69   
gb:CP000029_80789 Staphylococcus epidermidis RP62A, complete gen...   265   2e-69   
gb:BX908798_831067 Parachlamydia-related symbiont UWE25, complet...   256   5e-67   
pir|T47485|T47485 clpC-like protein - Arabidopsis thaliana>gb:AT...   253   8e-66   Arabidopsis thaliana [mouse-ear cress]
gb:BA000045_741617 Gloeobacter violaceus PCC 7421 DNA, complete ...   250   4e-65   
pir|H72404|H72404 endopeptidase Clp, ATP-binding chain - Thermot...   247   3e-64   Thermotoga maritima
pir|G72079|G72079 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   246   1e-63   Chlamydia pneumoniae
gb:AF401667_507586 Lactobacillus sakei rrnC operon, partial sequ...   245   1e-63   
gb:AE016995_374418 Chlamydophila caviae GPIC section 2 of 4 of t...   245   2e-63   
sp|Q9Z8A6|CLPC_CHLPN|CLPC_CHLPN Probable ATP-dependent Clp protease ATP-bin...   245   2e-63   Chlamydia pneumoniae
sp|O84288|CLPC_CHLTR|CLPC_CHLTR Probable ATP-dependent Clp protease ATP-bin...   244   2e-63   Chlamydia trachomatis
sp|Q9PKA8|CLPC_CHLMU|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-bin...   244   2e-63   Chlamydia muridarum [agent of mouse pneumonitis]
gb:AE016957_367210 Enterococcus faecalis V583, section 11 of 11 ...   244   4e-63   
pir|C86545|C86545 ClpC proteinase [imported] - Chlamydophila pne...   244   4e-63   Chlamydia pneumoniae
pir|B70412|B70412 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   243   8e-63   Aquifex aeolicus
gb:AL935254_550908 Lactobacillus plantarum strain WCFS1 complete...   236   8e-61   
gb:AE017301_435814 Thermus thermophilus HB27 section 1 of 7 of t...   235   1e-60   
gb:AE017288_432575 Leptospira interrogans serovar Copenhageni st...   231   2e-59   
gb:AE011226_270629 Leptospira interrogans serovar lai str. 56601...   231   2e-59   
sp|Q54316|HLYB_TREHY|HLYB_TREHY Hemolysin B.>gb:SHTLYBA_183460 S.hyodysente...   229   7e-59   Brachyspira hyodysenteriae
pir|D75436|D75436 ATP-dependent Clp proteinase, ATP-binding subu...   223   5e-57   Deinococcus radiodurans
gb:AE017201_403706 Lactobacillus johnsonii NCC 533, section 2 of...   222   1e-56   
gb:AF027500_470374 Aquifex pyrophilus alanyl-tRNA synthetase (al...   211   2e-53   
pir|H72258|H72258 endopeptidase Clp, ATP-binding chain - Thermot...   211   3e-53   Thermotoga maritima
gb:CP000033_88591 Lactobacillus acidophilus NCFM, complete genome.    210   6e-53   
gb:CP000027_80382 Dehalococcoides ethenogenes 195, complete genome.   208   2e-52   
gb:AE012798_285681 Chlorobium tepidum TLS section 19 of 194 of t...   207   4e-52   
gb:BA000016_675481 Clostridium perfringens str. 13 DNA, complete...   206   8e-52   
gb:CR522870_100755 Desulfotalea psychrophila LSv54 chromosome.        202   9e-51   
gb:AE017180_398961 Geobacter sulfurreducens PCA, complete genome.     200   5e-50   
gb:AP004777_1844915 Oryza sativa (japonica cultivar-group) genom...   200   6e-50   
gb:AY166599_1586181 Oryza sativa (indica cultivar-group) ATP-dep...   200   6e-50   
gb:AE014295_312149 Bifidobacterium longum NCC2705, complete genome.   200   6e-50   
gb:SME591791_186626 Sinorhizobium meliloti 1021 complete chromos...   198   2e-49   
pir|S76431|S76431 endopeptidase Clp ATP-binding chain B2 - Synec...   198   2e-49   Synechocystis sp. PCC 6803
gb:ECOPROT_129864 Escherichia coli ATP-dependent protease bindin...   197   3e-49   
gb:BA000040_729664 Bradyrhizobium japonicum USDA 110 DNA, comple...   197   4e-49   
gb:BA000045_743652 Gloeobacter violaceus PCC 7421 DNA, complete ...   196   7e-49   
gb:AE016987_372422 Shigella flexneri 2a str. 2457T section 10 of...   196   7e-49   
gb:ECCLPB_125208 E.coli ClpB gene for an analogue of ATP-depende...   196   7e-49   
gb:AE005674_72237 Shigella flexneri 2a str. 301, complete genome.     196   7e-49   
pir|E85905|E85905 heat shock protein [imported] - Escherichia co...   196   7e-49   Escherichia coli [E. coli]
sp|P03815|CLPB_ECOLI|CLPB_ECOLI ClpB protein (Heat shock protein F84.1).>pi...   196   7e-49   Escherichia coli [E. coli]
gb:PVI488200_162104 Uncultured bacterium gene for putative clp p...   196   1e-48   
gb:BA000035_717394 Corynebacterium efficiens YS-314 DNA, complet...   195   1e-48   
gb:BA000030_705128 Streptomyces avermitilis MA-4680 genomic DNA,...   195   1e-48   
gb:AX065723_1459775 Sequence 67 from Patent WO0100842.                195   2e-48   
gb:AX065721_1459774 Sequence 65 from Patent WO0100842.                195   2e-48   
gb:BX572607_804046 Rhodopseudomonas palustris CGA009 complete ge...   195   2e-48   
gb:CP000026_77274 Salmonella enterica subsp. enterica serovar Pa...   195   2e-48   
pir|AI0831|AI0831 ClpB protein (heat shock protein f84.1) [impor...   195   2e-48   Salmonella enterica subsp. enterica serovar Typhi
sp|P53532|CLPB_CORGL|CLPB_CORGL ClpB protein.>gb:BA000036_720507 Corynebact...   195   2e-48   Corynebacterium glutamicum
pir|A83589|A83589 probable ClpA/B proteinase ATP binding subunit...   194   3e-48   Pseudomonas aeruginosa
gb:AP008226_578944 Thermus thermophilus HB8 genomic DNA, complet...   192   1e-47   
gb:AE017304_436757 Thermus thermophilus HB27 section 4 of 7 of t...   192   1e-47   
gb:TTDNAKOPN_198426 T.thermophilus DnaK operon.                       192   1e-47   
sp|Q9RA63|CLPB_THETH|CLPB_THETH ClpB protein.>gb:AB012390_2043 Thermus ther...   192   1e-47   Thermus thermophilus
gb:AE017175_397368 Porphyromonas gingivalis W83 section 4 of 8 o...   191   2e-47   
gb:AE016776_330064 Pseudomonas putida KT2440 section 3 of 21 of ...   191   2e-47   
sp|P74361|CLPB_SYNY3|CLPB_SYNY3 ClpB protein.>pir|S76197|S76197 endopeptida...   191   2e-47   Synechocystis sp.
gb:AE008692_241162 Zymomonas mobilis subsp. mobilis ZM4, complet...   191   4e-47   
gb:BX572096_797791 Prochlorococcus marinus MIT9313 complete geno...   190   5e-47   
gb:AF061279_474776 Plectonema boryanum heat shock protein (clpB)...   190   5e-47   
gb:AY303998_607429 Meiothermus ruber ClpB-like protein (clpB) ge...   190   6e-47   
gb:AE016858_350282 Pseudomonas syringae pv. tomato str. DC3000 s...   190   6e-47   
gb:BX321864_774731 Nitrosomonas europaea ATCC 19718, complete ge...   189   8e-47   
gb:AF263561_493594 Secondary endosymbiont of Glycaspis brimbleco...   189   8e-47   
gb:AE017354_460115 Legionella pneumophila subsp. pneumophila str...   189   8e-47   
gb:CR628337_114917 Legionella pneumophila str. Lens complete gen...   189   8e-47   
gb:CR628336_111830 Legionella pneumophila str. Paris complete ge...   189   8e-47   
pir|A81707|A81707 ATP-dependent Clp proteinase, chain B TC0389 [...   189   8e-47   Chlamydia muridarum [agent of mouse pneumonitis]
gb:AE012973_287736 Chlorobium tepidum TLS section 194 of 194 of ...   189   1e-46   
gb:AE017241_414558 Mycobacterium avium subsp. paratuberculosis s...   189   1e-46   
gb:BX294148_770050 Pirellula sp. strain 1 complete genome; segme...   188   2e-46   
gb:AP006841_572936 Bacteroides fragilis YCH46 DNA, complete genome.   188   2e-46   
gb:AE016786_332737 Pseudomonas putida KT2440 section 13 of 21 of...   188   2e-46   
pir|T51523|T51523 clpB heat shock protein-like - Arabidopsis tha...   188   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb:BA000012_668607 Mesorhizobium loti MAFF303099 DNA, complete g...   187   3e-46   
gb:AP008231_580155 Synechococcus elongatus PCC 6301 DNA, complet...   187   3e-46   
gb:AP006841_571732 Bacteroides fragilis YCH46 DNA, complete genome.   187   3e-46   
gb:AE016945_363963 Bacteroides thetaiotaomicron VPI-5482, sectio...   187   3e-46   
gb:AE016827_343412 Mannheimia succiniciproducens MBEL55E, comple...   187   3e-46   
gb:OSJN00288_1698009 Oryza sativa genomic DNA, chromosome 4, BAC...   187   4e-46   
gb:MBU73653_142929 Mycobacterium bovis 63 kDa protein, 47 kDa pr...   187   4e-46   
sp|O53719|CLPB_MYCTU|CLPB_MYCTU ClpB protein.>pir|C70834|C70834 probable en...   187   4e-46   Mycobacterium tuberculosis
gb:BA000039_727173 Thermosynechococcus elongatus BP-1 DNA, compl...   187   5e-46   
gb:AE017295_434201 Leptospira interrogans serovar Copenhageni st...   187   5e-46   
gb:AE016996_374682 Chlamydophila caviae GPIC section 3 of 4 of t...   187   5e-46   
gb:AE011362_272116 Leptospira interrogans serovar lai str. 56601...   187   5e-46   
gb:CR925678_118881 Ehrlichia ruminantium str. Welgevonden, compl...   187   5e-46   
gb:CR767821_117004 Ehrlichia ruminantium strain Welgevonden, com...   187   5e-46   
gb:AF203700_1776622 Phaseolus lunatus ClpB (clpB) mRNA, complete...   186   7e-46   
gb:SCO939131_181189 Streptomyces coelicolor A3(2) complete genom...   186   9e-46   
pir|AC3070|AC3070 ATP-dependent Clp proteinase, ATP-binding subu...   186   9e-46   Agrobacterium fabrum str. C58
pir|D71555|D71555 endopeptidase Clp ATP-binding chain - Chlamydi...   186   9e-46   Chlamydia trachomatis
pir|F98216|F98216 endopeptidase clp ATP-binding chain B [importe...   186   9e-46   Agrobacterium fabrum str. C58
gb:AE017152_392104 Haemophilus ducreyi strain 35000HP section 2 ...   186   1e-45   
pir|C97707|C97707 clpB protein [imported] - Rickettsia conorii (...   186   1e-45   Rickettsia conorii
gb:AC137999_1743918 Oryza sativa chromosome 3 BAC OSJNBa0020H02 ...   185   2e-45   
gb:BX908798_830284 Parachlamydia-related symbiont UWE25, complet...   185   2e-45   
gb:BX248360_763361 Corynebacterium diphtheriae gravis NCTC13129,...   185   2e-45   
gb:AE017157_393490 Chlamydophila pneumoniae TW-183, section 1 of...   185   2e-45   
pir|H81556|H81556 ATP-dependent Clp proteinase, chain B CP0629 [...   185   2e-45   Chlamydia pneumoniae
pir|E72113|E72113 clp proteinase ATPase - Chlamydophila pneumoni...   185   2e-45   Chlamydia pneumoniae
gb:CP000009_863456 Gluconobacter oxydans 621H, complete genome.       185   2e-45   
gb:BX569693_776405 Synechococcus sp. WH8102 complete genome; seg...   185   2e-45   
gb:CR543861_103235 Acinetobacter sp. ADP1 complete genome.            185   2e-45   
pir|AD2441|AD2441 endopeptidase Clp ATP-binding chain B [importe...   185   2e-45   Nostoc sp. PCC 7120
gb:BX842654_825843 Bdellovibrio bacteriovorus complete genome, s...   184   3e-45   
gb:AP006618_561803 Nocardia farcinica IFM 10152 DNA, complete ge...   184   3e-45   
gb:AE017252_417077 Treponema denticola ATCC 35405, section 7 of ...   184   3e-45   
gb:HPCLPB_137553 H.pylori clpB gene.                                  184   3e-45   
sp|P53533|CLPB_SYNP7|CLPB_SYNP7 ClpB protein.>gb:SSU20646_191420 Synechococ...   184   3e-45   Synechococcus sp.
gb:AC133398_1741455 Oryza sativa chromosome 3 BAC OSJNBa0083F15 ...   184   3e-45   
gb:AE006206_216592 Pasteurella multocida subsp. multocida str. P...   184   3e-45   
gb:CR925677_117922 Ehrlichia ruminantium str. Gardel, complete g...   184   3e-45   
sp|P71404|CLPB_HELPY|CLPB_HELPY ClpB protein.>pir|H64552|H64552 endopeptida...   184   3e-45   Helicobacter pylori
sp|Q9ZMH1|CLPB_HELPJ|CLPB_HELPJ ClpB protein.>pir|C71956|C71956 probable en...   184   3e-45   Helicobacter pylori
sp|P44403|CLPB_HAEIN|CLPB_HAEIN ClpB protein.>pir|F64098|F64098 endopeptida...   184   3e-45   Haemophilus influenzae
gb:AY070722_1566874 Arabidopsis thaliana At2g25140/F13D4.100 mRN...   184   5e-45   
gb:AF076980_476899 Streptomyces albus G heat shock protein ClpB ...   184   5e-45   
pir|G84644|G84644 probable ATP-dependent CLPB protein [imported]...   184   5e-45   Arabidopsis thaliana [mouse-ear cress]
pir|D83077|D83077 ClpB protein PA4542 [imported] - Pseudomonas a...   183   6e-45   Pseudomonas aeruginosa
gb:BX950851_842080 Erwinia carotovora subsp. atroseptica SCRI104...   183   8e-45   
gb:AE017164_395538 Prochlorococcus marinus subsp. marinus str. C...   183   8e-45   
sp|O83110|CLPB_TREPA|CLPB_TREPA ClpB protein.>pir|G71371|G71371 probable en...   183   8e-45   Treponema pallidum
gb:BX640447_815939 Bordetella bronchiseptica strain RB50, comple...   182   1e-44   
gb:BX640428_810068 Bordetella parapertussis strain 12822, comple...   182   1e-44   
gb:SPU97124_189704 Synechococcus PCC 7942 heat shock protein Clp...   182   1e-44   
gb:CR555306_109215 Azoarcus sp. EbN1 complete genome.                 182   1e-44   
gb:AE015794_317905 Shewanella oneidensis MR-1 section 343 of 457...   182   1e-44   
gb:AE010496_263741 Fusobacterium nucleatum subsp. nucleatum ATCC...   182   1e-44   
gb:AE004969_60747 Neisseria gonorrhoeae FA 1090, complete genome.     182   1e-44   
sp|P33416|HSP7_YEAST|HSP7_YEAST Heat shock protein 78, mitochondrial precur...   182   1e-44   Saccharomyces cerevisiae [brewer's yeast]
gb:AF449501_1800726 Paracoccidioides brasiliensis ClpB ATP prote...   182   2e-44   
gb:BX571863_786128 Photorhabdus luminescens subsp. laumondii TTO...   181   2e-44   
gb:AE014291_309273 Brucella suis 1330 chromosome I, complete seq...   181   2e-44   
gb:AE013598_295038 Xanthomonas oryzae pv. oryzae KACC10331, comp...   181   2e-44   
gb:AE012421_282297 Xanthomonas campestris pv. campestris str. AT...   181   2e-44   
gb:AE011965_278110 Xanthomonas axonopodis pv. citri str. 306, se...   181   2e-44   
pir|AF3276|AF3276 ATP-dependent clp proteinase, ATP-binding chai...   181   2e-44   Brucella melitensis
pir|C70445|C70445 ATPase subunit of ATP-dependent proteinase (EC...   181   2e-44   Aquifex aeolicus
gb:BX640414_805622 Bordetella pertussis strain Tohama I, complet...   181   3e-44   
gb:AE016929_360266 Bacteroides thetaiotaomicron VPI-5482, sectio...   181   3e-44   
pir|F81863|F81863 ClpB protein NMA1683 [imported] - Neisseria me...   181   3e-44   Neisseria meningitidis serogroup A
gb:CR380959_1654031 Candida glabrata strain CBS138 chromosome M ...   181   4e-44   
gb:BX936398_835493 Yersinia pseudotuberculosis IP32953 genome, c...   181   4e-44   
gb:BX897700_829318 Bartonella quintana str. Toulouse, complete g...   181   4e-44   
gb:BX572091_796206 Prochlorococcus marinus MED4 complete genome;...   181   4e-44   
gb:AE017282_429790 Methylococcus capsulatus str. Bath, complete ...   181   4e-44   
gb:AE016960_367349 Coxiella burnetii strain RSA 493, section 1 o...   181   4e-44   
gb:AE013694_299238 Yersinia pestis KIM section 94 of 415 of the ...   181   4e-44   
pir|AI0397|AI0397 Clp ATPase [imported] - Yersinia pestis (strai...   181   4e-44   Yersinia pestis
pir|D71711|D71711 endopeptidase Clp ATP-binding chain B - Ricket...   181   4e-44   Rickettsia prowazekii
pir|T34902|T34902 clp proteinase ATP-binding chain - Streptomyce...   181   4e-44   Streptomyces coelicolor
gb:LDHSP100_1387258 L.donovani hsp100 gene.                           180   5e-44   
gb:CP000025_878384 Campylobacter jejuni RM1221, complete genome.      180   5e-44   
gb:CP000020_870742 Vibrio fischeri ES114 chromosome I, complete ...   180   5e-44   
gb:CJY13333_848434 Campylobacter jejuni clpB gene.                    180   5e-44   
gb:BA000037_721541 Vibrio vulnificus YJ016 DNA, chromosome I, co...   180   5e-44   
gb:BA000031_706021 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   180   5e-44   
gb:AE016798_335254 Vibrio vulnificus CMCP6 chromosome I section ...   180   5e-44   
gb:CP000031_87271 Silicibacter pomeroyi DSS-3, complete genome.       180   5e-44   
pir|A82290|A82290 clpB protein VC0711 [imported] - Vibrio choler...   180   5e-44   Vibrio cholerae
pir|F81396|F81396 ATP-dependent CLP proteinase ATP-binding chain...   180   5e-44   Campylobacter jejuni
gb:YSCHSP78A_1729354 Saccharomyces cerevisiae nuclear-encoded mi...   180   7e-44   
gb:AE017315_440123 Desulfovibrio vulgaris subsp. vulgaris str. H...   180   7e-44   
gb:BX897699_827993 Bartonella henselae strain Houston-1, complet...   179   9e-44   
gb:BA000039_728236 Thermosynechococcus elongatus BP-1 DNA, compl...   179   9e-44   
gb:AJ749949_532226 Francisella tularensis subsp. tularensis comp...   179   9e-44   
gb:AE017253_417365 Treponema denticola ATCC 35405, section 8 of ...   179   9e-44   
gb:SCO939117_177333 Streptomyces coelicolor A3(2) complete genom...   179   9e-44   
pir|T36551|T36551 probable ATP-dependent proteinase ATP-binding ...   179   9e-44   Streptomyces coelicolor
pir|G75442|G75442 ATP-dependent Clp proteinase, ATP-binding subu...   179   9e-44   Deinococcus radiodurans
gb:AY596495S1_1616760 Helicosporidium sp. ex Simulium jonesii pl...   179   1e-43   
gb:BA000016_674468 Clostridium perfringens str. 13 DNA, complete...   179   1e-43   
gb:CR378672_96323 Photobacterium profundum SS9; segment 10/12.        179   1e-43   
gb:AF487263_1804255 Leptosphaeria maculans major facilitator sup...   179   1e-43   
gb:BA000030_702401 Streptomyces avermitilis MA-4680 genomic DNA,...   179   1e-43   
gb:AE017197_402085 Rickettsia typhi str. Wilmington complete gen...   179   1e-43   
gb:AE016916_356905 Chromobacterium violaceum ATCC 12472 section ...   179   1e-43   
gb:CP000010_865650 Burkholderia mallei ATCC 23344 chromosome 1, ...   178   2e-43   
gb:BX571965_791273 Burkholderia pseudomallei strain K96243, chro...   178   2e-43   
gb:BX571658_777995 Wolinella succinogenes, complete genome; segm...   178   2e-43   
gb:AL646064_546263 Ralstonia solanacearum GMI1000 chromosome, co...   178   2e-43   
gb:AE017340_456943 Idiomarina loihiensis L2TR, complete genome.       178   2e-43   
gb:AE017256_418021 Wolbachia endosymbiont of Drosophila melanoga...   178   2e-43   
gb:LMCLPB_1387667 L.major (MHOM/SU/5ASKH) DNA for 100 kDa heat s...   177   4e-43   
pir|C87358|C87358 hypothetical protein CC0878 [imported] - Caulo...   177   4e-43   Caulobacter vibrioides
pir|D97018|D97018 ATPase with chaperone activity, two ATP-bindin...   177   4e-43   Clostridium acetobutylicum
gb:AE012559_285071 Xylella fastidiosa Temecula1, section 7 of 9 ...   177   6e-43   
pir|F81078|F81078 clpB protein NMB1472 [imported] - Neisseria me...   177   6e-43   Neisseria meningitidis serogroup B
gb:PBL418044_1699017 Phycomyces blakesleeanus mRNA for putative ...   176   7e-43   
gb:BX251412_764944 Tropheryma whipplei TW08/27, complete genome;...   176   7e-43   
gb:AE017172_396408 Porphyromonas gingivalis W83 section 1 of 8 o...   176   7e-43   
gb:AE016852_349270 Tropheryma whipplei str. Twist, section 3 of ...   176   7e-43   
gb:PFR535195_158040 Propionibacterium freudenreichii subsp. sher...   176   7e-43   
gb:AL935257_551640 Lactobacillus plantarum strain WCFS1 complete...   176   9e-43   
pir|AC2096|AC2096 endopeptidase Clp ATP-binding chain [imported]...   176   9e-43   Nostoc sp. PCC 7120
pir|G87220|G87220 heat shock protein [imported] - Mycobacterium ...   176   9e-43   Mycobacterium leprae
gb:CR382132_1665461 Yarrowia lipolytica chromosome F of strain C...   176   1e-42   
pir|D82814|D82814 ATP-dependent Clp proteinase subunit XF0381 [i...   176   1e-42   Xylella fastidiosa
gb:AE014901_312976 Streptococcus mutans UA159 section 49 of 185 ...   175   2e-42   
pir|E97962|E97962 ATP dependent proteinase [imported] - Streptoc...   175   2e-42   Streptococcus pneumoniae R6
sp|P42762|ERD1_ARATH|ERD1_ARATH ERD1 protein, chloroplast precursor.>pir|JN...   175   2e-42   Arabidopsis thaliana [mouse-ear cress]
sp|P35594|CLPE_STRPN|CLPE_STRPN ATP-dependent Clp protease ATP-binding subu...   175   2e-42   
gb:PBU46549_1391734 Plasmodium berghei heat shock protein ClpB m...   174   3e-42   
gb:AE017150_1030088 Trypanosoma brucei chromosome 2, complete se...   174   3e-42   
gb:AE017283_431767 Propionibacterium acnes KPA171202, complete g...   174   3e-42   
pir|E35905|E35905 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   174   3e-42   Trypanosoma brucei
sp|P31543|CLP_TRYBB|CLP_TRYBB Heat shock protein 100 (CLP protein).>gb:TBR...   174   3e-42   Trypanosoma brucei brucei
gb:AY037264_1560158 Arabidopsis thaliana AT5g51070/K3K7_27 mRNA,...   174   4e-42   
gb:BA000043_737376 Geobacillus kaustophilus HTA426 DNA, complete...   174   4e-42   
gb:DIHCLPBA_124130 Dichelobacter nodosus ATP-dependent protease ...   174   4e-42   
sp|P17422|CLPB_BACNO|CLPB_BACNO ClpB protein.>pir|C35905|C35905 endopeptida...   174   4e-42   
gb:PFMAL8P1_1192172 Plasmodium falciparum 3D7 chromosome 8, *** ...   174   5e-42   
gb:AE017355_462385 Bacillus thuringiensis serovar konkukian str....   174   5e-42   
pir|A71311|A71311 probable ATPase (clpC) - syphilis spirochete>g...   174   5e-42   
gb:CP000001_851687 Bacillus cereus ZK, complete genome.               173   6e-42   
gb:AE017027_381383 Bacillus anthracis str. Ames section 4 of 18 ...   173   6e-42   
pir|E86815|E86815 ClpB protein [imported] - Lactococcus lactis s...   173   6e-42   
pir|T40514|T40514 Chaperonin hsp78p - fission yeast (Schizosacch...   173   8e-42   
gb:AE017329_444657 Listeria monocytogenes str. 4b F2365, section...   172   1e-41   
gb:AE017321_441816 Wolbachia endosymbiont strain TRS of Brugia m...   172   1e-41   
pir|AI1720|AI1720 endopeptidase Clp ATP-binding chain B (ClpB) h...   172   1e-41   
pir|AF1350|AF1350 endopeptidase Clp ATP-binding chain B (ClpB) h...   172   1e-41   
gb:AE014214_305824 Streptococcus agalactiae 2603V/R section 24 o...   172   1e-41   
gb:SAG766845_170062 Streptococcus agalactiae NEM316 complete gen...   172   1e-41   
gb:AE016818_1747926 Ashbya gossypii (= Eremothecium gossypii) AT...   171   3e-41   
gb:AF016634_469331 Lactococcus lactis cremoris ClpB chaperone ho...   171   3e-41   
gb:AE016954_366341 Enterococcus faecalis V583, section 8 of 11 o...   171   3e-41   
gb:AE017150_1029793 Trypanosoma brucei chromosome 2, complete se...   170   5e-41   
gb:AE017001_376111 Bacillus cereus ATCC 14579 section 4 of 18 of...   170   5e-41   
gb:AF083344_1766883 Triticum aestivum heat shock protein 101 kDa...   170   7e-41   
gb:CR382137_1670471 Debaryomyces hansenii chromosome E of strain...   170   7e-41   
gb:AP006627_565766 Bacillus clausii KSM-K16 DNA, complete genome.     170   7e-41   
gb:AE017144_389862 Helicobacter hepaticus ATCC 51449 section 1 o...   170   7e-41   
gb:CP000024_876446 Streptococcus thermophilus CNRZ1066, complete...   169   9e-41   
gb:CP000023_874556 Streptococcus thermophilus LMG 18311, complet...   169   9e-41   
gb:AE017268_422515 Bacillus cereus ATCC 10987, section 5 of 18 o...   169   9e-41   
sp|Q9S5Z2|CLPE_LACLC|CLPE_LACLC ATP-dependent Clp protease ATP-binding subu...   169   9e-41   
sp|Q9CI09|CLPE_LACLA|CLPE_LACLA ATP-dependent Clp protease ATP-binding subu...   169   9e-41   
gb:AE017202_404025 Lactobacillus johnsonii NCC 533, section 3 of...   169   1e-40   
gb:AE015937_319718 Clostridium tetani E88, section 2 of 10 of th...   169   1e-40   
gb:CP000003_861186 Streptococcus pyogenes MGAS10394, complete ge...   169   2e-40   
gb:BX571965_790681 Burkholderia pseudomallei strain K96243, chro...   169   2e-40   
gb:AE014159_304640 Streptococcus pyogenes MGAS315, section 24 of...   169   2e-40   
gb:AE010067_258982 Streptococcus pyogenes strain MGAS8232, secti...   169   2e-40   
gb:AE006584_220431 Streptococcus pyogenes M1 GAS, section 113 of...   169   2e-40   
gb:AF097363_1767874 Triticum aestivum heat shock protein 101 (Hs...   168   2e-40   
gb:AE016822_341231 Leifsonia xyli subsp. xyli str. CTCB07, compl...   168   2e-40   
sp|P31540|HS98_NEUCR|HS98_NEUCR Heat shock protein HSP98.                        168   2e-40   
gb:CP000033_88932 Lactobacillus acidophilus NCFM, complete genome.    168   3e-40   
gb:AE017354_459192 Legionella pneumophila subsp. pneumophila str...   167   3e-40   
gb:AE016949_364788 Enterococcus faecalis V583, section 3 of 11 o...   167   3e-40   
gb:CR628337_114049 Legionella pneumophila str. Lens complete gen...   167   3e-40   
gb:CR628336_110995 Legionella pneumophila str. Paris complete ge...   167   3e-40   
sp|Q96UX5|HS78_CANAL|HS78_CANAL Heat shock protein 78, mitochondrial precur...   167   3e-40   
gb:AY062596_1565252 Arabidopsis thaliana heat shock protein 101 ...   167   4e-40   
gb:ATU13949_1556767 Arabidopsis thaliana heat shock protein AtHS...   167   4e-40   
gb:AE016923_358630 Chromobacterium violaceum ATCC 12472 section ...   167   4e-40   
gb:AE016746_322324 Staphylococcus epidermidis ATCC 12228, sectio...   167   4e-40   
gb:CP000029_81183 Staphylococcus epidermidis RP62A, complete gen...   167   4e-40   
pir|AE1199|AE1199 ATP-dependent proteinase [imported] - Listeria...   167   4e-40   
sp|P42730|H101_ARATH|H101_ARATH Heat shock protein 101.>pir|F96771|F96771 h...   167   4e-40   
gb:BX571856_780388 Staphylococcus aureus subsp. aureus strain MR...   167   6e-40   
gb:BA000033_711149 Staphylococcus aureus subsp. aureus MW2 DNA, ...   167   6e-40   
gb:AE016788_333416 Pseudomonas putida KT2440 section 15 of 21 of...   167   6e-40   
gb:CP000046_91126 Staphylococcus aureus subsp. aureus COL, compl...   167   6e-40   
pir|B83319|B83319 ATP-binding proteinase component ClpA PA2620 [...   167   6e-40   
pir|H89864|H89864 hypothetical protein clpB [imported] - Staphyl...   167   6e-40   
gb:AF174433_1774477 Triticum aestivum heat shock protein 101 (HS...   166   7e-40   
gb:AF083343_1766882 Nicotiana tabacum heat shock protein 101 kDa...   166   7e-40   
gb:AE017282_428524 Methylococcus capsulatus str. Bath, complete ...   166   7e-40   
gb:AE016868_352743 Pseudomonas syringae pv. tomato str. DC3000 s...   166   7e-40   
gb:CP000030_83785 Anaplasma marginale str. St. Maries, complete ...   166   7e-40   
pir|T07807|T07807 endopeptidase Clp (EC 3.4.21.-) ATP-binding ch...   166   7e-40   
gb:AF077337_1766214 Zea mays heat shock protein 101 (HSP101) gen...   166   1e-39   
gb:AC130611_1740888 Oryza sativa (japonica cultivar-group) chrom...   166   1e-39   
gb:OSA316025_1692524 Oryza sativa hsp101 gene for heat shock pro...   166   1e-39   
gb:CR382125_1657974 Kluyveromyces lactis strain NRRL Y-1140 chro...   166   1e-39   
pir|AC1557|AC1557 ATP-dependent proteinase [imported] - Listeria...   166   1e-39   
gb:AE017333_447388 Bacillus licheniformis DSM 13, complete genom...   166   1e-39   
gb:AE017325_443446 Listeria monocytogenes str. 4b F2365, section...   166   1e-39   
gb:AY229978_1591329 Paracoccidioides brasiliensis heat shock pro...   165   2e-39   
gb:AL646070_547392 Ralstonia solanacearum GMI1000 chromosome, co...   165   2e-39   
gb:BA000043_737545 Geobacillus kaustophilus HTA426 DNA, complete...   164   3e-39   
gb:AE017314_439853 Desulfovibrio vulgaris subsp. vulgaris str. H...   164   3e-39   
gb:BX248584_763803 Blochmannia floridanus complete genome; segme...   164   4e-39   
gb:AY224707_599174 Bacillus cereus strain 391-98 ClpC (clpC) gen...   164   4e-39   
gb:CR555306_107943 Azoarcus sp. EbN1 complete genome.                 164   5e-39   
pir|C87555|C87555 hypothetical protein CC2468 [imported] - Caulo...   164   5e-39   
pir|A69601|A69601 ATP-dependent Clp proteinase-like protein clpE...   164   5e-39   
gb:AY485529_1608454 Zea mays heat shock protein HSP101 (HSP101) ...   163   6e-39   
gb:BX572603_802760 Rhodopseudomonas palustris CGA009 complete ge...   163   6e-39   
gb:AY224698_599165 Bacillus cereus strain BGSC 6A5 ClpC (clpC) g...   163   6e-39   
gb:BX571864_786451 Photorhabdus luminescens subsp. laumondii TTO...   163   8e-39   
pir|E82236|E82236 ATP-dependent Clp proteinase ATP-binding chain...   163   8e-39   
gb:AE017347_1757868 Cryptococcus neoformans var. neoformans JEC2...   162   1e-38   
gb:AY224705_599172 Bacillus weihenstephanensis strain WSBC 10311...   162   1e-38   
gb:AY224696_599163 Bacillus thuringiensis serovar israelensis st...   162   1e-38   
gb:AE017263_420973 Mesoplasma florum L1 complete genome.              162   1e-38   
gb:BX842649_824214 Bdellovibrio bacteriovorus complete genome, s...   162   1e-38   
gb:AY224703_599170 Bacillus weihenstephanensis strain WSBC 10206...   162   1e-38   
gb:BA000031_706474 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   162   2e-38   
gb:AL935255_551119 Lactobacillus plantarum strain WCFS1 complete...   162   2e-38   
gb:AF023422_470002 Lactococcus lactis ClpC (clpC) gene, complete...   162   2e-38   
gb:CP000009_862631 Gluconobacter oxydans 621H, complete genome.       161   2e-38   
gb:BX640443_814671 Bordetella bronchiseptica strain RB50, comple...   161   2e-38   
gb:BX640430_810821 Bordetella parapertussis strain 12822, comple...   161   2e-38   
gb:BX640419_807156 Bordetella pertussis strain Tohama I, complet...   161   2e-38   
gb:BX571657_777742 Wolinella succinogenes, complete genome; segm...   161   2e-38   
gb:BA000040_733413 Bradyrhizobium japonicum USDA 110 DNA, comple...   161   2e-38   
gb:AF254897_493135 Bradyrhizobium japonicum strain USDA 110 YljA...   161   2e-38   
gb:AE017332_445538 Mycoplasma hyopneumoniae 232, complete genome.     161   2e-38   
gb:AE012301_281212 Xanthomonas campestris pv. campestris str. AT...   161   2e-38   
gb:AF090118_1240139 Plasmodium falciparum heat shock protein hsp...   161   3e-38   
gb:BA000012_666496 Mesorhizobium loti MAFF303099 DNA, complete g...   161   3e-38   
gb:AE017294_434011 Leptospira interrogans serovar Copenhageni st...   161   3e-38   
gb:AE011382_272341 Leptospira interrogans serovar lai str. 56601...   161   3e-38   
gb:AE013598_296254 Xanthomonas oryzae pv. oryzae KACC10331, comp...   160   4e-38   
pir|T39572|T39572 probable proteinase subunit - fission yeast  (...   160   4e-38   
gb:BA000045_742143 Gloeobacter violaceus PCC 7421 DNA, complete ...   160   5e-38   
gb:AE017340_456437 Idiomarina loihiensis L2TR, complete genome.       160   7e-38   
gb:AE011835_276934 Xanthomonas axonopodis pv. citri str. 306, se...   159   9e-38   
gb:CR378666_94540 Photobacterium profundum SS9; segment 4/12.         159   9e-38   
pir|C97525|C97525 clpA protein (AJ224881) [imported] - Agrobacte...   159   9e-38   
pir|C71983|C71983 endopeptidase Clp ATP-binding chain - Helicoba...   159   9e-38   
gb:BA000037_723148 Vibrio vulnificus YJ016 DNA, chromosome I, co...   159   1e-37   
gb:AE016980_370794 Shigella flexneri 2a str. 2457T section 3 of ...   159   1e-37   
gb:AE016804_336761 Vibrio vulnificus CMCP6 chromosome I section ...   159   1e-37   
gb:AE016758_325060 Escherichia coli CFT073 section 4 of 18 of th...   159   1e-37   
gb:AE015704_316994 Shewanella oneidensis MR-1 section 253 of 457...   159   1e-37   
gb:AE008740_242653 Salmonella typhimurium LT2, section 46 of 220...   159   1e-37   
gb:ECOCLPAA_128286 E.coli ATP-dependent C1p protease (clpA) gene...   159   1e-37   
gb:CP000026_76649 Salmonella enterica subsp. enterica serovar Pa...   159   1e-37   
gb:AE005674_70424 Shigella flexneri 2a str. 301, complete genome.     159   1e-37   
pir|A64524|A64524 endopeptidase Clp ATP-binding chain - Helicoba...   159   1e-37   
pir|B86705|B86705 ATP-dependent proteinase ATP-binding subunit [...   159   1e-37   
pir|AI0609|AI0609 ATP-dependent Clp protease ATP-binding chain C...   159   1e-37   
sp|P15716|CLPA_ECOLI|CLPA_ECOLI ATP-dependent Clp protease ATP-binding subu...   159   1e-37   
gb:AE016820_1749918 Ashbya gossypii (= Eremothecium gossypii) AT...   159   2e-37   
gb:BX950851_841393 Erwinia carotovora subsp. atroseptica SCRI104...   159   2e-37   
gb:AL935262_553008 Lactobacillus plantarum strain WCFS1 complete...   159   2e-37   
pir|C83922|C83922 ATP-dependent proteinase clpE [imported] - Bac...   159   2e-37   
gb:BX842644_822619 Mycoplasma mycoides subsp. mycoides SC genomi...   158   2e-37   
gb:BX569695_777248 Synechococcus sp. WH8102 complete genome; seg...   158   2e-37   
gb:AE012555_284084 Xylella fastidiosa Temecula1, section 3 of 9 ...   158   3e-37   
gb:BX321862_774061 Nitrosomonas europaea ATCC 19718, complete ge...   157   3e-37   
gb:AE017148_391317 Helicobacter hepaticus ATCC 51449 section 5 o...   157   5e-37   
pir|C71279|C71279 probable ATP-dependent Clp proteinase subunit ...   157   5e-37   
gb:CR382131_1664611 Yarrowia lipolytica chromosome E of strain C...   157   6e-37   
gb:AJ606044_526811 Oenococcus oeni clpP gene and clpL gene.           157   6e-37   
gb:BOVCLPAB_1435325 Bovine putative Clp-like ATP-dependent prote...   156   8e-37   
gb:CP000024_877392 Streptococcus thermophilus CNRZ1066, complete...   156   8e-37   
gb:CP000023_875465 Streptococcus thermophilus LMG 18311, complet...   156   8e-37   
gb:BX936398_836039 Yersinia pseudotuberculosis IP32953 genome, c...   156   8e-37   
gb:AE013884_301102 Yersinia pestis KIM section 284 of 415 of the...   156   8e-37   
pir|AB0167|AB0167 ATP-dependent Clp proteinase ATP-binding chain...   156   8e-37   
pir|AB3354|AB3354 ATP-dependent clp proteinase ATP-binding chain...   156   8e-37   
pir|A82681|A82681 ATP-dependent Clp proteinase subunit XF1443 [i...   156   8e-37   
gb:CP000031_87170 Silicibacter pomeroyi DSS-3, complete genome.       156   1e-36   
pir|H95039|H95039 hypothetical protein SP0338 [imported] - Strep...   156   1e-36   
gb:CP000003_860636 Streptococcus pyogenes MGAS10394, complete ge...   155   1e-36   
gb:AE010023_258477 Streptococcus pyogenes strain MGAS8232, secti...   155   1e-36   
gb:AE006538_219933 Streptococcus pyogenes M1 GAS, section 67 of ...   155   1e-36   
pir|C97910|C97910 ATP-dependent proteinase ATP-binding chain [im...   155   1e-36   
gb:AE014935_313333 Streptococcus mutans UA159 section 83 of 185 ...   155   2e-36   
pir|D75500|D75500 ATP-dependent Clp proteinase, ATP-binding subu...   155   2e-36   
pir|E81869|E81869 probable ATP-dependent proteinase ATP-binding ...   154   3e-36   
sp|P05444|CLPA_RHOBL|CLPA_RHOBL ClpA homolog protein.>pir|S04667|SURFCA end...   154   3e-36   
gb:CP000020_871941 Vibrio fischeri ES114 chromosome I, complete ...   154   4e-36   
gb:CP000024_875941 Streptococcus thermophilus CNRZ1066, complete...   154   5e-36   
gb:BX897699_827241 Bartonella henselae strain Houston-1, complet...   154   5e-36   
gb:AE008692_240143 Zymomonas mobilis subsp. mobilis ZM4, complet...   154   5e-36   
gb:CP000023_874054 Streptococcus thermophilus LMG 18311, complet...   153   7e-36   
gb:CR382137_1669711 Debaryomyces hansenii chromosome E of strain...   153   9e-36   
gb:CR382126_1659160 Kluyveromyces lactis strain NRRL Y-1140 chro...   153   9e-36   
gb:AF362391_1791461 Candida albicans heat shock protein Hsp104 (...   152   1e-35   
gb:AF362390_1791460 Candida albicans heat shock protein Hsp104 (...   152   1e-35   
gb:AF323526_500529 Lactobacillus rhamnosus EpsE (epsE) gene, par...   152   1e-35   
gb:SME591787_185505 Sinorhizobium meliloti 1021 complete chromos...   152   1e-35   
gb:CR543861_103326 Acinetobacter sp. ADP1 complete genome.            152   1e-35   
pir|G85160|G85160 heat shock protein like [imported] - Arabidops...   152   1e-35   
pir|D71409|D71409 probable endopeptidase Clp ATP-binding chain -...   152   1e-35   
gb:BA000028_695268 Oceanobacillus iheyensis HTE831 DNA, complete...   152   1e-35   
gb:CR522870_99731 Desulfotalea psychrophila LSv54 chromosome.         152   1e-35   
sp|Q06716|CLPL_LACLA|CLPL_LACLA ATP-dependent protease ATP-binding subunit ...   152   1e-35   
gb:AE012064_279046 Xanthomonas axonopodis pv. citri str. 306, se...   152   2e-35   
gb:AE017341_1754119 Cryptococcus neoformans var. neoformans JEC2...   151   2e-35   
gb:BX571856_782051 Staphylococcus aureus subsp. aureus strain MR...   151   2e-35   
gb:AE014251_306607 Streptococcus agalactiae 2603V/R section 61 o...   151   2e-35   
gb:SAG766850_170904 Streptococcus agalactiae NEM316 complete gen...   151   2e-35   
pir|B97125|B97125 ATP-dependent Clp proteinase [imported] - Clos...   151   2e-35   
gb:CR380953_1650784 Candida glabrata strain CBS138 chromosome G ...   151   3e-35   
gb:BX572101_799426 Prochlorococcus marinus MIT9313 complete geno...   151   3e-35   
gb:BA000033_712761 Staphylococcus aureus subsp. aureus MW2 DNA, ...   151   3e-35   
gb:CP000046_92634 Staphylococcus aureus subsp. aureus COL, compl...   151   3e-35   
pir|E90059|E90059 ATP-dependent Clp proteinase chain clpL [impor...   151   3e-35   
gb:AE016785_332517 Pseudomonas putida KT2440 section 12 of 21 of...   150   7e-35   
pir|D81153|D81153 ATP-dependent Clp proteinase, ATP-binding chai...   150   7e-35   
sp|P31539|H104_YEAST|H104_YEAST Heat shock protein 104.>pir|S61476|S61476 e...   150   7e-35   
gb:BX897700_828934 Bartonella quintana str. Toulouse, complete g...   149   9e-35   
gb:AE013598_297176 Xanthomonas oryzae pv. oryzae KACC10331, comp...   149   9e-35   
gb:AE013598_296746 Xanthomonas oryzae pv. oryzae KACC10331, comp...   149   9e-35   
gb:AY057112_1563874 Paracoccidioides brasiliensis ClpB mRNA, par...   149   1e-34   
gb:CP000025_878992 Campylobacter jejuni RM1221, complete genome.      149   1e-34   
pir|E98121|E98121 hypothetical protein clpC-truncation [imported...   149   1e-34   
pir|G81314|G81314 ATP-dependent CLP proteinase ATP-binding chain...   149   1e-34   
pir|D95256|D95256 ATP-dependent Clp proteinase, ATP-binding chai...   149   1e-34   
pir|A82898|A82898 ATP-dependent serine proteinase, heat shock pr...   149   1e-34   
gb:CP000010_866957 Burkholderia mallei ATCC 23344 chromosome 1, ...   149   2e-34   
gb:BX571965_792900 Burkholderia pseudomallei strain K96243, chro...   149   2e-34   
gb:AE017308_437987 Mycoplasma mobile 163K complete genome.            149   2e-34   
gb:AE016875_354759 Pseudomonas syringae pv. tomato str. DC3000 s...   149   2e-34   
gb:AF188207_1775211 Pleurotus sajor-caju HSP104 (HSP104) mRNA, c...   148   2e-34   
gb:BA000012_667776 Mesorhizobium loti MAFF303099 DNA, complete g...   147   4e-34   
gb:AL646080_549119 Ralstonia solanacearum GMI1000 megaplasmid, c...   147   4e-34   
gb:AE015936_319278 Clostridium tetani E88, section 1 of 10 of th...   147   4e-34   
gb:AE004969_60180 Neisseria gonorrhoeae FA 1090, complete genome.     147   4e-34   
gb:AP004753_1844420 Oryza sativa (japonica cultivar-group) genom...   147   6e-34   
gb:CP000011_868081 Burkholderia mallei ATCC 23344 chromosome 2, ...   146   1e-33   
gb:BX571966_794763 Burkholderia pseudomallei strain K96243, chro...   146   1e-33   
gb:AY424360_616878 Edwardsiella tarda evpABCDEFGH gene cluster, ...   145   2e-33   
gb:AY688432_640573 Uncultured proteobacterium QS1, partial genome.    145   2e-33   
gb:SAG766854_171397 Streptococcus agalactiae NEM316 complete gen...   145   2e-33   
pir|E97011|E97011 ATPase with chaperon activity, two ATP-binding...   145   2e-33   
gb:AE016864_351965 Pseudomonas syringae pv. tomato str. DC3000 s...   144   3e-33   
gb:BX572090_795833 Prochlorococcus marinus MED4 complete genome;...   144   5e-33   
gb:AE017161_394691 Prochlorococcus marinus subsp. marinus str. C...   144   5e-33   
gb:AF076664_476881 Listeria monocytogenes ATP-dependent protease...   143   7e-33   
gb:CR925677_117738 Ehrlichia ruminantium str. Gardel, complete g...   143   7e-33   


>sp|P31542|CLAB_LYCES ATP-dependent Clp protease ATP-binding subunit
            clpA homolog CD4B, chloroplast
            precursor.>pir|B35905|B35905 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain cd4B, chloroplast
            [similarity] - tomato>gb:TOMCD4B_1725638 Tomato
            ATP-dependent protease (CD4B) gene, complete cds.
          Length = 923

 Score =  536 bits (1382), Expect = e-151
 Identities = 295/391 (75%), Positives = 302/391 (77%)
 Frame = +1

Query: 124  MARVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSSQSPSLKLRSFTGLRGGN 303
            MAR LVQST+IPS VAGE   +F           R V MLC++QS SL LR FTGLRG N
Sbjct: 1    MARALVQSTSIPSSVAGERTTKFNGSGKTK----RAVTMLCNAQSSSLTLRDFTGLRGCN 56

Query: 304  ALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLGHN 483
            A+DT+ RSG+TL SK                 KAMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct: 57   AIDTLVRSGETLQSKVAAATYVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLGHN 116

Query: 484  FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 663
            FV                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR
Sbjct: 117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 176

Query: 664  VLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXX 843
            VLELSLEEARQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM     
Sbjct: 177  VLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGESN 236

Query: 844  XXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNP 1023
                         QKMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNP
Sbjct: 237  EAVGASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNP 296

Query: 1024 CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 1203
            CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL
Sbjct: 297  CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 356

Query: 1204 MEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MEEIKQSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 357  MEEIKQSDEIILFIDEVHTLIGAGAAEGAID 387



>sp|P31541|CLAA_LYCES ATP-dependent Clp protease ATP-binding subunit
            clpA homolog CD4A, chloroplast
            precursor.>pir|A35905|A35905 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain cd4A, chloroplast
            [similarity] - tomato>gb:TOMCD4A_1725637 Tomato
            ATP-dependent protease (CD4A) gene, complete cds.
          Length = 926

 Score =  521 bits (1341), Expect = e-146
 Identities = 289/393 (73%), Positives = 299/393 (76%), Gaps = 1/393 (0%)
 Frame = +1

Query: 121  IMARVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSSQSPSLKLRSFTGLRGG 300
            +MAR LVQSTNI   VAGE  GQF           R V MLC+ +  S +L +F GLRG 
Sbjct: 1    MMARALVQSTNILPSVAGERAGQFNGSRKDQ----RTVRMLCNVKCCSSRLNNFAGLRGC 56

Query: 301  NALDTM-ARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLG 477
            NALDT+  +SG+TLHSK                 KAMFERFTEKAIKVIMLAQEEARRLG
Sbjct: 57   NALDTLLVKSGETLHSKVAAATFVRRPRGCRFVPKAMFERFTEKAIKVIMLAQEEARRLG 116

Query: 478  HNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRA 657
            HNFV                AAKVLKSMGINLKDARVEVEKIIGRGSGF+AVEIPFTPRA
Sbjct: 117  HNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFIAVEIPFTPRA 176

Query: 658  KRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXX 837
            KRVLELSLEEARQLGHNYIGS             VAARVLENLGADP+NIRTQVIRM   
Sbjct: 177  KRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGE 236

Query: 838  XXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKN 1017
                            KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKN
Sbjct: 237  SSEAVGASVGGGTSGLKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKN 296

Query: 1018 NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK 1197
            NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK
Sbjct: 297  NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLK 356

Query: 1198 KLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            KLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 357  KLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 389



>gb:AF043539_1763745 Spinacia oleracea ClpC protease (clpC) mRNA,
            chloroplast gene encoding chloroplast protein, complete
            cds.
          Length = 891

 Score =  509 bits (1310), Expect = e-143
 Identities = 280/391 (71%), Positives = 294/391 (75%)
 Frame = +1

Query: 124  MARVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSSQSPSLKLRSFTGLRGGN 303
            MA  L+QSTNIPSL A +  GQF           + V M+ S Q P  ++R+F+G+RGGN
Sbjct: 1    MAGALIQSTNIPSL-AYKVNGQFQRSDKGN----KAVKMMASLQDPGYRMRTFSGVRGGN 55

Query: 304  ALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLGHN 483
            ALDT+  + +  +SK                 +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct: 56   ALDTLGTTSECFYSKMRAVLSVRKGTASRGVVRAMFERFTEKAIKVIMLAQEEARRLGHN 115

Query: 484  FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 663
            FV                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR
Sbjct: 116  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 175

Query: 664  VLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXX 843
            VLELSLEEARQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM     
Sbjct: 176  VLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENT 235

Query: 844  XXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNP 1023
                          KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNP
Sbjct: 236  EAVGAGVGGGTTGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGRRTKNNP 295

Query: 1024 CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 1203
            CLIGEPGVGKTAIAEGLAQRIA GDVPETIEGKKVITL MGLLVAGTKYRGEFEERLKKL
Sbjct: 296  CLIGEPGVGKTAIAEGLAQRIATGDVPETIEGKKVITLHMGLLVAGTKYRGEFEERLKKL 355

Query: 1204 MEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MEEIKQSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 356  MEEIKQSDEIILFIDEVHTLIGAGAAEGAID 386



>sp|P35100|CLPA_PEA ATP-dependent Clp protease ATP-binding subunit
            clpA homolog, chloroplast precursor.>pir|S31164|S31164
            endopeptidase Clp (EC 3.4.21.-) ATP-binding chain,
            chloroplast [similarity] - garden pea>gb:PEAPCLP_1699724
            Pisum sativum (clone pCLp) nuclear encoded precursor to
            chloroplast protein mRNA, complete cds.
          Length = 922

 Score =  501 bits (1290), Expect = e-140
 Identities = 275/391 (70%), Positives = 288/391 (73%)
 Frame = +1

Query: 124  MARVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSSQSPSLKLRSFTGLRGGN 303
            MARVL QS ++P LVAG    Q            R V  +C+ ++  L++  F+GLR  N
Sbjct: 1    MARVLAQSLSVPGLVAGHKDSQHKGSGKSK----RSVKTMCALRTSGLRMSGFSGLRTFN 56

Query: 304  ALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLGHN 483
             L+TM R G   HSK                 +AMFERFTEKAIKVIMLAQEEARRLGHN
Sbjct: 57   HLNTMMRPGLDFHSKVSKAVSSRRARAKRFIPRAMFERFTEKAIKVIMLAQEEARRLGHN 116

Query: 484  FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 663
            FV                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR
Sbjct: 117  FVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKR 176

Query: 664  VLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXX 843
            VLELS EEARQLGHNYIGS             VAARVLENLGADP+NIRTQVIRM     
Sbjct: 177  VLELSQEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPTNIRTQVIRMVGESA 236

Query: 844  XXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNP 1023
                          K PTLEEYGTNLTKLAEEGKLDPVVGRQ QIERVTQILGRRTKNNP
Sbjct: 237  DSVTATVGSGSSNNKTPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKNNP 296

Query: 1024 CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 1203
            CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL
Sbjct: 297  CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 356

Query: 1204 MEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MEEIKQSD+IILFIDEVHTLIGAGAAEGAID
Sbjct: 357  MEEIKQSDDIILFIDEVHTLIGAGAAEGAID 387



>gb:AB017063_1513334 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K3K7.>gb:AY102125_1577730 Arabidopsis thaliana
            AT5g50920/K3K7_7 mRNA, complete cds.
          Length = 929

 Score =  493 bits (1269), Expect = e-138
 Identities = 280/390 (71%), Positives = 288/390 (73%), Gaps = 1/390 (0%)
 Frame = +1

Query: 130  RVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSS-QSPSLKLRSFTGLRGGNA 306
            RVL QST  PSL    A  Q            R V M+CS  Q   L+++ F GLRG NA
Sbjct: 6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCSQLQVSGLRMQGFMGLRGNNA 60

Query: 307  LDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLGHNF 486
            LDT+ +S Q  HSK                 KAMFERFTEKAIKVIMLAQEEARRLGHNF
Sbjct: 61   LDTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNF 120

Query: 487  VXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRV 666
            V                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRV
Sbjct: 121  VGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRV 180

Query: 667  LELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXX 846
            LELSLEEARQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM      
Sbjct: 181  LELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNE 240

Query: 847  XXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPC 1026
                         KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPC
Sbjct: 241  VTANVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPC 299

Query: 1027 LIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM 1206
            LIGEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM
Sbjct: 300  LIGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLM 359

Query: 1207 EEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            EEI+QSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 360  EEIRQSDEIILFIDEVHTLIGAGAAEGAID 389



>pir|T52292|T52292 endopeptidase Clp (EC 3.4.21.92) ATP-binding chain
            C, chloroplast [imported] - Arabidopsis
            thaliana>gb:AF022909_1762028 Arabidopsis thaliana ClpC
            mRNA, nuclear gene encoding chloroplast protein, complete
            cds.
          Length = 928

 Score =  486 bits (1251), Expect = e-136
 Identities = 276/389 (70%), Positives = 284/389 (73%)
 Frame = +1

Query: 130  RVLVQSTNIPSLVAGEAIGQFXXXXXXXXXXXRVVAMLCSSQSPSLKLRSFTGLRGGNAL 309
            RVL QST  PSL    A  Q            R V M+C   +  L ++ F GLRG NAL
Sbjct: 6    RVLAQSTP-PSL----ACYQRNVPSRGSGRSRRSVKMMCIIFNVWLPMQGFMGLRGNNAL 60

Query: 310  DTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRLGHNFV 489
            DT+ +S Q  HSK                 KAMFERFTEKAIKVIMLAQEEARRLGHNFV
Sbjct: 61   DTLGKSRQDFHSKVRQAMNVPKGKASRFTVKAMFERFTEKAIKVIMLAQEEARRLGHNFV 120

Query: 490  XXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVL 669
                            AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVL
Sbjct: 121  GTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVL 180

Query: 670  ELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXX 849
            ELSLE  RQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM       
Sbjct: 181  ELSLEATRQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVGENNEV 240

Query: 850  XXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCL 1029
                        KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGRRTKNNPCL
Sbjct: 241  TANVGGGSSS-NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCL 299

Query: 1030 IGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME 1209
            IGEPGVGKTAIAEGLAQRIA+GDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME
Sbjct: 300  IGEPGVGKTAIAEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLME 359

Query: 1210 EIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            EI+QSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 360  EIRQSDEIILFIDEVHTLIGAGAAEGAID 388



>gb:AY056787_1563836 Arabidopsis thaliana AT3g48870/T21J18_140 mRNA,
            complete cds.
          Length = 558

 Score =  474 bits (1221), Expect = e-132
 Identities = 259/355 (72%), Positives = 270/355 (76%)
 Frame = +1

Query: 232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMF 411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K                 KAMF
Sbjct: 56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF 115

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ERFTEKAIKVIML+QEEARRLGHNFV                AAKVLKSMGINLKD+RVE
Sbjct: 116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE 175

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGS             VAAR
Sbjct: 176  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAAR 235

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            VLENLGADPSNIRTQVIRM                   KMPTLEEYGTNLTKLAEEGKLD
Sbjct: 236  VLENLGADPSNIRTQVIRMVGENNEVTASVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLD 295

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PVVGRQ QIERV QIL RRTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVPETIEGK VI
Sbjct: 296  PVVGRQPQIERVVQILARRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKTVI 355

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            TLDMGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 356  TLDMGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILFIDEVHTLIGAGAAEGAID 410



>pir|T52456|T52456 endopeptidase Clp ATP-binding chain C [imported] -
            Arabidopsis thaliana>gb:AB022324_1515222 Arabidopsis
            thaliana mRNA for AtClpC, complete cds.
          Length = 952

 Score =  474 bits (1221), Expect = e-132
 Identities = 259/355 (72%), Positives = 270/355 (76%)
 Frame = +1

Query: 232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMF 411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K                 KAMF
Sbjct: 56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF 115

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ERFTEKAIKVIML+QEEARRLGHNFV                AAKVLKSMGINLKD+RVE
Sbjct: 116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE 175

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGS             VAAR
Sbjct: 176  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAAR 235

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            VLENLGADPSNIRTQVIRM                   KMPTLEEYGTNLTKLAEEGKLD
Sbjct: 236  VLENLGADPSNIRTQVIRMVGENNEVTASVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLD 295

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PVVGRQ QIERV QIL RRTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVPETIEGK VI
Sbjct: 296  PVVGRQPQIERVVQILARRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKTVI 355

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            TLDMGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 356  TLDMGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILFIDEVHTLIGAGAAEGAID 410



>pir|T49283|T49283 AtClpC - Arabidopsis thaliana>gb:AX765872_1474625
            Sequence 81 from Patent WO03008440.>gb:ATT21J18_1555142
            Arabidopsis thaliana DNA chromosome 3, BAC clone T21J18.
          Length = 952

 Score =  473 bits (1218), Expect = e-132
 Identities = 258/355 (72%), Positives = 270/355 (76%)
 Frame = +1

Query: 232  VAMLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMF 411
            V M+ S Q+P L ++SF+GLR  +ALD + R       K                 KAMF
Sbjct: 56   VKMMSSLQAPLLTIQSFSGLRAPSALDYLGRPSPGFLVKYKLAKSSGREKASRCVPKAMF 115

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ERFTEKAIKVIML+QEEARRLGHNFV                AAKVLKSMGINLKD+RVE
Sbjct: 116  ERFTEKAIKVIMLSQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDSRVE 175

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGS             VAAR
Sbjct: 176  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAAR 235

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            VLENLGADPSNIRTQVIRM                   KMPTLEEYGTNLTKLAEEGKLD
Sbjct: 236  VLENLGADPSNIRTQVIRMVGENNEVTASVGGGSSGNSKMPTLEEYGTNLTKLAEEGKLD 295

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PVVGRQ QIER+ QIL RRTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVPETIEGK VI
Sbjct: 296  PVVGRQPQIERMVQILARRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPETIEGKTVI 355

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            TLDMGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 356  TLDMGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILFIDEVHTLIGAGAAEGAID 410



>gb:OSJN00240_1697237 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0039C07, complete sequence.
          Length = 888

 Score =  469 bits (1208), Expect = e-131
 Identities = 257/353 (72%), Positives = 270/353 (76%)
 Frame = +1

Query: 238  MLCSSQSPSLKLRSFTGLRGGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFER 417
            M+ +  + +L L  F GLR  N LD+ +   +   S                  +AMFER
Sbjct: 1    MMRTMPTRTLTLGGFQGLRQTNFLDSRSVIKRDFGSIVASQISRPRGLGSRGVVRAMFER 60

Query: 418  FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
            FTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMGINLKDARVEVE
Sbjct: 61   FTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVE 120

Query: 598  KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVL 777
            KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGS             VAARVL
Sbjct: 121  KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVL 180

Query: 778  ENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPV 957
            E+LGADP+NIRTQVIRM                  QKMPTLEEYGTNLTKLAEEGKLDPV
Sbjct: 181  ESLGADPNNIRTQVIRMVGESTEAVGAGVGGGSSGQKMPTLEEYGTNLTKLAEEGKLDPV 240

Query: 958  VGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITL 1137
            VGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI+NGDVPETIEGKKVITL
Sbjct: 241  VGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRISNGDVPETIEGKKVITL 300

Query: 1138 DMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            DMGLLVAGTKYRGEFEERLKKLMEEIKQ+D+IILFIDEVHTLIGAGAAEGAID
Sbjct: 301  DMGLLVAGTKYRGEFEERLKKLMEEIKQNDDIILFIDEVHTLIGAGAAEGAID 353



>pir|S37557|S37557 endopeptidase Clp ATP-binding chain A, chloroplast
            - rape  (fragment)
          Length = 874

 Score =  454 bits (1169), Expect = e-126
 Identities = 251/334 (75%), Positives = 255/334 (76%)
 Frame = +1

Query: 295  GGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRL 474
            G N LDT+ RS Q+   K                 KAMFERFTEKAIKVIMLAQEEARRL
Sbjct: 4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL 63

Query: 475  GHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR 654
            GHNFV                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR
Sbjct: 64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR 123

Query: 655  AKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXX 834
            AKRVLELSLEEARQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM  
Sbjct: 124  AKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVG 183

Query: 835  XXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTK 1014
                             KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERV QILGRRTK
Sbjct: 184  ENNEVTANVGGGSGT-NKMPTLEEYGTNLTKLAEEGKLDPVVGRHPQIERVVQILGRRTK 242

Query: 1015 NNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERL 1194
            NNPCLIGEPGVGKTAIAEGLAQRIA+G V ET EGKKVITLDMGLL AGTKYRGEFEER+
Sbjct: 243  NNPCLIGEPGVGKTAIAEGLAQRIASGVVRETSEGKKVITLDMGLLAAGTKYRGEFEERV 302

Query: 1195 KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 303  KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 336



>sp|P46523|CLPA_BRANA ATP-dependent Clp protease ATP-binding subunit
            clpA homolog, chloroplast precursor
            (Fragment).>gb:BNCLPA_1633519 B.napus (Topas) clpA mRNA.
          Length = 874

 Score =  454 bits (1169), Expect = e-126
 Identities = 251/334 (75%), Positives = 255/334 (76%)
 Frame = +1

Query: 295  GGNALDTMARSGQTLHSKXXXXXXXXXXXXXXXXXKAMFERFTEKAIKVIMLAQEEARRL 474
            G N LDT+ RS Q+   K                 KAMFERFTEKAIKVIMLAQEEARRL
Sbjct: 4    GNNVLDTLGRSRQSFGGKVRQAMNVPKGKGSRGVVKAMFERFTEKAIKVIMLAQEEARRL 63

Query: 475  GHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR 654
            GHNFV                AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR
Sbjct: 64   GHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPR 123

Query: 655  AKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXX 834
            AKRVLELSLEEARQLGHNYIGS             VAARVLENLGADPSNIRTQVIRM  
Sbjct: 124  AKRVLELSLEEARQLGHNYIGSEHLLLGLLREGEGVAARVLENLGADPSNIRTQVIRMVG 183

Query: 835  XXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTK 1014
                             KMPTLEEYGTNLTKLAEEGKLDPVVGR  QIERV QILGRRTK
Sbjct: 184  ENNEVTANVGGGSGT-NKMPTLEEYGTNLTKLAEEGKLDPVVGRHPQIERVVQILGRRTK 242

Query: 1015 NNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERL 1194
            NNPCLIGEPGVGKTAIAEGLAQRIA+G V ET EGKKVITLDMGLL AGTKYRGEFEER+
Sbjct: 243  NNPCLIGEPGVGKTAIAEGLAQRIASGVVRETSEGKKVITLDMGLLAAGTKYRGEFEERV 302

Query: 1195 KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID
Sbjct: 303  KKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 336



>pir|S76330|S76330 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain C
            [similarity] - Synechocystis sp. (strain PCC
            6803)>gb:BA000022_689571 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 821

 Score =  404 bits (1038), Expect = e-111
 Identities = 215/297 (72%), Positives = 235/297 (79%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D S +RTQVIRM                   K PTL+E+G+NLT++A EGK
Sbjct: 121  ARVLENLGVDLSKVRTQVIRMLGETAEVAAGGGSGGRT--KTPTLDEFGSNLTQMAAEGK 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIAN D+P+ +E K+
Sbjct: 179  LDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPDILEEKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+Q+  IIL IDEVHTLIGAGAAEGAID
Sbjct: 239  VVTLDIGLLVAGTKYRGEFEERLKKIMDEIRQAGNIILVIDEVHTLIGAGAAEGAID 295



>gb:BA000039_726092 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 824

 Score =  403 bits (1036), Expect = e-111
 Identities = 215/297 (72%), Positives = 234/297 (78%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVL+SMG+NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLRSMGVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D S +RTQVIRM                   K PTL+E+G NLT+LA EGK
Sbjct: 121  ARVLENLGVDLSKVRTQVIRMLGETAEVTAGASQGRT---KTPTLDEFGVNLTQLAIEGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIAN DVP+ +E K+
Sbjct: 178  LDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDVPDILEDKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+Q+  +IL IDEVHTLIGAGAAEGAID
Sbjct: 238  VVTLDIGLLVAGTKYRGEFEERLKKIMDEIRQAGNVILVIDEVHTLIGAGAAEGAID 294



>pir|S71553|S71553 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain
            clpC [similarity] - Synechococcus sp. (strain PCC
            7942)>gb:SSU16134_191084 Synechococcus sp. Clp protease
            putative regulatory subunit (clpC) gene, complete cds.
          Length = 839

 Score =  402 bits (1032), Expect = e-110
 Identities = 213/299 (71%), Positives = 235/299 (78%)
 Frame = +1

Query: 400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            +AMFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKD
Sbjct: 14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD 73

Query: 580  ARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            AR+EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             
Sbjct: 74   ARIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEG 133

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
            VAARVLENLG D S +RTQVIRM                   K PTL+E+G+NLT+ A +
Sbjct: 134  VAARVLENLGVDLSKVRTQVIRMLGETAEVSTGGGQGRT---KTPTLDEFGSNLTQQAAD 190

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIA GD+P+ +E 
Sbjct: 191  GKLDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIATGDIPDILED 250

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+ +  +IL IDEVHTLIGAGAAEGAID
Sbjct: 251  KRVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRSAGNVILVIDEVHTLIGAGAAEGAID 309



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +1

Query: 610 RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLG 789
           R +G  A+   FT +A +V+ L+ EEAR+LGHN++G+             VAA+VL+++G
Sbjct: 9   RHAGREAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMG 68

Query: 790 ADPSNIRTQV 819
            +  + R +V
Sbjct: 69  VNLKDARIEV 78



>gb:AP008231_580948 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 839

 Score =  401 bits (1030), Expect = e-110
 Identities = 212/299 (70%), Positives = 235/299 (78%)
 Frame = +1

Query: 400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            +AMFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKD
Sbjct: 14   EAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKD 73

Query: 580  ARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            AR+EVEKIIGRGSGFVA EIPFTPRAKRVLELSLEEARQLGHNYIG+             
Sbjct: 74   ARIEVEKIIGRGSGFVAAEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEG 133

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
            VAARVLENLG D S +RTQVIRM                   K PTL+E+G+NLT+ A +
Sbjct: 134  VAARVLENLGVDLSKVRTQVIRMLGETAEVSTGGGQGRT---KTPTLDEFGSNLTQQAAD 190

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIA GD+P+ +E 
Sbjct: 191  GKLDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIATGDIPDILED 250

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K+V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+ + ++IL IDEVHTLIGAGAAEGAID
Sbjct: 251  KRVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRSAGDVILVIDEVHTLIGAGAAEGAID 309



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 25/70 (35%), Positives = 42/70 (60%)
 Frame = +1

Query: 610 RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLG 789
           R +G  A+   FT +A +V+ L+ EEAR+LGHN++G+             VAA+VL+++G
Sbjct: 9   RHAGREAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMG 68

Query: 790 ADPSNIRTQV 819
            +  + R +V
Sbjct: 69  VNLKDARIEV 78



>gb:AE017164_395563 Prochlorococcus marinus subsp. marinus str.
            CCMP1375 section 4 of 6 of the complete
            genome.>gb:AE017126_1031232 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 856

 Score =  399 bits (1025), Expect = e-110
 Identities = 213/297 (71%), Positives = 231/297 (77%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKD+R
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDSR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D + +RTQVIRM                   K  TL+E+GTNLTKLA E K
Sbjct: 121  ARVLENLGVDLTKVRTQVIRMLGETAEVSAGGGSGKGSI-KTATLDEFGTNLTKLASESK 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGR D+I+RV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI  GD+P+ +E K+
Sbjct: 180  LDPVVGRHDEIDRVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIQQGDIPDILEEKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+MEEIK +  +IL IDEVHTLIGAGAAEGAID
Sbjct: 240  VLTLDIGLLVAGTKYRGEFEERLKKIMEEIKSAGNVILVIDEVHTLIGAGAAEGAID 296



>pir|AH2180|AH2180 endopeptidase Clp ATP-binding chain [imported] -
            Nostoc sp.  (strain PCC 7120)>gb:BA000019_683988 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 839

 Score =  399 bits (1024), Expect = e-110
 Identities = 212/298 (71%), Positives = 233/298 (78%)
 Frame = +1

Query: 403  AMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDA 582
            AMFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKDA
Sbjct: 16   AMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDA 75

Query: 583  RVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            R+EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             V
Sbjct: 76   RIEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGV 135

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            AARVLENLG D S +RTQVIRM                   K PTL+E+G+NLT++A + 
Sbjct: 136  AARVLENLGVDLSKVRTQVIRMLGETAEVSATGQSGRT---KTPTLDEFGSNLTQMATDN 192

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPVVGR  +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLA RIAN DVP+ +E K
Sbjct: 193  KLDPVVGRAKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLASRIANKDVPDILEDK 252

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+Q+  +IL IDEVHTLIGAGAAEGAID
Sbjct: 253  RVVTLDIGLLVAGTKYRGEFEERLKKIMDEIRQAGNVILVIDEVHTLIGAGAAEGAID 310



 Score = 47.0 bits (110), Expect = 9e-04
 Identities = 25/69 (36%), Positives = 41/69 (59%)
 Frame = +1

Query: 613 GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGA 792
           G G  A+   FT +A +V+ L+ EEAR+LGHN++G+             VAA+VL+++G 
Sbjct: 11  GDGKNAMFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGV 70

Query: 793 DPSNIRTQV 819
           +  + R +V
Sbjct: 71  NLKDARIEV 79



>gb:BA000045_742139 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 819

 Score =  397 bits (1021), Expect = e-109
 Identities = 209/297 (70%), Positives = 233/297 (78%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D S +RTQVIRM                   K PTL+E+G+NLT++A EGK
Sbjct: 121  ARVLENLGVDLSKVRTQVIRMLGETAEVSAGGNTGRT---KTPTLDEFGSNLTQMAAEGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGR+ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI+N D+P+ +  K+
Sbjct: 178  LDPVVGREKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRISNNDIPDILADKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+M+EI+ +  ++L IDEVHTLIGAGAAEGAID
Sbjct: 238  VVTLDIGLLVAGTKYRGEFEERLKKIMDEIRAAGNVVLVIDEVHTLIGAGAAEGAID 294



>sp|P51332|CLPC_PORPU ATP-dependent Clp protease ATP-binding subunit
            clpA homolog.>pir|S73253|S73253 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain clpC [similarity] - red alga
            (Porphyra purpurea) chloroplast>gb:PPU38804_1701648
            Porphyra purpurea chloroplast, complete genome.
          Length = 821

 Score =  397 bits (1019), Expect = e-109
 Identities = 212/297 (71%), Positives = 230/297 (77%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AA+VLKSM +NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLVGEGTGIAAQVLKSMNVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLMGLVREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENL  D S+IR +VI+M                   K PTLEE+G+NLT++A EG 
Sbjct: 121  ARVLENLAVDVSSIRAEVIQMLGENAEANVSGSNATQARSKTPTLEEFGSNLTQMAIEGG 180

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIAN DVP  +E K 
Sbjct: 181  LDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIANRDVPSILEDKL 240

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            VITLD+GLLVAGTKYRGEFEERLK++M+EIK +D +IL IDEVHTLIGAGAAEGAID
Sbjct: 241  VITLDVGLLVAGTKYRGEFEERLKRIMDEIKSADNVILVIDEVHTLIGAGAAEGAID 297



>gb:BX569691_775840 Synechococcus sp. WH8102 complete genome; segment
            3/7.
          Length = 846

 Score =  396 bits (1018), Expect = e-109
 Identities = 211/298 (70%), Positives = 232/298 (77%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMGVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ-KMPTLEEYGTNLTKLAEEG 942
            ARVLENLG D + +RTQVIRM                    K PTL+E+G+NLT++A E 
Sbjct: 121  ARVLENLGVDLAKVRTQVIRMLGETAEVSGGGGGGGAKGSTKTPTLDEFGSNLTQMANEA 180

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPVVGR ++IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI  G++P+ +E K
Sbjct: 181  KLDPVVGRHNEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIQQGEIPDILEDK 240

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V+TLD+GLLVAGTKYRGEFEERLKK+MEEIK +  +IL IDEVHTLIGAGAAEGAID
Sbjct: 241  RVLTLDIGLLVAGTKYRGEFEERLKKIMEEIKAAGNVILVIDEVHTLIGAGAAEGAID 298



>gb:BX572098_798403 Prochlorococcus marinus MIT9313 complete genome;
            segment 4/7.
          Length = 859

 Score =  394 bits (1013), Expect = e-108
 Identities = 211/297 (71%), Positives = 231/297 (77%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSM +NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSMSVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D + +RTQVIRM                   K  TL+E+G+NLT+LA E K
Sbjct: 121  ARVLENLGVDLAKVRTQVIRMLGETAEVTAGGGGGKGST-KTATLDEFGSNLTQLANESK 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ++I+RV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI  GD+P+ +E K+
Sbjct: 180  LDPVVGRQNEIDRVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIQQGDIPDILEEKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+MEEIK +  +IL IDEVHTLIGAGAAEGAID
Sbjct: 240  VLTLDIGLLVAGTKYRGEFEERLKKIMEEIKAAGNVILVIDEVHTLIGAGAAEGAID 296



>sp|O78410|CLPC_GUITH ATP-dependent Clp protease ATP-binding subunit
            clpA homolog.>gb:AF041468_1763464 Guillardia theta
            complete plastid genome.
          Length = 819

 Score =  393 bits (1010), Expect = e-108
 Identities = 210/297 (70%), Positives = 232/297 (78%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKSMG+NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENL  D + +RTQVIR+                   K PTLEE+G+NLT+ A EGK
Sbjct: 121  ARVLENLALDLTKVRTQVIRLLGDTAEVSATNGQTKG---KTPTLEEFGSNLTQKAAEGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI N DVP+ +E K+
Sbjct: 178  LDPVIGRQKEIERVIQILGRRTKNNPILIGEPGVGKTAIAEGLAQRINNRDVPDILEDKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+++EI+ ++ +IL IDEVHTLIGAGAAEGAID
Sbjct: 238  VVTLDIGLLVAGTKYRGEFEERLKKIIDEIRVANNVILVIDEVHTLIGAGAAEGAID 294



>gb:AY673996_1621408 Gracilaria tenuistipitata var. liui chloroplast,
            complete genome.
          Length = 823

 Score =  392 bits (1008), Expect = e-108
 Identities = 208/297 (70%), Positives = 231/297 (77%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AA+VLKSM +NLKDAR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAQVLKSMNVNLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLMGLVREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENL  + ++IRT+VI+M                   K PTLEE+G+NLT+LA EG 
Sbjct: 121  ARVLENLAVNVASIRTEVIQMLGDTTEANTNGNNNTQTRSKTPTLEEFGSNLTELAIEGI 180

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIAN D+P  +E K 
Sbjct: 181  LDPVVGRQKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIANKDIPSILEDKL 240

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLK++M+EIK ++ I+L IDEVHTLIGAGAAEGAID
Sbjct: 241  VVTLDVGLLVAGTKYRGEFEERLKRIMDEIKSANNIVLVIDEVHTLIGAGAAEGAID 297



>gb:BX572092_796714 Prochlorococcus marinus MED4 complete genome;
            segment 3/5.
          Length = 842

 Score =  391 bits (1004), Expect = e-107
 Identities = 209/297 (70%), Positives = 230/297 (77%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AAKVLKS+G+NLKD+R
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGVAAKVLKSLGVNLKDSR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG+             VA
Sbjct: 61   IEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLENLG D + +RTQVIRM                   K  TL+E+GTNLTKLA E K
Sbjct: 121  ARVLENLGIDLTKVRTQVIRMLGETAEVGSGGSSNKGNL-KTATLDEFGTNLTKLASESK 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGR  +I+RV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI  G++P+ +E K+
Sbjct: 180  LDPVVGRYAEIDRVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIQLGEIPDILEDKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLD+GLLVAGTKYRGEFEERLKK+MEEIK +  +IL IDEVHTLIGAGAAEGAID
Sbjct: 240  VLTLDIGLLVAGTKYRGEFEERLKKIMEEIKSAGNVILVIDEVHTLIGAGAAEGAID 296



>sp|Q9TM05|CLPC_CYACA ATP-dependent Clp protease ATP-binding subunit
            clpA homolog.>gb:AF022186_1761876 Cyanidium caldarium
            strain RK1 chloroplast, complete genome.
          Length = 854

 Score =  385 bits (989), Expect = e-105
 Identities = 202/299 (67%), Positives = 229/299 (76%)
 Frame = +1

Query: 400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            K MFERFTEKA+KVIMLAQEEARRLGHNFV                AAK LKSMGI LKD
Sbjct: 30   KNMFERFTEKAVKVIMLAQEEARRLGHNFVGTEQILLGILGEGTGLAAKALKSMGITLKD 89

Query: 580  ARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            AR+EVEKIIGRGSGFVA+EIPFTPRAK++LEL++EE+R L HNY+G+             
Sbjct: 90   ARIEVEKIIGRGSGFVAIEIPFTPRAKKILELAIEESRILTHNYVGTEHLLLGLIKEGEG 149

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
            VAARVLENLG D   +R+ +IRM                   K+PTLEE+GTNLT++A E
Sbjct: 150  VAARVLENLGVDLPKLRSNIIRMIGETSEVSVGATSGRS---KVPTLEEFGTNLTQMAVE 206

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPVVGR  +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI N +VP+T+E 
Sbjct: 207  GKLDPVVGRAKEIERVVQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIINNEVPDTLED 266

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            KKVITLD+ LLVAGTKYRGEFEERLKK+M+EI+ +D +IL IDEVHTLIGAGAAEGAID
Sbjct: 267  KKVITLDVSLLVAGTKYRGEFEERLKKIMDEIRMADNVILVIDEVHTLIGAGAAEGAID 325



>gb:AB002583_1508807 Cyanidioschyzon merolae chloroplast DNA, complete
            genome, strain:10D.
          Length = 821

 Score =  372 bits (955), Expect = e-102
 Identities = 199/297 (67%), Positives = 228/297 (76%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVIMLAQEEARRLGHNFV                AA+ LK++G++LK+AR
Sbjct: 1    MFERFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGLAARALKTLGVDLKEAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSL+EAR L HNYIG+             VA
Sbjct: 61   VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLDEARILSHNYIGTEHLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVLE+LG D + +R+ V+RM                   + PTLEE+G NLT+LA EG+
Sbjct: 121  ARVLESLGVDLATLRSLVLRMLDETSEVVIGGGYSRS---RTPTLEEFGVNLTELAMEGE 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGR+ +IERV QILGRRTKNNP LIGEPGVGKTAIAEGLAQRIA+ D+P+ +E  K
Sbjct: 178  LDPVVGREKEIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIADRDIPDILEDMK 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            VITLD+GLLVAGTKYRGEFEERLKK+M+EI++   +IL IDEVHTLIGAGAAEGAID
Sbjct: 238  VITLDIGLLVAGTKYRGEFEERLKKVMDEIREVGNVILVIDEVHTLIGAGAAEGAID 294



>pir|AE2051|AE2051 endopeptidase Clp ATP-binding chain [imported] -
            Nostoc sp.  (strain PCC 7120)>gb:BA000019_682952 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 814

 Score =  332 bits (852), Expect = 8e-90
 Identities = 174/297 (58%), Positives = 208/297 (70%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE FT +AIKVIMLAQEEARRLGHNFV                AAKVL  MG+ LKDAR
Sbjct: 1    MFEHFTSEAIKVIMLAQEEARRLGHNFVGTEQILLGLMGEGTGVAAKVLTEMGVTLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVEKIIGRGSGFV  EIPFTP+ K + E S  EA  LG+NYI +             VA
Sbjct: 61   REVEKIIGRGSGFVPPEIPFTPKVKSLFEQSFREAHNLGNNYINTEHLLLGLTEAGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            A+VL+NLG D  ++R+ VIR                    + P +EE+G NLTKLA+EGK
Sbjct: 121  AKVLQNLGVDLKSVRSAVIRRLGEDPTVVVGGGGSRR--NQTPMMEEFGRNLTKLAKEGK 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGRQ +IER  QILGRRTKNNP LIGEPGVGKTAIAEGLAQRI N DVP+ ++ K+
Sbjct: 179  LDPVVGRQKEIERTVQILGRRTKNNPVLIGEPGVGKTAIAEGLAQRIINQDVPDILQDKQ 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG LVAGT++RG+FEER+KK++EE++ +  IIL IDE+HTL+GAG  EG +D
Sbjct: 239  VVSLDMGSLVAGTRFRGDFEERIKKIVEEVRSAGNIILVIDEIHTLVGAGGTEGGLD 295



>gb:AP006618_556806 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 851

 Score =  306 bits (785), Expect = 5e-82
 Identities = 163/300 (54%), Positives = 208/300 (69%), Gaps = 3/300 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT---LEEYGTNLTKLAE 936
            A+VL  LGAD + +R QVI++                      T   L+++G NLT+ A 
Sbjct: 121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEPVESGARGETGTPSTSLVLDQFGRNLTQAAL 180

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            EGKLDPV+GR  +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I NG+VPET++
Sbjct: 181  EGKLDPVIGRSKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVNGEVPETLK 240

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEGAID
Sbjct: 241  DKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEGAID 300



>gb:AP006840_570319 Symbiobacterium thermophilum DNA, complete genome.
          Length = 833

 Score =  306 bits (784), Expect = 6e-82
 Identities = 164/303 (54%), Positives = 211/303 (69%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF R+TE+A +VI+LAQ+EARRL +++V                AAK L+S+GI L+  R
Sbjct: 1    MFSRYTERAQRVIVLAQDEARRLNYDYVGTEHLLLGLIREGEGIAAKALQSLGIQLEQVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVL-ELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVEK+IG+GS     EI FTPRAK+V+ EL++EEAR LGHNY+G+             V
Sbjct: 61   AEVEKMIGKGSASSRGEIGFTPRAKKVMVELAIEEARLLGHNYVGTEHILLGLIREGEGV 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMP-----TLEEYGTNLTK 927
            AA+VL+NLGAD   +R QVI +                   K P     TL+++G +L +
Sbjct: 121  AAQVLQNLGADLERVRNQVIHLLGGVPHPPAGSSMPGSAKVKGPKTSTSTLDQFGRDLNQ 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
            +A +GKLDPV+GR+ +IERV QIL RRTKNNP LIGEPGVGKTAIAEGLAQRI +G VPE
Sbjct: 181  MARDGKLDPVIGREKEIERVIQILTRRTKNNPVLIGEPGVGKTAIAEGLAQRIVDGRVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
             ++ K+V+ LD+  LVAG+KYRGEFEERLKK++EEI+ +  +ILFIDE+HT+IGAGAAEG
Sbjct: 241  ILKDKRVVALDLASLVAGSKYRGEFEERLKKVLEEIRNAGNVILFIDELHTIIGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>gb:BA000030_702584 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 841

 Score =  305 bits (781), Expect = 1e-81
 Identities = 160/299 (53%), Positives = 207/299 (69%), Gaps = 2/299 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTL--EEYGTNLTKLAEE 939
            A+VL  LGAD + +R QVI++                      +L  +++G NLT+ A E
Sbjct: 121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETAAAGGPAEGTPSTSLVLDQFGRNLTQAARE 180

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
             KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I  G+VPET++ 
Sbjct: 181  SKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVKGEVPETLKD 240

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K + TLD+G LVAG++YRG+FEERLKK+++EI+   +IILFIDE+HTL+GAGAAEGAID
Sbjct: 241  KHLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIILFIDELHTLVGAGAAEGAID 299



>pir|T36384|T36384 probable ATP-binding proteinase - Streptomyces
            coelicolor>gb:SCO939116_177046 Streptomyces coelicolor
            A3(2) complete genome; segment 13/29.
          Length = 841

 Score =  305 bits (781), Expect = 1e-81
 Identities = 160/299 (53%), Positives = 207/299 (69%), Gaps = 2/299 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTL--EEYGTNLTKLAEE 939
            A+VL  LGAD + +R QVI++                      +L  +++G NLT+ A E
Sbjct: 121  AQVLVKLGADLNRVRQQVIQLLSGYQGKETATAGGPAEGTPSTSLVLDQFGRNLTQAARE 180

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
             KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I  G+VPET++ 
Sbjct: 181  SKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVKGEVPETLKD 240

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K + TLD+G LVAG++YRG+FEERLKK+++EI+   +IILFIDE+HTL+GAGAAEGAID
Sbjct: 241  KHLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIILFIDELHTLVGAGAAEGAID 299



>gb:BA000030_700486 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 842

 Score =  305 bits (780), Expect = 2e-81
 Identities = 161/300 (53%), Positives = 207/300 (69%), Gaps = 3/300 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   QQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT---LEEYGTNLTKLAE 936
            A+VL  LGAD + +R QVI++                      T   L+++G NLT+ A 
Sbjct: 121  AQVLVKLGADLNRVRQQVIQLLSGYHQGKESTVEGGPAEGTPSTSLVLDQFGRNLTQAAR 180

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            E KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I  G+VPET++
Sbjct: 181  ESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVKGEVPETLK 240

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K + TLD+G LVAG++YRG+FEERLKK+++EI+   +IILFIDE+HTL+GAGAAEGAID
Sbjct: 241  DKHLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIILFIDELHTLVGAGAAEGAID 300



>gb:AE000516_23831 Mycobacterium tuberculosis CDC1551, complete
            genome.
          Length = 848

 Score =  303 bits (777), Expect = 4e-81
 Identities = 161/303 (53%), Positives = 209/303 (68%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A KV++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARKVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A EGKLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G+VPE
Sbjct: 181  AAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>sp|O06286|CLPC_MYCTU Probable ATP-dependent Clp protease ATP-binding
            subunit.>pir|E70954|E70954 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain clpC [similarity] -
            Mycobacterium tuberculosis (strain
            H37RV)>gb:BX248346_760982 Mycobacterium bovis subsp.
            bovis AF2122/97 complete genome; segment
            13/14.>gb:BX842583_821704 Mycobacterium tuberculosis
            H37Rv complete genome; segment 12/13.
          Length = 848

 Score =  302 bits (774), Expect = 9e-81
 Identities = 160/303 (52%), Positives = 209/303 (68%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A EGKLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G+VPE
Sbjct: 181  AAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>gb:AE017228_411166 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 2 of 16 of the complete
            genome.>gb:AE016958_1054570 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 843

 Score =  301 bits (772), Expect = 1e-80
 Identities = 160/303 (52%), Positives = 208/303 (68%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L+S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A EGKLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G VPE
Sbjct: 181  AAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGQVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>gb:BX248359_763248 Corynebacterium diphtheriae gravis NCTC13129,
            complete genome; segment 6/8.
          Length = 883

 Score =  300 bits (768), Expect = 4e-80
 Identities = 164/316 (51%), Positives = 205/316 (64%), Gaps = 19/316 (6%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +VI+LAQEEAR L HN++                AAK L+SMGI+L+  R
Sbjct: 6    MFERFTDRARRVIVLAQEEARGLNHNYIGTEHILLGLIHEGEGVAAKALESMGISLEAVR 65

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE+IIG GS   A  IPFTPRAK+VLELSL E  Q+GH YIG+             VA
Sbjct: 66   QEVEEIIGHGSEPPAGHIPFTPRAKKVLELSLREGLQMGHKYIGTEFLLLGLIREGDGVA 125

Query: 766  ARVLENLGADPSNIRTQVIRMXXX-------------------XXXXXXXXXXXXXXXQK 888
            A+VL  LGAD   +R QVI++                                       
Sbjct: 126  AQVLVKLGADLPRVRQQVIQLLSGYEGGESPENNNEGEAVGAGTGAGRAGRGGGAGERSN 185

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
               L+++G NLT+ A+EGKLDPVVGR+ +IER+ Q+L RRTKNNP LIGEPGVGKTA+ E
Sbjct: 186  SLVLDQFGRNLTQAAKEGKLDPVVGREQEIERIMQVLSRRTKNNPVLIGEPGVGKTAVVE 245

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFID 1248
            GLA  I NG VPET++ K+V +LD+G LVAG++YRG+FEERLKK+++EI Q  +IILFID
Sbjct: 246  GLALDIVNGKVPETLKDKQVYSLDLGSLVAGSRYRGDFEERLKKVLKEINQRGDIILFID 305

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HTL+GAGAAEGAID
Sbjct: 306  EIHTLVGAGAAEGAID 321



>gb:MLPUTATP_148776 Mycobacterium leprae DNA for putative atp operon.
          Length = 649

 Score =  298 bits (763), Expect = 2e-79
 Identities = 159/303 (52%), Positives = 206/303 (67%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLDSLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEDIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A E KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G+VPE
Sbjct: 181  AAMESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>pir|S11163|S11163 endopeptidase Clp ATP-binding chain C -
            Mycobacterium leprae (fragment)
          Length = 649

 Score =  298 bits (763), Expect = 2e-79
 Identities = 159/303 (52%), Positives = 206/303 (67%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLDSLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEDIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A E KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G+VPE
Sbjct: 181  AAMESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>sp|P24428|CLPC_MYCLE Probable ATP-dependent Clp protease ATP-binding
            subunit.>pir|C86938|C86938 probable ATP-dependent Clp
            proteinase [imported] - Mycobacterium
            leprae>gb:MLEPRTN1_145837 Mycobacterium leprae strain TN
            complete genome; segment 1/10.
          Length = 848

 Score =  298 bits (763), Expect = 2e-79
 Identities = 159/303 (52%), Positives = 206/303 (67%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEAR L HN++                AAK L S+GI+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLDSLGISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   SQVEDIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT------LEEYGTNLTK 927
            A+VL  LGA+ + +R QVI++                   +  +      L+++G NLT 
Sbjct: 121  AQVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVLDQFGRNLTA 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A E KLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ EGLAQ I +G+VPE
Sbjct: 181  AAMESKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQAIVHGEVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T++ K++ TLD+G LVAG++YRG+FEERLKK+++EI    +IILFIDE+HTL+GAGAAEG
Sbjct: 241  TLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINTRGDIILFIDELHTLVGAGAAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>gb:BA000043_736655 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 810

 Score =  296 bits (758), Expect = 6e-79
 Identities = 159/297 (53%), Positives = 202/297 (68%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ LAQEEA RLGHN +                AAK L ++G+     +
Sbjct: 2    MFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGIAAKALMALGLGPDKIQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRGS  V+  I +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVESLIGRGSE-VSHTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A EG+
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNESMSGHGGGASHVST--PTLDSLARDLTAIAREGR 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPET+  K+
Sbjct: 179  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVNNEVPETLRDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 239  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 295



>gb:AE016822_341056 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 839

 Score =  295 bits (756), Expect = 1e-78
 Identities = 156/300 (52%), Positives = 202/300 (67%), Gaps = 3/300 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQEEA+ L HN++                AAK L+S+GI+L   R
Sbjct: 1    MFERFTDRARRVVVLAQEEAKMLNHNYIGTEHILLGLIHEGEGVAAKALESLGISLDAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +V+ IIG+G       IPFTPRAK+VLELSL EA QLGHNYIG+             VA
Sbjct: 61   EQVQDIIGQGQQQPTGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMP---TLEEYGTNLTKLAE 936
            A+VL  LGAD + +R QVI++                          L+++G NLT+ A 
Sbjct: 121  AQVLVKLGADLNRVRQQVIQLLSGYQGKEQVQVGGNDQATAQAGSQILDQFGRNLTQAAR 180

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            + KLDPV+GR+ +IERV QIL RR+KNNP LIGEPGVGKTA+ EGLAQ I  GDVPET++
Sbjct: 181  DNKLDPVIGREKEIERVMQILSRRSKNNPVLIGEPGVGKTAVVEGLAQAIVRGDVPETLK 240

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K++ TLD+G L+AG++YRG+FEERLKK+ +EI+   +II FIDE+HTL+GAGAAEGAID
Sbjct: 241  DKQLYTLDLGSLIAGSRYRGDFEERLKKVTKEIRTRGDIITFIDEIHTLVGAGAAEGAID 300



>gb:BA000035_717310 Corynebacterium efficiens YS-314 DNA, complete
            genome.
          Length = 927

 Score =  295 bits (755), Expect = 1e-78
 Identities = 163/321 (50%), Positives = 203/321 (63%), Gaps = 24/321 (7%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +VI+LAQEEAR L HN++                AAK L+SMGI+L   R
Sbjct: 1    MFERFTDRARRVIVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESMGISLDAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE+IIG GS      IPFTPRAK+VLELSL E  Q+GH YIG+             VA
Sbjct: 61   QEVEEIIGHGSKPTTGHIPFTPRAKKVLELSLREGLQMGHKYIGTEFLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ-------------------- 885
            A+VL  LGAD   +R QVI++                  Q                    
Sbjct: 121  AQVLVKLGADLPRVRQQVIQLLSGYEGGQGGSPDSPQGGQGGDAVGAGSAPGGRATGSGA 180

Query: 886  ----KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGK 1053
                    L+++G NLT+ A++GKLDPVVGR  +IER+ Q+L RRTKNNP LIGEPGVGK
Sbjct: 181  GERSNSLVLDQFGRNLTQAAKDGKLDPVVGRDKEIERIMQVLSRRTKNNPVLIGEPGVGK 240

Query: 1054 TAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEI 1233
            TA+ EGLA  I NG VPET++ K+V +LD+G LVAG++YRG+FEERLKK+++EI Q  +I
Sbjct: 241  TAVVEGLALDIVNGKVPETLKDKQVYSLDLGSLVAGSRYRGDFEERLKKVLKEINQRGDI 300

Query: 1234 ILFIDEVHTLIGAGAAEGAID 1296
            ILFIDE+HTL+GAGAAEGAID
Sbjct: 301  ILFIDEIHTLVGAGAAEGAID 321



>gb:BA000036_720405 Corynebacterium glutamicum ATCC 13032 DNA,
            complete genome.>gb:BX927156_834211 Corynebacterium
            glutamicum ATCC 13032, IS fingerprint type 4-5, complete
            genome; segment 9/10.>gb:AX065705_1459766 Sequence 49
            from Patent WO0100842.>gb:AX397919_1467053 Sequence 1
            from Patent WO0220574.
          Length = 925

 Score =  295 bits (754), Expect = 2e-78
 Identities = 165/325 (50%), Positives = 206/325 (63%), Gaps = 28/325 (8%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +VI+LAQEEAR L HN++                AAK L+SMGI+L   R
Sbjct: 1    MFERFTDRARRVIVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESMGISLDAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE+IIG+GS      IPFTPRAK+VLELSL E  Q+GH YIG+             VA
Sbjct: 61   QEVEEIIGQGSQPTTGHIPFTPRAKKVLELSLREGLQMGHKYIGTEFLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT---------------- 897
            A+VL  LGAD   +R QVI++                  Q  PT                
Sbjct: 121  AQVLVKLGADLPRVRQQVIQLLSGYEGGQGGSPEGG---QGAPTGGDAVGAGAAPGGRPS 177

Query: 898  ------------LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEP 1041
                        L+++G NLT+ A++GKLDPVVGR  +IER+ Q+L RRTKNNP LIGEP
Sbjct: 178  SGSPGERSTSLVLDQFGRNLTQAAKDGKLDPVVGRDKEIERIMQVLSRRTKNNPVLIGEP 237

Query: 1042 GVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ 1221
            GVGKTA+ EGLA  I NG VPET++ K+V +LD+G LVAG++YRG+FEERLKK+++EI Q
Sbjct: 238  GVGKTAVVEGLALDIVNGKVPETLKDKQVYSLDLGSLVAGSRYRGDFEERLKKVLKEINQ 297

Query: 1222 SDEIILFIDEVHTLIGAGAAEGAID 1296
              +IILFIDE+HTL+GAGAAEGAID
Sbjct: 298  RGDIILFIDEIHTLVGAGAAEGAID 322



>pir|G83662|G83662 class III stress response-related ATPase clpC
            [imported] - Bacillus halodurans (strain
            C-125)>gb:BA000004_654049 Bacillus halodurans C-125 DNA,
            complete genome.
          Length = 813

 Score =  294 bits (752), Expect = 3e-78
 Identities = 156/297 (52%), Positives = 199/297 (67%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ LAQEEA RLGHN +                AAK L+++G+  +  +
Sbjct: 2    MFGRFTERAQKVLALAQEEAIRLGHNNIGTEHILLGLIREGEGIAAKALQALGLGPEKIQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IG+G    A  I +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVETLIGKGQDG-AKTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A E  
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNETSSSSQQGGGAANANTPTLDSLARDLTAIAREEG 180

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +IERV Q+L RRTKNNP LIGEPGVGKTAIAEGLAQ I + +VPET+  K+
Sbjct: 181  LDPVIGRSKEIERVIQVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIIHNEVPETLRNKR 240

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 241  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 297



>gb:BA000028_694480 Oceanobacillus iheyensis HTE831 DNA, complete
            genome.
          Length = 809

 Score =  292 bits (747), Expect = 1e-77
 Identities = 158/298 (53%), Positives = 200/298 (67%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ L+QEEA RLGHN +                AAK L+S+G+ +   +
Sbjct: 2    MFGRFTERAQKVLALSQEEAVRLGHNNIGTEHILLGLVREGEGIAAKALQSLGLEVSKIQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVEK+IG G       I +TPRAK+V+ELS +EAR+LGH+Y+G+             VA
Sbjct: 62   EEVEKLIGVGKQ-PTQSIHYTPRAKKVVELSQDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ-KMPTLEEYGTNLTKLAEEG 942
            ARVL NLG   +  R QV+++                      PTL+    +LT  A+EG
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNESQAGRQGRSGQQSNASTPTLDSLARDLTVSAKEG 180

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            K+DPV+GR  +IERV Q+L RRTKNNP LIGEPGVGKTA+AEGLAQ+I + +VPET+  K
Sbjct: 181  KIDPVIGRSKEIERVIQVLSRRTKNNPVLIGEPGVGKTAVAEGLAQQIIDNEVPETLRDK 240

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V+TLDMG +VAGTKYRGEFE+RLKK+MEEI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 241  RVMTLDMGTVVAGTKYRGEFEDRLKKVMEEIRQAGNIILFIDELHTLIGAGGAEGAID 298



>sp|P37571|CLPC_BACSU Negative regulator of genetic competence
            clpC/mecB.>pir|I40508|I40508 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain clpC [similarity] - Bacillus
            subtilis>gb:BAC180K_744704 B. subtilis DNA, 180 kilobase
            region of replication origin.>gb:BSU02604_751369 Bacillus
            subtilis Marburg 168 ClpC adenosine triphosphatase (mecB)
            gene, complete cds, orfX and orfY, partial
            cds.>gb:BSUB0001_752051 Bacillus subtilis complete genome
            (section 1 of 21): from 1 to 213080.>gb:CQ796233_1453198
            Sequence 9 from Patent WO2004027092.
          Length = 810

 Score =  292 bits (747), Expect = 1e-77
 Identities = 155/297 (52%), Positives = 201/297 (67%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ LAQEEA RLGHN +                AAK L+++G+  +  +
Sbjct: 2    MFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLGSEKIQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRG   ++  I +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVESLIGRGQE-MSQTIHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A+E  
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNETGSSAAGTNSNA--NTPTLDSLARDLTAIAKEDS 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPE +  K+
Sbjct: 179  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIINNEVPEILRDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 239  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 295



>gb:CP000001_850713 Bacillus cereus ZK, complete genome.
          Length = 811

 Score =  291 bits (744), Expect = 3e-77
 Identities = 154/297 (51%), Positives = 203/297 (68%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ L+QEEA R+GHN +                AAK L ++G++ +  +
Sbjct: 2    MFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGIAAKALIALGLSPEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRG+  V+  + +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVEALIGRGTE-VSQTVHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A E +
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANT-PTLDSLARDLTVVARENR 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPET+  K+
Sbjct: 180  LDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVNNEVPETLRDKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 240  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 296



>gb:AE016998_375140 Bacillus cereus ATCC 14579 section 1 of 18 of the
            complete genome.>gb:AE016877_1015390 Bacillus cereus ATCC
            14579 complete genome.
          Length = 811

 Score =  290 bits (742), Expect = 4e-77
 Identities = 153/297 (51%), Positives = 202/297 (68%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ L+QEEA R+GHN +                AAK L ++G++ +  +
Sbjct: 2    MFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGIAAKALIALGLSPEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRG+   +  + +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVEALIGRGTE-ASQTVHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A E +
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANT-PTLDSLARDLTVVARENR 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPET+  K+
Sbjct: 180  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVNNEVPETLRDKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 240  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 296



>gb:AE017333_446040 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_855863 Bacillus licheniformis ATCC
            14580, complete genome.>gb:CQ796315_1453239 Sequence 91
            from Patent WO2004027092.
          Length = 810

 Score =  289 bits (740), Expect = 8e-77
 Identities = 154/297 (51%), Positives = 200/297 (67%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ LAQEEA RLGHN +                AAK L+++G++    +
Sbjct: 2    MFGRFTERAQKVLALAQEEALRLGHNNIGTEHILLGLVREGEGIAAKALQALGLSPDKIQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRG   ++  I +TPRAK+V EL+++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVESLIGRGQE-MSQSIHYTPRAKKVTELAMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A+E  
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNESGGAASGANSSA--NTPTLDSLARDLTAIAKEDS 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPE +  K+
Sbjct: 179  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIINNEVPEILRDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 239  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 295



>gb:AE017283_430068 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 844

 Score =  289 bits (740), Expect = 8e-77
 Identities = 149/302 (49%), Positives = 201/302 (66%), Gaps = 5/302 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +V++LAQ+EA+ L HN++                AAK L+S+ I+L+  R
Sbjct: 1    MFERFTDRARRVVVLAQDEAKALNHNYIGTEHLLLGLISEGEGVAAKALESLDISLEAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE+IIG G+      IPFTPRAK+VLELSL EA Q+ H+YIG+             VA
Sbjct: 61   AQVEEIIGHGTSTPTGHIPFTPRAKKVLELSLREALQMNHSYIGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXX-----XXQKMPTLEEYGTNLTKL 930
            A+VL  LGAD + +R  V+++                            L+++G NLT+ 
Sbjct: 121  AQVLIRLGADLNTVRNSVLQLLQGYQGDERQAATSGAPEAGPQQSSATILDQFGRNLTEA 180

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A +G+LDPV+GR+ +IERV  +L RRTKNNP LIGEPGVGK+A  EGLAQ I  GDVPET
Sbjct: 181  ARDGELDPVIGREREIERVMVVLSRRTKNNPVLIGEPGVGKSACVEGLAQAIVRGDVPET 240

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGA 1290
            +  KK+ +LD+G +VAG++YRG+FEER+KK+++EIK   +IILFIDE+HTL+GAGAAEGA
Sbjct: 241  LRDKKIYSLDLGSMVAGSRYRGDFEERMKKVLKEIKNRGDIILFIDEIHTLVGAGAAEGA 300

Query: 1291 ID 1296
            ID
Sbjct: 301  ID 302



>gb:AE017024_380377 Bacillus anthracis str. Ames section 1 of 18 of
            the complete genome.>gb:AE017225_405494 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017264_421316 Bacillus cereus ATCC 10987,
            section 1 of 18 of the complete
            genome.>gb:AE017334_450226 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE017355_461410 Bacillus
            thuringiensis serovar konkukian str. 97-27, complete
            genome.>gb:AE016879_1010082 Bacillus anthracis str. Ames
            complete genome.>gb:AE017194_1059735 Bacillus cereus ATCC
            10987, complete genome.
          Length = 811

 Score =  289 bits (740), Expect = 8e-77
 Identities = 153/297 (51%), Positives = 202/297 (68%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFTE+A KV+ L+QEEA R+GHN +                AAK L ++G++ +  +
Sbjct: 2    MFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGIAAKALIALGLSPEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IGRG+   +  + +TPRAK+V+ELS++EAR+LGH+Y+G+             VA
Sbjct: 62   KEVEALIGRGTE-ASQTVHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                     PTL+    +LT +A E +
Sbjct: 121  ARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANT-PTLDSLARDLTVVARENR 179

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I N +VPET+  K+
Sbjct: 180  LDPVIGRGKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVNNEVPETLRDKR 239

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  IILFIDE+HTLIGAG AEGAID
Sbjct: 240  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDELHTLIGAGGAEGAID 296



>gb:AE016850_348589 Tropheryma whipplei str. Twist, section 1 of 3 of
            the complete genome.>gb:BX251410_764289 Tropheryma
            whipplei TW08/27, complete genome; segment
            1/3.>gb:AE014184_1028785 Tropheryma whipplei str. Twist,
            complete genome.
          Length = 840

 Score =  288 bits (737), Expect = 2e-76
 Identities = 151/299 (50%), Positives = 203/299 (67%), Gaps = 2/299 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT+KA +VI+LAQEEAR L HN++                AA+ L+S+ I L+ AR
Sbjct: 5    MFERFTDKARRVIVLAQEEARTLSHNYIGTEHVLLGLISEGDGIAAQALESLDITLERAR 64

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
              V ++IGRG    +  IPFTPRAK+VLELSL EA QLGHNYIG+             +A
Sbjct: 65   EGVAELIGRGQNATSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGILHEGEGIA 124

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT--LEEYGTNLTKLAEE 939
            A+VL N+GA+   I+ +V+ +                  +   +  L+++G +LT+ A+E
Sbjct: 125  AQVLVNMGAELPAIQQRVMHLLEDGREQEPVSVGPSESGKISGSQILDQFGRHLTRAAKE 184

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ E LAQ I NGDVP  +  
Sbjct: 185  GKLDPVIGREKEIERVMQVLSRRTKNNPILIGEPGVGKTAVVEALAQAIVNGDVPVNLRN 244

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K+V +LD+G L+AG++YRG+FEERLKK+ +EI+   +II+FIDE+H+L+GAG+AEGAID
Sbjct: 245  KQVYSLDLGSLIAGSRYRGDFEERLKKVTKEIRSRGDIIVFIDEIHSLVGAGSAEGAID 303



>gb:AE017322_442682 Listeria monocytogenes str. 4b F2365, section 1 of
            10 of the complete genome.>gb:AE017262_1075038 Listeria
            monocytogenes str. 4b F2365, complete genome.
          Length = 820

 Score =  285 bits (730), Expect = 1e-75
 Identities = 153/297 (51%), Positives = 197/297 (66%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFT++A KV+ L+QEEA RL H+ +                AAK L  +GI+ +  +
Sbjct: 2    MFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGIAAKALYELGISSEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IG G   V   I +TPRAK+V+ELS++EAR+LGH Y+G+             VA
Sbjct: 62   QEVEGLIGHGEKAVTT-IQYTPRAKKVIELSMDEARKLGHTYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                  Q  PTL+    +LT +A E  
Sbjct: 121  ARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNT---QATPTLDSLARDLTVIAREDN 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I   +VPET+ GK+
Sbjct: 178  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVRNEVPETLRGKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 238  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 294



>gb:LMU40604_141661 Listeria monocytogenes ClpC ATPase (mec) gene,
            complete cds.
          Length = 825

 Score =  285 bits (730), Expect = 1e-75
 Identities = 153/297 (51%), Positives = 197/297 (66%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFT++A KV+ L+QEEA RL H+ +                AAK L  +GI+ +  +
Sbjct: 2    MFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGIAAKALYELGISSEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IG G   V   I +TPRAK+V+ELS++EAR+LGH Y+G+             VA
Sbjct: 62   QEVEGLIGHGEKAVTT-IQYTPRAKKVIELSMDEARKLGHTYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                  Q  PTL+    +LT +A E  
Sbjct: 121  ARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNT---QATPTLDSLARDLTVIAREDN 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I   +VPET+ GK+
Sbjct: 178  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVRNEVPETLRGKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 238  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 294



>pir|AI1103|AI1103 endopeptidase Clp ATP-binding chain C [imported] -
            Listeria monocytogenes (strain EGD-e)>gb:AL591974_534724
            Listeria monocytogenes strain EGD, complete genome,
            segment 2/12.
          Length = 820

 Score =  285 bits (730), Expect = 1e-75
 Identities = 153/297 (51%), Positives = 197/297 (66%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFT++A KV+ L+QEEA RL H+ +                AAK L  +GI+ +  +
Sbjct: 2    MFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGIAAKALYELGISSEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IG G   V   I +TPRAK+V+ELS++EAR+LGH Y+G+             VA
Sbjct: 62   QEVEGLIGHGEKAVTT-IQYTPRAKKVIELSMDEARKLGHTYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                  Q  PTL+    +LT +A E  
Sbjct: 121  ARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNT---QATPTLDSLARDLTVIAREDN 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I   +VPET+ GK+
Sbjct: 178  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVRNEVPETLRGKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 238  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 294



>gb:AX065707_1459767 Sequence 51 from Patent WO0100842.
          Length = 327

 Score =  285 bits (729), Expect = 1e-75
 Identities = 160/320 (50%), Positives = 201/320 (62%), Gaps = 28/320 (8%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +VI+LAQEEAR L HN++                AAK L+SMGI+L   R
Sbjct: 1    MFERFTDRARRVIVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKALESMGISLDAVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE+IIG+GS      IPFTPRAK+VLELSL E  Q+GH YIG+             VA
Sbjct: 61   QEVEEIIGQGSQPTTGHIPFTPRAKKVLELSLREGLQMGHKYIGTEFLLLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT---------------- 897
            A+VL  LGAD   +R QVI++                  Q  PT                
Sbjct: 121  AQVLVKLGADLPRVRQQVIQLLSGYEGGQGGSPEGG---QGAPTGGDAVGAGAAPGGRPS 177

Query: 898  ------------LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEP 1041
                        L+++G NLT+ A++GKLDPVVGR  +IER+ Q+L RRTKNNP LIGEP
Sbjct: 178  SGSPGERSTSLVLDQFGRNLTQAAKDGKLDPVVGRDKEIERIMQVLSRRTKNNPVLIGEP 237

Query: 1042 GVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ 1221
            GVGKTA+ EGLA  I NG VPET++ K+V +LD+G LVAG++YRG+FEERLKK+++EI Q
Sbjct: 238  GVGKTAVVEGLALDIVNGKVPETLKDKQVYSLDLGSLVAGSRYRGDFEERLKKVLKEINQ 297

Query: 1222 SDEIILFIDEVHTLIGAGAA 1281
              +IILFIDE+HTL+GAGAA
Sbjct: 298  RGDIILFIDEIHTLVGAGAA 317



>pir|AI1465|AI1465 endopeptidase Clp ATP-binding chain C [imported] -
            Listeria innocua (strain Clip11262)>gb:AL596164_537611
            Listeria innocua Clip11262 complete genome, segment 2/12.
          Length = 820

 Score =  285 bits (729), Expect = 1e-75
 Identities = 153/297 (51%), Positives = 197/297 (66%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RFT++A KV+ L+QEEA RL H+ +                AAK L  +GI+ +  +
Sbjct: 2    MFGRFTQRAQKVLALSQEEAMRLNHSNLGTEHILLGLVREGEGIAAKALYELGISSEKVQ 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE +IG G   V   I +TPRAK+V+ELS++EAR+LGH Y+G+             VA
Sbjct: 62   QEVEGLIGHGEKAVTT-IQYTPRAKKVIELSMDEARKLGHTYVGTEHILLGLIREGEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARVL NLG   +  R QV+++                  Q  PTL+    +LT +A E  
Sbjct: 121  ARVLSNLGISLNKARQQVLQLLGGGDATGAGRQTNT---QATPTLDSLARDLTVIAREEN 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I+RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ+I   +VPET+ GK+
Sbjct: 178  LDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQQIVRNEVPETLRGKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 238  VMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 294



>sp|P49574|CLPC_ODOSI ATP-dependent Clp protease ATP-binding subunit
            clpA homolog.>pir|S78246|S78246 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain clpC [similarity] - Odontella
            sinensis chloroplast>gb:OSCHLPLXX_1692831 Odontella
            sinensis complete chloroplast genome.
          Length = 885

 Score =  284 bits (727), Expect = 2e-75
 Identities = 147/305 (48%), Positives = 193/305 (63%), Gaps = 8/305 (2%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FTE AIKVIML+QEEARR+GHNFV                 A+ LK   + LK AR
Sbjct: 1    MFEKFTEGAIKVIMLSQEEARRMGHNFVGTEQLLLGIIGQRHGIGARALKKQKVTLKKAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             E+E  IGRG+GFVA EIPFTPRAKRVLE+++ E + LG N++G+             VA
Sbjct: 61   REIELYIGRGTGFVASEIPFTPRAKRVLEMAVHEGKDLGQNFVGTEHILLALISESDGVA 120

Query: 766  ARVLENLGADPSNIRTQVI--------RMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNL 921
             R L+ LG +   +R  ++         +                     PTL+EY  N+
Sbjct: 121  MRTLDKLGVNIPKLRNLILMYIEENQEEILRPLTQAEKFLLEREKKGSSTPTLDEYSENI 180

Query: 922  TKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDV 1101
            +K A +GKLDPV+GR  +I  V ++L RR KNNP LIGEPGVGKTA+AEGLAQ I     
Sbjct: 181  SKEAVDGKLDPVIGRDKEIHEVIKVLARRRKNNPVLIGEPGVGKTAVAEGLAQLIIAEKA 240

Query: 1102 PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAA 1281
            P+ ++G  ++ LD+G ++AGTKYRGEFEER+K+++EE++    IIL IDE+HTL+GAGAA
Sbjct: 241  PDFLDGNLLMALDLGSILAGTKYRGEFEERIKRIVEEVQNDSAIILVIDEIHTLVGAGAA 300

Query: 1282 EGAID 1296
            EGA+D
Sbjct: 301  EGAVD 305



>gb:AP006627_562448 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 818

 Score =  282 bits (721), Expect = 1e-74
 Identities = 150/300 (50%), Positives = 197/300 (65%), Gaps = 3/300 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            +F RFTE+A KV+ L+QEEA RL H+ +                AAK L+ +G+  +  +
Sbjct: 2    IFGRFTERAQKVLALSQEEAIRLSHHNIGTEHILLGLIREGEGIAAKALQQLGLGSEKLQ 61

Query: 586  VEVEKIIGRGS-GFVAVEIP--FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
             EVE ++G+G  G  ++     +TPRAK+V+ELS++EAR+LGH+Y+G+            
Sbjct: 62   KEVETLVGKGQEGQKSIHSTPHYTPRAKKVIELSMDEARKLGHSYVGTEHILLGLIREGE 121

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             VAARVL NLG   +  R QV+++                     PTL+    +LT +A 
Sbjct: 122  GVAARVLNNLGVSLNKARQQVLQLLGSNEGGSSSQSNGAATNANTPTLDSLARDLTAIAR 181

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            E  LDPV+GR  +IERV Q+L RRTKNNP LIGEPGVGKTAIAEGLAQ I   +VPET+ 
Sbjct: 182  EETLDPVIGRSREIERVIQVLSRRTKNNPVLIGEPGVGKTAIAEGLAQSIVANEVPETLR 241

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K+V+TLDMG +VAGTKYRGEFE+RLKK+M+EI+Q+  +ILFIDE+HTLIGAG AEGAID
Sbjct: 242  NKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNVILFIDELHTLIGAGGAEGAID 301



>gb:CP000027_79071 Dehalococcoides ethenogenes 195, complete genome.
          Length = 824

 Score =  280 bits (717), Expect = 4e-74
 Identities = 151/296 (51%), Positives = 191/296 (64%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F++F+E+A +V+  AQEEA+ L HN++                AA+VL +M +NL   R 
Sbjct: 5    FDKFSERARRVLTYAQEEAQSLNHNYIGTEHILLGLVREEEGVAARVLVNMDVNLAKVRS 64

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
             VE I+GRG      E   T RAK+V+EL ++EAR LGHNYIG+              AA
Sbjct: 65   AVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLGHNYIGTEHLLLGLLREGEGAAA 124

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKL 948
             VLE+ G     +RT+V R+                   + P L++ G +LT  A  GKL
Sbjct: 125  GVLESFGVTVEKVRTEVGRILNQGLNKPKAGRATPS---RTPQLDQLGFDLTAAARTGKL 181

Query: 949  DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKV 1128
            DPV+GR  +IERV QIL RRTKNNP LIGEPGVGKT+I EGLAQRI +GDVPET+E K +
Sbjct: 182  DPVIGRAKEIERVVQILSRRTKNNPALIGEPGVGKTSIVEGLAQRIVSGDVPETLEQKHI 241

Query: 1129 ITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            I+LD+  LVAGTKYRGEFEERLKK++EEIK +  IILFIDE HT++GAGAAEGA+D
Sbjct: 242  ISLDVASLVAGTKYRGEFEERLKKVIEEIKTAGNIILFIDEFHTMVGAGAAEGAVD 297



>gb:AF497482_516550 Micromonospora echinospora calicheamicin
            biosynthetic locus, complete sequence.
          Length = 797

 Score =  276 bits (707), Expect = 5e-73
 Identities = 143/256 (55%), Positives = 185/256 (72%), Gaps = 3/256 (1%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIG 717
            AAK L+S+GI+L+  R +VE+IIG+G    +  IPFTPRAK+VLELSL EA QLGHNYIG
Sbjct: 7    AAKALESLGISLEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG 66

Query: 718  SXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT 897
            +             VAA+VL  LGAD + +R QVI++                      T
Sbjct: 67   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEPAAAGAAAGEAAPST 126

Query: 898  ---LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
               L+++G NLT+ A EGKLDPV+GR+ +IERV Q+L RRTKNNP LIGEPGVGKTA+ E
Sbjct: 127  SLVLDQFGRNLTQAAREGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVGKTAVVE 186

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFID 1248
            GL+Q+I  G+VPET++ K++ TLD+G LVAG++YRG+FEERLKK+++EI+   +IILFID
Sbjct: 187  GLSQKIIKGEVPETLKDKQLYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGDIILFID 246

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HTL+GAGAAEGAID
Sbjct: 247  EIHTLVGAGAAEGAID 262



 Score = 37.4 bits (85), Expect = 0.68
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +1

Query: 418 FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
           FT +A KV+ L+  EA +LGHN++                AA+VL  +G +L   R +V 
Sbjct: 42  FTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVI 101

Query: 598 KIIGRGSG 621
           +++    G
Sbjct: 102 QLLSGYQG 109



>gb:AE013175_289893 Thermoanaerobacter tengcongensis MB4, section 202
            of 244 of the complete genome.>gb:AE008691_1111958
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 816

 Score =  275 bits (704), Expect = 1e-72
 Identities = 147/298 (49%), Positives = 193/298 (64%)
 Frame = +1

Query: 403  AMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDA 582
            AMF RFTE+A K + LAQEEAR   HN+V                AA+VLK +G+  +  
Sbjct: 2    AMFGRFTERAQKALYLAQEEARSFYHNYVGTEHILLGLLKEDEGIAARVLKKLGVTYEAT 61

Query: 583  RVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            R +V  +IG G+      + +TPRAKRVLELSL EAR+   +Y+G+             V
Sbjct: 62   REKVLSLIGMGN-IPGDVVGYTPRAKRVLELSLSEARRFNTSYVGTEHILLGLLREGEGV 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            A R+L   G D + +R ++++M                     PTL ++G +LT LA +G
Sbjct: 121  AVRILMEQGIDFNRVREEIVKMLSEEPAAGPSKVSKAKNTNT-PTLNQFGRDLTDLARDG 179

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR+ +IERV QIL RRTKNNP LIGEPGVGKTAI EGLAQ+I  G+VPE ++ K
Sbjct: 180  KLDPVIGREKEIERVIQILSRRTKNNPVLIGEPGVGKTAIVEGLAQKIVEGEVPEILKDK 239

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V+TLD+  LVAGTKYRGEFE+RLK ++ E+ ++  +ILF+DE+HTLIGAGAAEGAID
Sbjct: 240  RVVTLDLASLVAGTKYRGEFEDRLKTVINEVIKAGNVILFVDEMHTLIGAGAAEGAID 297



>gb:AE014295_310749 Bifidobacterium longum NCC2705, complete genome.
          Length = 869

 Score =  275 bits (703), Expect = 1e-72
 Identities = 147/306 (48%), Positives = 195/306 (63%), Gaps = 10/306 (3%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFT++A +VI+LAQEEAR L HN++                AAK L S G+ L   R
Sbjct: 1    MFERFTDRARRVIVLAQEEARALQHNYIGTEHLLLGLIREGEGVAAKALASKGVELDATR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             +VE++IG+G+      IPFTP AK+VLE SL EA QLGH+YIG+             V 
Sbjct: 61   KQVEEMIGKGNAAPNGHIPFTPHAKQVLEFSLREALQLGHSYIGTEHILLGLIREGEGVG 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT----------LEEYGT 915
             +VL  +  D   +R+  I M                      T          L+++G 
Sbjct: 121  TQVLIKMDVDLGELRSATIDMIRGNSGTGTGDGKGDLANAGGVTDKQNKSGSAILDQFGR 180

Query: 916  NLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANG 1095
            NLT  A EGKLDPV+GR ++IERV  +L RRTKNNP LIGEPGVGKTA+ EGLAQ+I  G
Sbjct: 181  NLTAEAAEGKLDPVIGRTNEIERVMVVLSRRTKNNPVLIGEPGVGKTAVVEGLAQKIQAG 240

Query: 1096 DVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAG 1275
            DVPET++GK+V +LD+G +VAG++YRG+FEERLKK+++EIK   +I+LFIDE+HT++GAG
Sbjct: 241  DVPETLKGKQVYSLDLGSMVAGSRYRGDFEERLKKVLKEIKTRGDIVLFIDEIHTIVGAG 300

Query: 1276 AAEGAI 1293
            +A+GA+
Sbjct: 301  SADGAL 306



>gb:AE015945_321644 Clostridium tetani E88, section 10 of 10 of the
            complete genome.>gb:AE015927_964433 Clostridium tetani
            E88, complete genome.
          Length = 811

 Score =  273 bits (697), Expect = 7e-72
 Identities = 142/298 (47%), Positives = 189/298 (63%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            +F RF E+A KV++ AQE AR   H +V                +  +LK M + L+D  
Sbjct: 2    IFGRFNERAQKVLVFAQESARNYRHGYVGTEHILLGILKEEGI-SKNILKDMNVELEDVE 60

Query: 586  VEVEKIIGRGS-GFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
              +E+  G+G     + EIP TPR KR+LE+SL EAR L HN+I               +
Sbjct: 61   SLIEEYEGKGDLDLYSNEIPLTPRTKRLLEISLLEARNLNHNFITPEHILLALIKESEGI 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            A  +L NLG D + +R +++                    Q  PTL E+G +LT +A EG
Sbjct: 121  AFTILSNLGVDFNRLRKELLENVAGERSVNRSSSDTNKKNQDTPTLNEFGRDLTDMAMEG 180

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR  + +RV QIL RRTKNNPCLIG+PGVGKTAIAEGLAQ+I  G++PE ++ K
Sbjct: 181  KLDPVIGRDKETQRVLQILCRRTKNNPCLIGDPGVGKTAIAEGLAQKIVEGNIPEILKDK 240

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V+TLD+  ++AG KYRGEFE+RLKK+MEEI++S  +ILFIDE+HT+IGAGAAEGAID
Sbjct: 241  RVVTLDLSSMIAGAKYRGEFEDRLKKVMEEIRKSGNVILFIDEIHTIIGAGAAEGAID 298



>pir|C97292|C97292 ATPases with chaperone activity clpC, two
            ATP-binding domain CAC3189 [imported] - Clostridium
            acetobutylicum>gb:AE007814_230487 Clostridium
            acetobutylicum ATCC 824 section 302 of 356 of the
            complete genome.>gb:AE001437_1093442 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 813

 Score =  272 bits (696), Expect = 1e-71
 Identities = 143/298 (47%), Positives = 188/298 (63%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF RF+++A K+I  AQEEA+   H +V                A  +L +MG+ ++  R
Sbjct: 2    MFGRFSDRAQKMIYYAQEEAQNFKHGYVGTEHILLGILRDENGKAQSLLANMGVTIEKVR 61

Query: 586  VEVEKIIGRG-SGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
              +E+  G G S     E P TPR KR+LE+SL EAR L HNYI               V
Sbjct: 62   RLIEEYEGFGDSDLYKEEPPLTPRTKRLLEISLLEARNLNHNYINPEHVLLALIRESEGV 121

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            A  +L NLG D   +R +++                       PTL +YGT+LT++A EG
Sbjct: 122  AFTILGNLGVDFERLRKEILDSLSGREENTGIKTSFSSNTSVTPTLNQYGTDLTQMALEG 181

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++ +R+ +IL RRTKNNPCLIG+PGVGKTAIAEGLAQ+I  G++PE ++ K
Sbjct: 182  KLDPVIGRDNETQRILEILCRRTKNNPCLIGDPGVGKTAIAEGLAQKIVEGNIPEILKDK 241

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +VITLD+  LVAG+KYRGEFEERLKK+M EIK +  +ILFIDE+HT++GAG AEGAID
Sbjct: 242  RVITLDVSSLVAGSKYRGEFEERLKKVMTEIKAAKNVILFIDEIHTIVGAGGAEGAID 299



>gb:BA000033_710772 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.
          Length = 818

 Score =  272 bits (695), Expect = 1e-71
 Identities = 148/297 (49%), Positives = 192/297 (64%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            +F R TE+A +V+  AQEEA RL H+ +                AAKVL+S  I      
Sbjct: 2    LFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVI 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVEK+IG G   V   + +TPRAK+V+ELS++EAR+L HN++G+             VA
Sbjct: 62   EEVEKLIGHGQDHVGT-LHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARV  NL  + +  R QV++                      PTL+    +LT +A++G 
Sbjct: 121  ARVFANLDLNITKARAQVVK--ALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGT 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ I N +VPET++ K+
Sbjct: 179  LDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG +VAGTKYRGEFEERLKK+MEEI+Q+  +ILFIDE+HTL+GAG AEGAID
Sbjct: 239  VMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAID 295



>pir|F89819|F89819 endopeptidase [imported] - Staphylococcus aureus
            (strain N315)>gb:BA000017_676222 Staphylococcus aureus
            subsp. aureus Mu50 DNA, complete
            genome.>gb:BA000018_678895 Staphylococcus aureus subsp.
            aureus N315 genomic DNA, complete
            genome.>gb:BX571856_779994 Staphylococcus aureus subsp.
            aureus strain MRSA252, complete
            genome.>gb:BX571857_782701 Staphylococcus aureus strain
            MSSA476, complete genome.
          Length = 818

 Score =  272 bits (695), Expect = 1e-71
 Identities = 148/297 (49%), Positives = 192/297 (64%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            +F R TE+A +V+  AQEEA RL H+ +                AAKVL+S  I      
Sbjct: 2    LFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVI 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVEK+IG G   V   + +TPRAK+V+ELS++EAR+L HN++G+             VA
Sbjct: 62   EEVEKLIGHGQDHVGT-LHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARV  NL  + +  R QV++                      PTL+    +LT +A++G 
Sbjct: 121  ARVFANLDLNITKARAQVVK--ALGNPEMSNKNAQASKSNNTPTLDSLARDLTVIAKDGT 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  +I RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ I N +VPET++ K+
Sbjct: 179  LDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG +VAGTKYRGEFEERLKK+MEEI+Q+  +ILFIDE+HTL+GAG AEGAID
Sbjct: 239  VMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAID 295



>gb:BX294144_768783 Pirellula sp. strain 1 complete genome; segment
            12/24.
          Length = 859

 Score =  265 bits (678), Expect = 1e-69
 Identities = 138/314 (43%), Positives = 196/314 (62%), Gaps = 17/314 (5%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M+ERFT++A KV+ LA +EA+R  H ++                AA VLK++ ++L+  R
Sbjct: 1    MYERFTDRARKVMQLANQEAQRFNHEYIGTEHILLGLVKEGSGVAANVLKNLEVDLRKIR 60

Query: 586  VEVEKIIGRGSGFVAV-EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            +EVEK++  G   V V ++P TPRAK+V+E S+EEAR L H+Y+G+             V
Sbjct: 61   LEVEKLVQSGPEMVTVGKLPQTPRAKKVIEYSMEEARNLNHSYVGTEHILLGLLREQEGV 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXX----------------XXXXXXXXXXXXQKMP 894
            AA+VL NLG    ++R +V+ +                                   K P
Sbjct: 121  AAQVLMNLGLKLEDVREEVLNLLGHGLEGAEVGERGGRGGDGEGSSGGSGSSKSGKSKTP 180

Query: 895  TLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGL 1074
             L+ +G +LT+LA++G+LDPV+GR+ +IER  QIL RRTKNNP L+GE GVGKTAI EG 
Sbjct: 181  ALDSFGRDLTELAKKGELDPVIGREREIERAIQILCRRTKNNPVLLGEAGVGKTAIIEGF 240

Query: 1075 AQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEV 1254
            AQR+  G+VPE +  K+++ LD+ ++VAGTKYRG+FEER+K +M E+++    ILFIDE+
Sbjct: 241  AQRVVGGEVPEILAEKRIVVLDLAMMVAGTKYRGQFEERIKAVMTEVRRVKNTILFIDEL 300

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAG AEGAID
Sbjct: 301  HTLVGAGGAEGAID 314



>gb:CP000029_80789 Staphylococcus epidermidis RP62A, complete
            genome.>gb:AE016744_321937 Staphylococcus epidermidis
            ATCC 12228, section 1 of 9 of the complete
            genome.>gb:AE015929_1146606 Staphylococcus epidermidis
            ATCC 12228, complete genome.
          Length = 817

 Score =  265 bits (677), Expect = 2e-69
 Identities = 147/297 (49%), Positives = 189/297 (63%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            +F R TE+A +V+  AQEEA RL H+ +                AAKVL S  I      
Sbjct: 2    LFGRLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLVSFNITEDKVI 61

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVEK+IG G   +   + +TPRAK+V+ELS++EAR+L HN++G+             VA
Sbjct: 62   EEVEKLIGHGQEQMGT-LHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            ARV  NL  + +  R QV++                      PTL+    +LT +A++G 
Sbjct: 121  ARVFANLDLNITKARAQVVK--ALGSPEMSNKNAQANKSNNTPTLDGLARDLTVIAKDGT 178

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPVVGR  +I RV ++L RRTKNNP LIGEPGVGKTAIAEGLAQ I   +VPET++ K+
Sbjct: 179  LDPVVGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVKNEVPETLKDKR 238

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG +VAGTKYRGEFEERLKK+MEEI Q+  +ILFIDE+HTL+GAG AEGAID
Sbjct: 239  VMSLDMGTVVAGTKYRGEFEERLKKVMEEIHQAGNVILFIDELHTLVGAGGAEGAID 295



>gb:BX908798_831067 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 847

 Score =  256 bits (655), Expect = 5e-67
 Identities = 137/320 (42%), Positives = 191/320 (59%), Gaps = 23/320 (7%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF++FT +A +VI LA++EA+RL HN++                A  VL+++ I+ +  R
Sbjct: 1    MFDKFTNRAKQVIKLAKKEAQRLNHNYLGTEHVLLGLLKLGQGVAVNVLRNLNIDFETVR 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVEK++G G        P  T + K+V E + EEA  L HNY+G+             V
Sbjct: 61   SEVEKLVGYGPEIQVYGDPALTGKVKKVFEFANEEAANLNHNYVGTEHLLLGLLRQTDGV 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXX----------------------XXXXXXXXX 876
            AA+VLENL  +   +R +V++                                       
Sbjct: 121  AAQVLENLNVNLKEVRKEVLKELETFNLQLPPISGAGISPSNPSPGSGGKGSYEKVAAGT 180

Query: 877  XXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKT 1056
               KMP L  YG +LT++  EGK+DPV+GR+++IER+  IL RR KNNP L+GE GVGKT
Sbjct: 181  ANDKMPALRAYGHDLTEMCREGKMDPVIGRKEEIERLILILCRRRKNNPVLVGEAGVGKT 240

Query: 1057 AIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEII 1236
            AI EGLAQ I  GDVP+T+  KK+ITLD+ L++AGTKYRG+FEER+K +M+EIK++  ++
Sbjct: 241  AIVEGLAQAIVKGDVPDTLRKKKLITLDLALMIAGTKYRGQFEERIKAVMDEIKKNGNVL 300

Query: 1237 LFIDEVHTLIGAGAAEGAID 1296
            LFIDE+HT++GAGAAEGAID
Sbjct: 301  LFIDELHTIVGAGAAEGAID 320



>pir|T47485|T47485 clpC-like protein - Arabidopsis
            thaliana>gb:ATF9K21_1551403 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F9K21.
          Length = 341

 Score =  253 bits (645), Expect = 8e-66
 Identities = 159/298 (53%), Positives = 175/298 (58%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFERFTEKAIKVI LAQEEARRLG+NF                 AAKVLKSMGINLKDAR
Sbjct: 1    MFERFTEKAIKVITLAQEEARRLGYNFFGTEHILLSLIGEGTGIAAKVLKSMGINLKDAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VEVEKIIGRGSGFV VEIPFTPR                                   +A
Sbjct: 61   VEVEKIIGRGSGFVVVEIPFTPRKA-----------------CAGFVTRGSSTTRHKGIA 103

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
             RVLE LGADPSNIRTQV                       +  + E  T        GK
Sbjct: 104  VRVLEILGADPSNIRTQV-----------NAPILVNSQQALVAEVMETATWQVGNTRRGK 152

Query: 946  LDPVVGRQDQIERVTQILGRRT-KNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            LDPVVGRQ QI+RV QIL RRT +NN CLIG+PGVGK AIAEG+AQRIA+GDVPETI+GK
Sbjct: 153  LDPVVGRQPQIKRVVQILARRTCRNNACLIGKPGVGKRAIAEGIAQRIASGDVPETIKGK 212

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
              +  + G      + RG+ E       E   QSD+IILFIDE+H LIGAGA EGAID
Sbjct: 213  MNVAGNCGWNEIRWRSRGKIE-------EVYGQSDDIILFIDEMHLLIGAGAVEGAID 263



>gb:BA000045_741617 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 778

 Score =  250 bits (639), Expect = 4e-65
 Identities = 138/304 (45%), Positives = 185/304 (60%), Gaps = 7/304 (2%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+F+  A++V+ LA++E+ RLG N V                AA+VL  +G++L  AR
Sbjct: 1    MFEQFSPSALQVLNLAKQESLRLGQNAVGTEQLLLGLLAHSDAVAAQVLTELGLSLAGAR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             EVE I+G+G    +  + FTPRA R++E +L EA   G   +               VA
Sbjct: 61   REVESIVGKGESRPSQRVAFTPRAGRLIEQALIEANGFGQRLVEPEHLLLSMLRDNEGVA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXX------XXXXXQKMPTLEEYGTNLTK 927
            +RVL+  G D    R  ++                          +    LE +G +LT+
Sbjct: 121  SRVLDEFGVDRDKARQMLLESLGDAAKATSASRGNEQPRRSDRASRSGGPLERFGRDLTE 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
            LA  GK+DPVVGR +QIERV QILGRRTKNNP LIGEPGVGKTAIAEGLA RIA GDVPE
Sbjct: 181  LARGGKIDPVVGRAEQIERVIQILGRRTKNNPVLIGEPGVGKTAIAEGLAVRIAEGDVPE 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE-IKQSDEIILFIDEVHTLIGAGAAE 1284
             +  +++++LDMG ++AGT+ RGEFEERLK +M+E I    +I+LFIDE+HTL+GAGA+E
Sbjct: 241  MLFDRRIVSLDMGQVLAGTQMRGEFEERLKGVMQEVIASKGQIVLFIDELHTLVGAGASE 300

Query: 1285 GAID 1296
            G +D
Sbjct: 301  GGMD 304



>pir|H72404|H72404 endopeptidase Clp, ATP-binding chain - Thermotoga
            maritima  (strain MSB8)>gb:AE001705_38118 Thermotoga
            maritima MSB8 section 17 of 136 of the complete
            genome.>gb:AE000512_1112591 Thermotoga maritima MSB8,
            complete genome.
          Length = 820

 Score =  247 bits (631), Expect = 3e-64
 Identities = 130/298 (43%), Positives = 183/298 (61%), Gaps = 1/298 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MF++F+EK  ++ + AQEEA+ LGH++V                A ++L+ MG +    R
Sbjct: 1    MFDKFSEKTAQIFVTAQEEAKELGHSYVGTEHLLLAILKVDRSPAVELLEEMGASYSKVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             E+  ++G G          TPRAKRV EL+ EEA+ LG + I               +A
Sbjct: 61   SEIISMVGMGMRGFVPSPQMTPRAKRVTELAYEEAKILGSDKINPEHLLLGILREGEGIA 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQK-MPTLEEYGTNLTKLAEEG 942
              +L  LG D + +R ++I +                   + +  LE +G NLT+LA + 
Sbjct: 121  IHILRKLGVDIATLRREIIDIYSYSSNKNLEYEEEEDYTYRSVKQLEGFGVNLTELAAKK 180

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            +LDPV+GR+++IERV Q+L RR KNNP LIG+PGVGKTAI EGLAQRI  GDVPE ++ K
Sbjct: 181  ELDPVIGREEEIERVMQVLVRRKKNNPVLIGDPGVGKTAIVEGLAQRIVAGDVPEILKNK 240

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             + +LD+  LVAGTKYRGEFE+R+KKL++ + +   IILFIDE+HT++GAG+AEGAID
Sbjct: 241  VIFSLDVAALVAGTKYRGEFEKRMKKLLQIVTKDKNIILFIDEIHTIVGAGSAEGAID 298



>pir|G72079|G72079 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain
            clpC [similarity] - Chlamydophila pneumoniae (strain
            CWL029)>gb:AE001626_37293 Chlamydia pneumoniae section 42
            of 103 of the complete genome.>gb:AE001363_941850
            Chlamydia pneumoniae, complete
            genome.>gb:AX300405_1465487 Sequence 17 from Patent
            WO0185972.
          Length = 845

 Score =  246 bits (627), Expect = 1e-63
 Identities = 134/319 (42%), Positives = 187/319 (58%), Gaps = 22/319 (6%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FT +A +VI LA++EA+RL HN++                A  VL+++GI+   AR
Sbjct: 1    MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRNLGIDFDTAR 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 61   QEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASLLEHNYVGTEHLLLGILHQSDSV 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXX-------------------- 882
            A +VLENL  DP  +R +++R                                       
Sbjct: 121  ALQVLENLHIDPREVRKEILRELETFNLQLPPSSSSSSSSSRSNPSSSKSPLGHSLGSDK 180

Query: 883  -QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA 1059
             +K+  L+ YG +LT++  E KLDPV+GR  ++ER+  IL RR KNNP LIGE GVGKTA
Sbjct: 181  NEKLSALKAYGYDLTEMVRESKLDPVIGRSSEVERLILILCRRRKNNPVLIGEAGVGKTA 240

Query: 1060 IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL 1239
            I EGLAQ+I   +VP+ +  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   I+L
Sbjct: 241  IVEGLAQKIILNEVPDALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNILL 300

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAGAAEGAID
Sbjct: 301  FIDELHTIVGAGAAEGAID 319



>gb:AF401667_507586 Lactobacillus sakei rrnC operon, partial sequence.
          Length = 709

 Score =  245 bits (626), Expect = 1e-63
 Identities = 130/300 (43%), Positives = 184/300 (61%), Gaps = 7/300 (2%)
 Frame = +1

Query: 418  FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
            FT  A  V+MLAQE+A++  H+ +                A   L+ +G+   D   E+E
Sbjct: 5    FTPSAKNVLMLAQEQAKKFNHHALGTEHLLLALVLESEGIAGNALRELGVTPTDVLEEIE 64

Query: 598  KIIGRGSGFVAVEI----PFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            ++ G G   VA+ +    P++P+AK+VL+L+  E++Q     IG+             +A
Sbjct: 65   RLTGYGDSIVAMGVGGYLPYSPKAKQVLDLARVESQQANSVKIGTAHLLLALLRDDDIIA 124

Query: 766  ARVLENLGADPSNIRTQVIR---MXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
            AR+L NLG   +  R  +++   +                  +  PTL +   +LT++A 
Sbjct: 125  ARILLNLGLSLAKTRQLLLQKMGIDAATAKKRAKASAKKVDQEGTPTLNQLARDLTQMAR 184

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            E ++DPVVGR  +++R+ QIL RR+KNNP LIGEPGVGKTAIAEG AQRI NGDVP  ++
Sbjct: 185  ENQIDPVVGRDSEVKRLVQILARRSKNNPVLIGEPGVGKTAIAEGFAQRIINGDVPSDMQ 244

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K+++ LDMG LVAGTKYRGEFE+RLKK++EEI +  ++ILFIDE+HTLIGAG AEGAID
Sbjct: 245  QKRLMMLDMGSLVAGTKYRGEFEDRLKKIIEEIHEDGQVILFIDELHTLIGAGGAEGAID 304



>gb:AE016995_374418 Chlamydophila caviae GPIC section 2 of 4 of the
            complete genome.>gb:AE015925_994097 Chlamydophila caviae
            GPIC complete genome.
          Length = 846

 Score =  245 bits (625), Expect = 2e-63
 Identities = 132/318 (41%), Positives = 188/318 (59%), Gaps = 21/318 (6%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FT +A +VI LA++EA+RL HN++                A  VL+++G++   A+
Sbjct: 1    MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRNLGVDFDTAK 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 61   QEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEAGVLEHNYVGTEHLLLGILNQADGV 120

Query: 763  AARVLENLGADPSNIRTQVIR--------------------MXXXXXXXXXXXXXXXXXX 882
            A +VLENL  DP  +R ++++                                       
Sbjct: 121  ALQVLENLHIDPREVRKEILKELETFNLQLPPSSSSNPRGSSSSSSKSSSLGHALGGEKS 180

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
             K+  L+ YG +LT++  E KLDPV+GR  ++ER+  IL RR KNNP LIGE GVGKTAI
Sbjct: 181  DKLSALKAYGYDLTEMFRESKLDPVIGRSAEVERLILILCRRRKNNPVLIGEAGVGKTAI 240

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 1242
             EGLAQ+I + +VP+T+  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   I+LF
Sbjct: 241  VEGLAQKIISNEVPDTLRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNILLF 300

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGAAEGAID
Sbjct: 301  IDELHTIVGAGAAEGAID 318



>sp|Q9Z8A6|CLPC_CHLPN Probable ATP-dependent Clp protease ATP-binding
            subunit.>pir|G81590|G81590 ATP-dependent Clp proteinase,
            ATP-binding chain CP0316 [imported] - Chlamydophila
            pneumoniae (strain AR39)>gb:AE002194_43800 Chlamydophila
            pneumoniae AR39, section 27 of 94 of the complete
            genome.>gb:AE017158_393796 Chlamydophila pneumoniae
            TW-183, section 2 of 4 of the complete
            genome.>gb:AE002161_885925 Chlamydophila pneumoniae AR39,
            complete genome.>gb:AE009440_1028058 Chlamydophila
            pneumoniae TW-183, complete genome.
          Length = 845

 Score =  245 bits (625), Expect = 2e-63
 Identities = 134/319 (42%), Positives = 187/319 (58%), Gaps = 22/319 (6%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FT +A +VI LA++EA+RL HN++                A  VL+++GI+   AR
Sbjct: 1    MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRNLGIDFDTAR 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 61   QEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASLLEHNYVGTEHLLLGILHQSDSV 120

Query: 763  AARVLENLGADPSNIRTQVI---------------------RMXXXXXXXXXXXXXXXXX 879
            A +VLENL  DP  +R +++                     R                  
Sbjct: 121  ALQVLENLHIDPREVRKEILKELETFNLQLPPSSSSSSSSSRSNPSSSKSPLGHSLGSDK 180

Query: 880  XQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA 1059
             +K+  L+ YG +LT++  E KLDPV+GR  ++ER+  IL RR KNNP LIGE GVGKTA
Sbjct: 181  NEKLSALKAYGYDLTEMVRESKLDPVIGRSSEVERLILILCRRRKNNPVLIGEAGVGKTA 240

Query: 1060 IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL 1239
            I EGLAQ+I   +VP+ +  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   I+L
Sbjct: 241  IVEGLAQKIILNEVPDALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNILL 300

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAGAAEGAID
Sbjct: 301  FIDELHTIVGAGAAEGAID 319



>sp|O84288|CLPC_CHLTR Probable ATP-dependent Clp protease ATP-binding
            subunit.>pir|C71533|C71533 endopeptidase Clp (EC
            3.4.21.-) ATP-binding chain clpC [similarity] - Chlamydia
            trachomatis (serotype D, strain UW3/Cx)>gb:AE001301_34214
            Chlamydia trachomatis D/UW-3/CX section 28 of 87 of the
            complete genome.>gb:AE001273_1098240 Chlamydia
            trachomatis D/UW-3/CX, complete genome.
          Length = 854

 Score =  244 bits (624), Expect = 2e-63
 Identities = 132/321 (41%), Positives = 190/321 (59%), Gaps = 24/321 (7%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FT +A +VI LA++EA+RL HN++                A  VL+++G++   A+
Sbjct: 1    MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRTLGVDFDTAK 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 61   HEVERLIGYGPEIQVCGDPALTGRVKKSFESANEEAALLEHNYVGTEHLLLGILNQSDGV 120

Query: 763  AARVLENLGADPSNIRTQVIR-----------------------MXXXXXXXXXXXXXXX 873
            A +VLENL  DP  IR ++++                                       
Sbjct: 121  ALQVLENLHVDPKEIRKEILKELETFNLQLPPSSSITPRNTNSSSSSKSSSPLGGHTLGG 180

Query: 874  XXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGK 1053
               +K+  L+ YG +LT++ +E +LDPV+GR  ++ER+  IL RR KNNP L+GE GVGK
Sbjct: 181  DKPEKLSALKAYGYDLTEMFKESRLDPVIGRSAEVERLILILCRRRKNNPVLVGEAGVGK 240

Query: 1054 TAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEI 1233
            TAI EGLAQ+I +G+VPE +  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   I
Sbjct: 241  TAIVEGLAQKIVSGEVPEALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNI 300

Query: 1234 ILFIDEVHTLIGAGAAEGAID 1296
            +LFIDE+HT++GAGAAEGAID
Sbjct: 301  LLFIDELHTIVGAGAAEGAID 321



>sp|Q9PKA8|CLPC_CHLMU Probable ATP-dependent Clp protease ATP-binding
            subunit.>pir|B81689|B81689 ATP-dependent Clp proteinase,
            ATP-binding chain ClpC, TC0559 [imported] - Chlamydia
            muridarum (strain Nigg)>gb:AE002324_45145 Chlamydia
            muridarum Nigg section 55 of 85 of the complete
            genome.>gb:AE002160_1149285 Chlamydia muridarum Nigg,
            complete genome.
          Length = 870

 Score =  244 bits (624), Expect = 2e-63
 Identities = 133/322 (41%), Positives = 190/322 (59%), Gaps = 25/322 (7%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FT +A +VI LA++EA+RL HN++                A  VL+++G++   A+
Sbjct: 17   MFEKFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRTLGVDFDTAK 76

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 77   NEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASILEHNYVGTEHLLLGILNQADGV 136

Query: 763  AARVLENLGADPSNIRTQVIR------------------------MXXXXXXXXXXXXXX 870
            A +VLENL  DP  IR ++++                                       
Sbjct: 137  ALQVLENLHIDPKEIRKEILKELETFNLQLPPSSSITPRNTNSSSSSSSKSSSLGGHSLG 196

Query: 871  XXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVG 1050
                +K+  L+ YG +LT++ +E +LDPV+GR  ++ER+  IL RR KNNP LIGE GVG
Sbjct: 197  GDKPEKLSALKAYGYDLTEMFKEARLDPVIGRSAEVERLILILCRRRKNNPVLIGEAGVG 256

Query: 1051 KTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDE 1230
            KTAI EGLAQ+I +G+VPE +  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   
Sbjct: 257  KTAIVEGLAQKIVSGEVPEALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGN 316

Query: 1231 IILFIDEVHTLIGAGAAEGAID 1296
            I+LFIDE+HT++GAGAAEGAID
Sbjct: 317  ILLFIDELHTIVGAGAAEGAID 338



>gb:AE016957_367210 Enterococcus faecalis V583, section 11 of 11 of
            the complete genome.>gb:AE016830_993698 Enterococcus
            faecalis V583, complete genome.
          Length = 831

 Score =  244 bits (622), Expect = 4e-63
 Identities = 137/305 (44%), Positives = 186/305 (60%), Gaps = 8/305 (2%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M E FTE A  V+ +AQEEA+   H  V                A K L+ +  + +D R
Sbjct: 1    MDELFTESAKAVLAIAQEEAKYFRHQSVGSEHLLLALVLEPNGIAGKTLRQLNTDTEDIR 60

Query: 586  VEVEKIIGRGS-----GFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
             E+E + G G+     G   + +P++PRAK++   + +EA++LG   IG+          
Sbjct: 61   EEIEHLSGYGTMQSPMGNNNLYLPYSPRAKQIFAYAGDEAKRLGAQKIGTEHLLLGLLRD 120

Query: 751  XXXVAARVLENLGADPSNIRTQVIR---MXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNL 921
               +A+R+L NLG   S +R  +++   +                  Q  PTL+    +L
Sbjct: 121  EEILASRILVNLGLSLSKMRQLLLKKMGVSEPNGAQRRRNGQNKNAPQGTPTLDSLARDL 180

Query: 922  TKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDV 1101
            TKLA E  LDPVVGR  ++ R+ QIL RRTKNNP L+GEPGVGKTAIAEGLAQ+I N +V
Sbjct: 181  TKLAREQSLDPVVGRGTEVRRLIQILSRRTKNNPVLVGEPGVGKTAIAEGLAQKIVNREV 240

Query: 1102 PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAA 1281
            PE ++GK+++ LDMG LVAGTKYRGEFE+RLKK+++EI Q  ++ILFIDE+HTLIGAG A
Sbjct: 241  PEDMQGKRLMMLDMGALVAGTKYRGEFEDRLKKVVDEIYQDGQVILFIDELHTLIGAGGA 300

Query: 1282 EGAID 1296
            EGAID
Sbjct: 301  EGAID 305



>pir|C86545|C86545 ClpC proteinase [imported] - Chlamydophila
            pneumoniae  (strain J138)>gb:BA000008_663808
            Chlamydophila pneumoniae J138 genomic DNA, complete
            sequence.
          Length = 845

 Score =  244 bits (622), Expect = 4e-63
 Identities = 134/319 (42%), Positives = 186/319 (58%), Gaps = 22/319 (6%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE FT +A +VI LA++EA+RL HN++                A  VL+++GI+   AR
Sbjct: 1    MFETFTNRAKQVIKLAKKEAQRLNHNYLGTEHILLGLLKLGQGVAVNVLRNLGIDFDTAR 60

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             EVE++IG G        P  T R K+  E + EEA  L HNY+G+             V
Sbjct: 61   QEVERLIGYGPEIQVYGDPALTGRVKKSFESANEEASLLEHNYVGTEHLLLGILHQSDSV 120

Query: 763  AARVLENLGADPSNIRTQVI---------------------RMXXXXXXXXXXXXXXXXX 879
            A +VLENL  DP  +R +++                     R                  
Sbjct: 121  ALQVLENLHIDPREVRKEILKELETFNLQLPPSSSSSSSSSRSNPSSSKSPLGHSLGSDK 180

Query: 880  XQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA 1059
             +K+  L+ YG +LT++  E KLDPV+GR  ++ER+  IL RR KNNP LIGE GVGKTA
Sbjct: 181  NEKLSALKAYGYDLTEMVRESKLDPVIGRSSEVERLILILCRRRKNNPVLIGEAGVGKTA 240

Query: 1060 IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIIL 1239
            I EGLAQ+I   +VP+ +  K++ITLD+ L++AGTKYRG+FEER+K +M+E+++   I+L
Sbjct: 241  IVEGLAQKIILNEVPDALRKKRLITLDLALMIAGTKYRGQFEERIKAVMDEVRKHGNILL 300

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAGAAEGAID
Sbjct: 301  FIDELHTIVGAGAAEGAID 319



>pir|B70412|B70412 endopeptidase Clp (EC 3.4.21.-) ATP-binding chain
            clpC [similarity] - Aquifex aeolicus>gb:AE000733_26677
            Aquifex aeolicus VF5 section 65 of 109 of the complete
            genome.>gb:AE000657_977208 Aquifex aeolicus VF5 complete
            genome.
          Length = 810

 Score =  243 bits (619), Expect = 8e-63
 Identities = 130/297 (43%), Positives = 189/297 (63%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            MFE+FTE+A +VI+ A+EEA  LGH+++                   VL  +G++ +  R
Sbjct: 1    MFEKFTERARQVILRAREEALELGHSYLGSEHILLALIKDEDIPVL-VLSKLGVSPEKIR 59

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
              +   I +GS   + E+ F P AKRV+E ++EEAR L H ++G              + 
Sbjct: 60   KAIMGQITKGSH--SGEVLFAPDAKRVIEFAVEEARILHHQFVGPEHLLIGVVREKTGLG 117

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
             R+L + G D  ++R +V+++                     P L+ +  +LT++A EGK
Sbjct: 118  GRILRSFGLDEYSVRREVLQLLGELPPQESQRYVST------PNLDRFSRDLTQMAREGK 171

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR+ +IERV QIL RR KNNP L+G+PGVGKTAI EGLAQRIAN +VPE +  K+
Sbjct: 172  LDPVIGREKEIERVIQILVRRRKNNPVLLGDPGVGKTAIVEGLAQRIANKEVPEPLLNKR 231

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V+ LD+  LVAGTKYRG+FEERLK +++E+++++ +ILFIDE+HTL+GAG+AEG+ID
Sbjct: 232  VVALDLAALVAGTKYRGQFEERLKNILKELEKANNVILFIDELHTLVGAGSAEGSID 288



>gb:AL935254_550908 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 3/11.
          Length = 837

 Score =  236 bits (602), Expect = 8e-61
 Identities = 134/300 (44%), Positives = 180/300 (60%), Gaps = 7/300 (2%)
 Frame = +1

Query: 418  FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
            FT  A  V++LAQE+A+   H  V                A KVL+   ++  D R E+E
Sbjct: 5    FTPSAKSVLVLAQEQAKYFKHQAVGTEHLLLALAIEKNGIANKVLQQYAVSEDDIREEIE 64

Query: 598  KIIGRGS-GFVAVE--IPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
            +  G G+   V  +  +P++P+AK +L ++ +EA++LG N IG+             +++
Sbjct: 65   RFTGYGTLSNVGKDTYLPYSPKAKEILSVAGDEAKRLGANKIGTEHLLLAMLSDESILSS 124

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKM----PTLEEYGTNLTKLAE 936
            R+L NL  D    R  V+R                    K     PTL+    +LT+LA 
Sbjct: 125  RILMNLNLDLGQTRKVVLRKLGVSDAMSKRKGNAANRGGKKTEGTPTLDSLARDLTQLAS 184

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            E ++DPVVGR  +++RV QIL RRTKNNP LIGEPGVGKTAIAEGLAQ+I  GDVP  + 
Sbjct: 185  EQEMDPVVGRSKEVKRVIQILSRRTKNNPVLIGEPGVGKTAIAEGLAQKIVAGDVPTDMA 244

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             K+++ LDMG LVAGTKYRGEFE+RLKK+++EI     +ILFIDE+HTLIGAG AEGAID
Sbjct: 245  DKRLMMLDMGSLVAGTKYRGEFEDRLKKVIDEIYNDGHVILFIDELHTLIGAGGAEGAID 304



>gb:AE017301_435814 Thermus thermophilus HB27 section 1 of 7 of the
            complete genome.>gb:AP008226_577999 Thermus thermophilus
            HB8 genomic DNA, complete genome.>gb:AE017221_1077792
            Thermus thermophilus HB27 complete genome.
          Length = 736

 Score =  235 bits (600), Expect = 1e-60
 Identities = 134/295 (45%), Positives = 181/295 (61%), Gaps = 1/295 (0%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            R+ ++A  V   A+EE  RLGH+ +                AA++L+  G +L+  R  V
Sbjct: 3    RYDDRARLVFHYAREEGSRLGHSMIGPEHLLLGLMREGGT-AARILQEYGASLEAMRRMV 61

Query: 595  EKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            E+++GRG G    E P  TPRA+RV+EL+  EAR +G   IG+             +A R
Sbjct: 62   EELVGRGEGGRTGEPPAITPRARRVMELASAEARNMGSPVIGTEHILLGIIREGDGIAYR 121

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L +   D   IR +V+ M                     P L+EYG +LTK A EGKLD
Sbjct: 122  ILSHFAKDVDAIRWRVLAMAEGREREKPVNT---------PFLDEYGRDLTKEAREGKLD 172

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GRQ++I RV QIL RRTKNNP LIG+PGVGKTAI EGLAQ I  G VP  ++G +V+
Sbjct: 173  PVIGRQEEINRVIQILARRTKNNPVLIGDPGVGKTAIVEGLAQAIVEGRVPPILKGARVV 232

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
             +D+  +VAGTKYRGEFEERL++++EE+K + ++I FIDE+HTLIGAG AEG +D
Sbjct: 233  AIDLAGVVAGTKYRGEFEERLRQIIEELKNA-KVIAFIDELHTLIGAGGAEGTLD 286



>gb:AE017288_432575 Leptospira interrogans serovar Copenhageni str.
            Fiocruz L1-130, chromosome I, section 2 of 14 of the
            complete sequence.>gb:AE016823_1065586 Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130,
            chromosome I, complete sequence.
          Length = 846

 Score =  231 bits (589), Expect = 2e-59
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 9/302 (2%)
 Frame = +1

Query: 418  FTEKAIKVIM-LAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            FT++A +VI  +AQ+EA+RLG +++                A K+L ++ INL + R EV
Sbjct: 4    FTKRAKRVINEIAQDEAKRLGSDYIGPEHILLGLLKEEDSVAIKILNNLNINLNELRKEV 63

Query: 595  EKIIGRGSGFVAVEIPF-TPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            E+     SG + +++     R ++++ELS EEA++L HNY+G+             +A  
Sbjct: 64   ERRTREASGALLMDVAGGQDRYQKIIELSKEEAKRLKHNYVGTEHILLALLRDNNNIAGG 123

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ-------KMPTLEEYGTNLTKL 930
             L +   + + I+++++R+                          K P L+E+  +LT+L
Sbjct: 124  ALYSFSVNYNVIKSEILRLLGAPPTSSVGVSSTTQSGPQPRQEKTKTPILDEFARDLTQL 183

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A + KLDPVVGR  +I+RV QIL R+TKNNP L+GE GVGKTAI EGLA  I    VP+ 
Sbjct: 184  ARDKKLDPVVGRATEIQRVIQILSRKTKNNPVLVGESGVGKTAIVEGLALAIVEKSVPDL 243

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGA 1290
            +  K+V++LD+  L+AGTKYRGEFEERLKK+M+EI  S  II+FIDE+HTLIGAGAAEGA
Sbjct: 244  LFEKRVLSLDLASLIAGTKYRGEFEERLKKIMKEITSSTNIIIFIDELHTLIGAGAAEGA 303

Query: 1291 ID 1296
            +D
Sbjct: 304  VD 305



>gb:AE011226_270629 Leptospira interrogans serovar lai str. 56601
            chromosome I, section 35 of 397 of the complete
            sequence.>gb:AE010300_1004028 Leptospira interrogans
            serovar lai str. 56601 chromosome I, complete sequence.
          Length = 846

 Score =  231 bits (589), Expect = 2e-59
 Identities = 128/302 (42%), Positives = 185/302 (61%), Gaps = 9/302 (2%)
 Frame = +1

Query: 418  FTEKAIKVIM-LAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            FT++A +VI  +AQ+EA+RLG +++                A K+L ++ INL + R EV
Sbjct: 4    FTKRAKRVINEIAQDEAKRLGSDYIGPEHILLGLLKEEDSVAIKILNNLNINLNELRKEV 63

Query: 595  EKIIGRGSGFVAVEIPF-TPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            E+     SG + +++     R ++++ELS EEA++L HNY+G+             +A  
Sbjct: 64   ERRTREASGALLMDVAGGQDRYQKIIELSKEEAKRLKHNYVGTEHILLALLRDNNNIAGG 123

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ-------KMPTLEEYGTNLTKL 930
             L +   + + I+++++R+                          K P L+E+  +LT+L
Sbjct: 124  ALYSFSVNYNVIKSEILRLLGAPPTSSVGVSSTTQSGPQPRQEKTKTPILDEFARDLTQL 183

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A + KLDPVVGR  +I+RV QIL R+TKNNP L+GE GVGKTAI EGLA  I    VP+ 
Sbjct: 184  ARDKKLDPVVGRATEIQRVIQILSRKTKNNPVLVGESGVGKTAIVEGLALAIVEKSVPDL 243

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGA 1290
            +  K+V++LD+  L+AGTKYRGEFEERLKK+M+EI  S  II+FIDE+HTLIGAGAAEGA
Sbjct: 244  LFEKRVLSLDLASLIAGTKYRGEFEERLKKIMKEITSSTNIIIFIDELHTLIGAGAAEGA 303

Query: 1291 ID 1296
            +D
Sbjct: 304  VD 305



>sp|Q54316|HLYB_TREHY Hemolysin B.>gb:SHTLYBA_183460 S.hyodysenteriae
            gene for tlyB hemolysin.
          Length = 828

 Score =  229 bits (585), Expect = 7e-59
 Identities = 130/304 (42%), Positives = 184/304 (60%), Gaps = 7/304 (2%)
 Frame = +1

Query: 406  MFE-RFTEKAIKVIML-AQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            MF+   T KA KVI L AQEEA+RL H+ V                A +VL  + I+L  
Sbjct: 1    MFQFHLTSKAKKVIELYAQEEAKRLNHDMVTPEHILLGLLYESEALATRVLMRLKIDLDR 60

Query: 580  ARVEVEKIIGRGSGF-VAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
             ++E+E  + + S   V   +P  PR ++++  S EEAR L HNYIG+            
Sbjct: 61   LKLELESAMVKSSTTKVFGTLPTAPRVQKLISRSAEEARALSHNYIGTEHLLLGLLREES 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQ----KMPTLEEYGTNLT 924
              A  VL ++G + + +R ++++M                       K PTL+++  +LT
Sbjct: 121  GTAYNVLTSMGLELTILRQEILKMLGVAGSNISSMEQTSQEDNVKKVKTPTLDQFARDLT 180

Query: 925  KLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVP 1104
            K+A +  LD V+GR++++ RV QIL RR KNNP L+GEPGVGKTAI EGLA++I   DVP
Sbjct: 181  KMARDKALDRVIGRENEVMRVVQILSRRKKNNPILLGEPGVGKTAIVEGLAEKIVAADVP 240

Query: 1105 ETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAE 1284
            + +  K+V+TLD+  +VAGTKYRGEFEER+K ++ EIK++  II+FIDE+HTLIGAG AE
Sbjct: 241  DILLKKRVLTLDLSSVVAGTKYRGEFEERIKNIVLEIKKASNIIIFIDELHTLIGAGGAE 300

Query: 1285 GAID 1296
            GA+D
Sbjct: 301  GALD 304



>pir|D75436|D75436 ATP-dependent Clp proteinase, ATP-binding subunit
            ClpC - Deinococcus radiodurans (strain
            R1)>gb:AE001961_41388 Deinococcus radiodurans R1 section
            98 of 229 of the complete chromosome
            1.>gb:AE000513_882283 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 747

 Score =  223 bits (569), Expect = 5e-57
 Identities = 134/300 (44%), Positives = 178/300 (59%), Gaps = 3/300 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M  RF ++A  V   A+EE  RLGH  V                AA++L   G  L   R
Sbjct: 1    MTNRFDDRARLVFHYAREEGNRLGHAMVGPEHLLLGLMREGGS-AAQILGEFGATLDSLR 59

Query: 586  VEVEKIIGRGSGFVAVEIP-FTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             +VE IIGRG G    + P  TPRA+RV+ELS  EAR LG     +             V
Sbjct: 60   RKVEDIIGRGEGSRLNDAPSITPRARRVMELSGAEARALGSQTTSTQHILLGIIREGDGV 119

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPT--LEEYGTNLTKLAE 936
            A R+L++L  D   IR +++                    + +PT  L+EYG +LTK A 
Sbjct: 120  AFRILQDLTKDVETIRWRIL---------AEDSGEGGKAAKPVPTPFLDEYGRDLTKWAR 170

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            EGKLDPV+GR ++I RVTQIL RRTKNNP LIG+PGVGKTAI EGLA  I     P ++ 
Sbjct: 171  EGKLDPVIGRSEEIRRVTQILTRRTKNNPVLIGDPGVGKTAIVEGLALAIHEQRTPPSLH 230

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            G ++I+LD+  +VAGTKYRGEFEERL++++EE++ + +++ FIDE+HTL+GAG AEG +D
Sbjct: 231  GVRLISLDLSGVVAGTKYRGEFEERLRQIIEELRTA-KVMAFIDELHTLVGAGGAEGTLD 289



>gb:AE017201_403706 Lactobacillus johnsonii NCC 533, section 2 of 7 of
            the complete genome.>gb:AE017198_1122193 Lactobacillus
            johnsonii NCC 533, complete genome.
          Length = 822

 Score =  222 bits (565), Expect = 1e-56
 Identities = 120/303 (39%), Positives = 174/303 (57%), Gaps = 6/303 (1%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M + +++ A  V+ +A+E+A+   H  +                A K+L+   + L   R
Sbjct: 1    MEKSYSDSAKNVLEIAKEQAQNFHHRIIGTEHVLLALVIEANGDAGKLLRERNVTLTLVR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             E+E+  G GS   A  +  +PR   VL  + + A +LG   I +             +A
Sbjct: 61   EEIERYTGYGSSPKATYMEMSPRLSLVLNFAKQRADELGTAQIETKHILLGLLASDQILA 120

Query: 766  ARVLENLGADPSNIRTQVIR--MXXXXXXXXXXXXXXXXXXQK----MPTLEEYGTNLTK 927
            + +L+N+G DP ++   V    M                  +K     P L++   NL K
Sbjct: 121  SLILKNIGVDPRDLSQDVNDSFMDGSGEENNVLGISSATGMKKGKSLTPNLDKVSVNLNK 180

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A EG +DPV+GR  +I+RV QIL RRTKNNP L+GEPGVGKTA+A+G+A  I N +VP+
Sbjct: 181  RAREGAIDPVIGRDKEIKRVIQILSRRTKNNPVLVGEPGVGKTAVAQGIAAAIVNHEVPD 240

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG 1287
            T+  K+V+ LDMG L+AGTKYRGEFE+R+KK+++EI+Q   +ILF+DE+HTLIGAG AEG
Sbjct: 241  TLAKKRVMALDMGSLIAGTKYRGEFEDRMKKILKEIQQDGSVILFVDEMHTLIGAGGAEG 300

Query: 1288 AID 1296
            AID
Sbjct: 301  AID 303



>gb:AF027500_470374 Aquifex pyrophilus alanyl-tRNA synthetase (alaS)
            gene, complete cds; and ATP-dependent Clp protease
            regulatory subunit (clpA) gene, partial cds.
          Length = 631

 Score =  211 bits (538), Expect = 2e-53
 Identities = 105/221 (47%), Positives = 150/221 (67%)
 Frame = +1

Query: 634  EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRT 813
            E+ F P AKRV+E ++EEAR L H ++G              +  R+L + G D  ++R 
Sbjct: 12   EVLFAPDAKRVIEFAVEEARILHHQFVGPEHLLIGVVREKTGLGGRILRSFGLDEYSVRR 71

Query: 814  QVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQ 993
            +V+++                     P L+ +  +LT++A EGKLDPV+ ++ +IERV Q
Sbjct: 72   EVLQLLGELPPQESQRYVST------PNLDRFSRDLTQMAREGKLDPVIRKEREIERVIQ 125

Query: 994  ILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYR 1173
            IL RR KNNP L+G+PGVGKTAI EGLAQRIAN +VPE +  K+V+ LD+  LVAGTKYR
Sbjct: 126  ILVRRRKNNPVLLGDPGVGKTAIVEGLAQRIANREVPEPLLNKRVVALDLAALVAGTKYR 185

Query: 1174 GEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            G+FEERLK +++E+++++ +ILFIDE+HTL+GAG+AEG+ID
Sbjct: 186  GQFEERLKNILKELEKANNVILFIDELHTLVGAGSAEGSID 226



>pir|H72258|H72258 endopeptidase Clp, ATP-binding chain - Thermotoga
            maritima  (strain MSB8)>gb:AE001792_39290 Thermotoga
            maritima MSB8 section 104 of 136 of the complete
            genome.>gb:AE000512_1113763 Thermotoga maritima MSB8,
            complete genome.
          Length = 791

 Score =  211 bits (536), Expect = 3e-53
 Identities = 122/301 (40%), Positives = 171/301 (56%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E +TEKA KV+M  Q+   R   N +                  ++LK + +++   + E
Sbjct: 5    EEYTEKAQKVMMSIQDIMTRYRQNQLSSEHILLAILEEGNNVGVELLKELNVDINRLKDE 64

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            VE  IG+       G    +I  TP A+ V+E + EEAR++G + IG+            
Sbjct: 65   VEVFIGKYGVRVPEGASVSQIFITPDARHVIEKAREEARRMGDSKIGTEHLILGMVLSPD 124

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
              A R+L   G  P  +   + ++                  + +  L  +  +LT+LA 
Sbjct: 125  STAFRILSRYGVTPERVYEAIRKIRSTGKTDEA---------ENVEALARFTVDLTQLAR 175

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            E KL PVV R+ +I RV QIL RRTKNNP LIG+PGVGKTA+ EGLAQRI  G VP  + 
Sbjct: 176  EKKLMPVVDREKEIRRVIQILSRRTKNNPVLIGDPGVGKTAVVEGLAQRIVEGKVPLFLR 235

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEGAI 1293
              +V+ LDMG LVAGT++RG+FEERLK+L++E+K +  E+ILFIDEVHT++GAGAAEGA+
Sbjct: 236  NVRVLKLDMGRLVAGTRFRGDFEERLKRLLDELKRKKGEVILFIDEVHTVVGAGAAEGAL 295

Query: 1294 D 1296
            D
Sbjct: 296  D 296



>gb:CP000033_88591 Lactobacillus acidophilus NCFM, complete genome.
          Length = 825

 Score =  210 bits (534), Expect = 6e-53
 Identities = 116/305 (38%), Positives = 166/305 (54%), Gaps = 8/305 (2%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M   +++   +V+ +A+E+A+   H  +                A K+L+S G+     R
Sbjct: 1    MENSYSKSVNQVLEIAREQAQNFHHRLIGTEHILLALVIETDGEAGKILRSWGLTPTAIR 60

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
             E+E+  G GS   A  +  +PR    L+ +  +A Q G+  I +             ++
Sbjct: 61   EEIERYTGYGSAPKASYMEMSPRLSLALDYAKRQAEQGGYKEIKTNHVLLGITASEQVLS 120

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKM--------PTLEEYGTNL 921
            A +L+NL  D S +R   I                               PTL++   NL
Sbjct: 121  AMILKNLSVDISRLRQDAIDSLEQDQDFNDSANWLGNSDSNQKKRKNSTTPTLDKVAINL 180

Query: 922  TKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDV 1101
             +   EG +DPV+GR  +IERV QIL RRTKNNP L+GEPGVGKTA+AE +A  I    V
Sbjct: 181  NQRTREGNIDPVIGRDKEIERVIQILSRRTKNNPVLVGEPGVGKTAVAEAIATEIVKKRV 240

Query: 1102 PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAA 1281
            PE +  K+V+ L+MG LVAGTKYRGEFE+R+KK+++EI +  ++ILF+DE+HTLIGAG A
Sbjct: 241  PEDLLDKRVMALNMGNLVAGTKYRGEFEDRMKKILDEIAKDGKVILFVDEMHTLIGAGGA 300

Query: 1282 EGAID 1296
            EGAID
Sbjct: 301  EGAID 305



>gb:CP000027_80382 Dehalococcoides ethenogenes 195, complete genome.
          Length = 812

 Score =  208 bits (529), Expect = 2e-52
 Identities = 117/298 (39%), Positives = 176/298 (59%), Gaps = 3/298 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+FTE+A + +  +Q   +   H+                    ++LK + ++ ++   +
Sbjct: 4    EKFTEQAQEALSASQMLVQEYQHSQWDVEHVLLALIRQEKGLVGEILKELKVSSEEITKQ 63

Query: 592  VEKIIGRGSGFVA--VEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +   + R    V   ++I  TPR   +L+ +  EA +L   +IG+              +
Sbjct: 64   LVDSLKRSPKAVGGNIQIYPTPRIINLLQTANNEAERLRDEFIGTEHLLVAIAGDTQGES 123

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
            AR+L+  G D   + + + ++                   K   L +Y  +LT+LA++GK
Sbjct: 124  ARILKQFGIDQEKVYSALQKIRGGHRVTDARAES------KYRALAKYSRDLTELAKQGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            +DPV+GR  +I RV QIL RRTKNNP ++GE GVGKTAIAEG+AQ+IA+ DVPE++  +K
Sbjct: 178  IDPVIGRDQEIRRVMQILSRRTKNNPVIVGEAGVGKTAIAEGVAQKIADNDVPESLRDRK 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFIDEVHTLIGAGAAEGAID 1296
            V+ LDMG LVAG+K+RGEFEERLK +M+E++QS  EIILFIDE+HT++GAGAAEGAID
Sbjct: 238  VMALDMGALVAGSKFRGEFEERLKAVMDEVRQSAGEIILFIDEIHTVVGAGAAEGAID 295



>gb:AE012798_285681 Chlorobium tepidum TLS section 19 of 194 of the
            complete genome.>gb:AE006470_932849 Chlorobium tepidum
            TLS complete genome.
          Length = 854

 Score =  207 bits (527), Expect = 4e-52
 Identities = 116/317 (36%), Positives = 175/317 (55%), Gaps = 24/317 (7%)
 Frame = +1

Query: 418  FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
            F+ +   VI L++EEA RLGH+++                 AK+LK++ ++L   + ++E
Sbjct: 5    FSNRVQDVIRLSREEALRLGHDYIGTEHLLLGLIREGEGIGAKILKNLKVDLFQLKQKIE 64

Query: 598  -----KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
                 K+     G     +P T +A++VL+++  EA+      IG+             +
Sbjct: 65   ENTHPKVPATQMG----NVPLTKQAEKVLKITYLEAKICKSTIIGTEHLLLSILKGDDNI 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXX-------------------XXXXXXXXXXXQ 885
            AA++LE  G     +R +++ +                                      
Sbjct: 121  AAQILEQFGVTYDQVRDELMTITTGRSEAYEPPMEGSYSSGSGSPARPSKKSETKRGERT 180

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K P L+ +G ++T+LA E KLDP++GR+ +IERV Q+L RR KNNP LIGEPGVGKTAIA
Sbjct: 181  KTPVLDNFGRDITRLAMEDKLDPIIGREKEIERVAQVLSRRKKNNPVLIGEPGVGKTAIA 240

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFI 1245
            EGLA +I    V   +  K+V+ LD+  LVAGTKYRG+FEER+K LM E+++S ++ILFI
Sbjct: 241  EGLALKIVQRKVSRVLYDKRVVALDLAALVAGTKYRGQFEERMKALMNELERSRDVILFI 300

Query: 1246 DEVHTLIGAGAAEGAID 1296
            DE+HT+IGAG A G++D
Sbjct: 301  DELHTIIGAGGASGSLD 317



>gb:BA000016_675481 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 814

 Score =  206 bits (524), Expect = 8e-52
 Identities = 117/299 (39%), Positives = 172/299 (57%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            + F E +  VI   +E +  L H ++                 +K+L+   +  +     
Sbjct: 4    DNFNENSKIVINKGKESSLMLKHGYMGTEHLLIGLINENGQ-CSKILEESNVTEEKVLSF 62

Query: 592  VEKIIGRGS-GFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
            ++  +G G   +   E+PFTPR K++L+ S+E A++ GH+                 VA 
Sbjct: 63   IKLYVGIGEVNYSLDEVPFTPRCKKILDRSVEIAKEYGHSISRPEHILLALIKEREGVAN 122

Query: 769  RVLENL-GADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQK--MPTLEEYGTNLTKLAEE 939
             +L  +   D  NI  ++  +                  ++   PTL  YG NL + A++
Sbjct: 123  LILTKIVKNDIKNISDKLNNILGRIPSKESKSLKEKEKPKRKDTPTLNLYGINLIERADK 182

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
             KLDPV+GR+D+ +R+ +IL RR KNNPCLIGEPGVGKTA+ EGLAQRI  G+VP+ I+ 
Sbjct: 183  NKLDPVIGRKDETQRLLEILCRRMKNNPCLIGEPGVGKTAVVEGLAQRILLGEVPDIIKD 242

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K++ TLD+  ++AG KYRGEFEERLKK++ E+K SD+IILFIDE+H ++GAG AEGAID
Sbjct: 243  KRIFTLDVTSMLAGAKYRGEFEERLKKVLNEVKDSDDIILFIDEMHNIVGAGGAEGAID 301



>gb:CR522870_100755 Desulfotalea psychrophila LSv54 chromosome.
          Length = 868

 Score =  202 bits (515), Expect = 9e-51
 Identities = 120/306 (39%), Positives = 171/306 (55%), Gaps = 11/306 (3%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGIN------- 570
            ++FT K+ + +  AQ++AR++GH  +                   VLK MG+        
Sbjct: 4    DKFTLKSQEAVQAAQQQARQMGHQEIHLSHLVLAILQQTDSIIIPVLKKMGVQPHMLEVA 63

Query: 571  LKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
            L++A   + K+ G G+G V         A + L    + A  +      S          
Sbjct: 64   LQEALAAIPKVSGSGAGQVY--------ASQALTTLFDSASDIA----SSMQDDFVSMEH 111

Query: 751  XXXVAARVLENLGADPSNIRTQVIR---MXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNL 921
                A RV ++  AD    R QV     +                  +K   L++Y  NL
Sbjct: 112  IFLAALRVKKDAVADVFK-RNQVSEKQFLQALMDIRGNQRVTDQSPEEKFQALQKYADNL 170

Query: 922  TKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDV 1101
            T  A++GK+DPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI + D+
Sbjct: 171  TDRAKQGKIDPVIGRDEEIRRVIQVLSRRTKNNPILIGEPGVGKTAIVEGLAQRIVDDDI 230

Query: 1102 PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGA 1278
            P T++ K+V+TLDMG L+AG KYRGEFE+RLK +++E+ KQ+  IILFIDE+HT++GAGA
Sbjct: 231  PTTLKNKQVVTLDMGALIAGAKYRGEFEDRLKAVLKEVEKQAGNIILFIDELHTIVGAGA 290

Query: 1279 AEGAID 1296
            +EG++D
Sbjct: 291  SEGSMD 296



>gb:AE017180_398961 Geobacter sulfurreducens PCA, complete genome.
          Length = 865

 Score =  200 bits (509), Expect = 5e-50
 Identities = 118/299 (39%), Positives = 169/299 (56%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMG---INLKDA 582
            E+ T K  + +  AQ+ A R G+  +                 A +++ +G     L+ A
Sbjct: 5    EKMTIKTQEALAGAQQLAARQGNGSIEPEHLLVSLLEQEGGLIAPIIQKVGGAPAALRSA 64

Query: 583  RVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
               + K + + SG  A +   +P   R+L+ +  EA  +   ++ +              
Sbjct: 65   ADVLVKRLPQVSGATA-QAYLSPALNRILDAAQREADTMKDEFVSTEHLLLGFFADRQCA 123

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            AAR L + G    N+   ++ +                       L +Y  +LT LA +G
Sbjct: 124  AARALLDAGVSRDNVLAALMEIRGGERVTDQNPEDTYQA------LAKYARDLTDLARQG 177

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR D+I RV Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI +GDVPET++ K
Sbjct: 178  KLDPVIGRDDEIRRVLQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVSGDVPETLKDK 237

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            +++ LDMG L+AG KYRGEFEERLK ++ E+ +S+ ++ILFIDE+HTL+GAGAAEGA+D
Sbjct: 238  RLVALDMGALIAGAKYRGEFEERLKAVIREVAKSEGKVILFIDELHTLVGAGAAEGAMD 296



>gb:AP004777_1844915 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0458B05.
          Length = 938

 Score =  200 bits (508), Expect = 6e-50
 Identities = 120/324 (37%), Positives = 177/324 (54%), Gaps = 32/324 (9%)
 Frame = +1

Query: 400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            +A+FERFTE+A+K ++L+Q EA+ LG   V                +A    S GIN++ 
Sbjct: 71   RAVFERFTERAVKAVVLSQREAKGLGEGAV--APRHLLLGLIAEDRSAGGFLSSGINIER 128

Query: 580  ARVEVEKIIGR----------GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXX 729
            AR E   I  R          GSG + ++IPF+   KRV E+++E +R +G ++I     
Sbjct: 129  AREECRGIGARDLTPGAPSPSGSG-LEMDIPFSGSCKRVFEVAVEFSRNMGCSFISPEHL 187

Query: 730  XXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXX----------------------XX 843
                          +L +LGADPS + +  +                             
Sbjct: 188  ALALFTLDDPTTNSLLRSLGADPSQLASVALTRLQAELAKDCREPAGASSFKVPKKSPAG 247

Query: 844  XXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNP 1023
                         ++   L+++  +LT  A  G +DP++GR+++IERV QI+ RRTKNNP
Sbjct: 248  AGRSAFSKSLNSKKEKGALDQFCLDLTTQASGGFIDPIIGREEEIERVVQIICRRTKNNP 307

Query: 1024 CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 1203
             L+GE GVGKTAIAEGLA RIANGDVP  +  K++++LD+GLL+AG K RGE E R+  L
Sbjct: 308  ILLGEAGVGKTAIAEGLALRIANGDVPIYLVAKRIMSLDVGLLIAGAKERGELESRVTSL 367

Query: 1204 MEEIKQSDEIILFIDEVHTLIGAG 1275
            + E++++ ++ILFIDEVH LIG+G
Sbjct: 368  IREVREAGDVILFIDEVHNLIGSG 391



>gb:AY166599_1586181 Oryza sativa (indica cultivar-group)
            ATP-dependent Clp protease ATP-binding subunit precursor
            (CLPD1) mRNA, complete cds; nuclear gene for chloroplast
            product.
          Length = 938

 Score =  200 bits (508), Expect = 6e-50
 Identities = 120/324 (37%), Positives = 177/324 (54%), Gaps = 32/324 (9%)
 Frame = +1

Query: 400  KAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKD 579
            +A+FERFTE+A+K ++L+Q EA+ LG   V                +A    S GIN++ 
Sbjct: 71   RAVFERFTERAVKAVVLSQREAKGLGEGAV--APRHLLLGLIAEDRSAGGFLSSGINIER 128

Query: 580  ARVEVEKIIGR----------GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXX 729
            AR E   I  R          GSG + ++IPF+   KRV E+++E +R +G ++I     
Sbjct: 129  AREECRGIGARDLTPGAPSPSGSG-LEMDIPFSGSCKRVFEVAVEFSRNMGCSFISPEHL 187

Query: 730  XXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXX----------------------XX 843
                          +L +LGADPS + +  +                             
Sbjct: 188  ALALFTLDDPTTNSLLRSLGADPSQLASVALTRLQAELAKDGREPAGASSFKVPKKSPAG 247

Query: 844  XXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNP 1023
                         ++   L+++  +LT  A  G +DP++GR+++IERV QI+ RRTKNNP
Sbjct: 248  AGRSAFSKSLNSKKEKGALDQFCLDLTTQASGGFIDPIIGREEEIERVVQIICRRTKNNP 307

Query: 1024 CLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKL 1203
             L+GE GVGKTAIAEGLA RIANGDVP  +  K++++LD+GLL+AG K RGE E R+  L
Sbjct: 308  ILLGEAGVGKTAIAEGLALRIANGDVPIYLVAKRIMSLDVGLLIAGAKERGELESRVTSL 367

Query: 1204 MEEIKQSDEIILFIDEVHTLIGAG 1275
            + E++++ ++ILFIDEVH LIG+G
Sbjct: 368  IREVREAGDVILFIDEVHNLIGSG 391



>gb:AE014295_312149 Bifidobacterium longum NCC2705, complete genome.
          Length = 889

 Score =  200 bits (508), Expect = 6e-50
 Identities = 107/221 (48%), Positives = 143/221 (64%), Gaps = 5/221 (2%)
 Frame = +1

Query: 649  PRAKRVLELSLEEA----RQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQ 816
            P+A R L  ++ +A    +Q+G  Y+ +              +A +LE  G   +++R  
Sbjct: 81   PQASRQLTAAIAQAEKEMQQMGDEYVSTEHLLIGIAASKPNQSAEILEKNGVTAASLRKA 140

Query: 817  VIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQI 996
            V  +                       LE+Y T+LT  A+EGKLDPV+GR  +I RV QI
Sbjct: 141  VPGVRGGAKVTSPDAEGSYKA------LEKYSTDLTAAAKEGKLDPVIGRDQEIRRVIQI 194

Query: 997  LGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRG 1176
            L RRTKNNP LIGEPGVGKTA+ EGLAQRI  GDVP T++GKK+I+LD+G +VAG+KYRG
Sbjct: 195  LSRRTKNNPVLIGEPGVGKTAVVEGLAQRIVAGDVPTTLQGKKLISLDLGSMVAGSKYRG 254

Query: 1177 EFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            EFEERLK ++ EIK +D +II FIDE+HT++GAGAAEG++D
Sbjct: 255  EFEERLKSVLNEIKNADGQIITFIDEIHTIVGAGAAEGSMD 295



>gb:SME591791_186626 Sinorhizobium meliloti 1021 complete chromosome;
            segment 10/12.
          Length = 868

 Score =  198 bits (504), Expect = 2e-49
 Identities = 118/303 (38%), Positives = 169/303 (55%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV- 588
            E+++E+    +  AQ  A   GH                   AA +++  G N ++A+V 
Sbjct: 4    EKYSERVRGFLQSAQTYALAEGHQQFTPEHVLKVLLDDDQGMAASLIERAGGNAREAKVG 63

Query: 589  ------EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
                  ++ K+ G G+G V +  P      +V   + + A++ G +++            
Sbjct: 64   TAAALAKLPKVTG-GNGSVYLSQPLA----KVFTAAEDAAKKAGDSFVTVERLLLALAIE 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
                 A +L   G  P+ +  QVI                    Q   +L++Y  +LT  
Sbjct: 119  SSAATASILSKAGVTPTKLN-QVIN-----EIRKGRTADSANAEQGFDSLKKYARDLTAE 172

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A EGKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI NGDVPE+
Sbjct: 173  AREGKLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPES 232

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEG 1287
            ++ K+++ LDMG L+AG K+RGEFEERLK ++ E++ +  EIILFIDE+HTL+GAG A+G
Sbjct: 233  LKDKRLMALDMGALIAGAKFRGEFEERLKAVLNEVRSEGGEIILFIDEMHTLVGAGKADG 292

Query: 1288 AID 1296
            A+D
Sbjct: 293  AMD 295



>pir|S76431|S76431 endopeptidase Clp ATP-binding chain B2 -
            Synechocystis sp.  (strain PCC 6803)>gb:BA000022_689341
            Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 898

 Score =  198 bits (503), Expect = 2e-49
 Identities = 115/293 (39%), Positives = 165/293 (56%), Gaps = 1/293 (0%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FTE+A   I+ +QE ARR  +  +                AA++ +   ++ +  R ++
Sbjct: 8    KFTEQAWDAIVKSQEVARRYKNTNLEVEHILLALLEQDMGLAARIFQRAAVDGEGLRQQL 67

Query: 595  EKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARV 774
            E    R      VE  +  R+  V+    + AR    +   S             V  + 
Sbjct: 68   EIFTNRQPKQAYVEQLYLGRSLDVMLDRADAARSSWEDKFISVEHLLVGFAEDDRVGRKT 127

Query: 775  LENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDP 954
            L     DP ++   +                     +K   L++YG +LT+ A +GKLDP
Sbjct: 128  LRAFNLDPQDLELAI------KAIRGSQKVTEPNQEEKYEALDKYGRDLTEQARQGKLDP 181

Query: 955  VVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVIT 1134
            V+GR ++I RV Q+L RR+KNNP LIGEPGVGKTAIAEGLAQRI NGDVPE+++ +++I+
Sbjct: 182  VIGRDEEIRRVIQVLSRRSKNNPVLIGEPGVGKTAIAEGLAQRIINGDVPESLKNRQLIS 241

Query: 1135 LDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGA 1290
            LDMG L+AG KYRGEFEERL+ +M+E+  SD +IILFIDEVHT++GAG  EG+
Sbjct: 242  LDMGSLIAGAKYRGEFEERLRSVMKEVTNSDGQIILFIDEVHTVVGAGGREGS 294



>gb:ECOPROT_129864 Escherichia coli ATP-dependent protease binding
            subunit gene, complete cds; 16S ribosomal RNA (rrnG)
            gene, partial sequence; and unknown gene.
          Length = 857

 Score =  197 bits (502), Expect = 3e-49
 Identities = 119/293 (40%), Positives = 168/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L    A++ G N+I S             VA  +L+
Sbjct: 72   PQVEGTGG---DVQPSQDLVRVLNLCDNVAQKRGDNFISSELFVLAALESRGTVAD-ILK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  AAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:BA000040_729664 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 879

 Score =  197 bits (501), Expect = 4e-49
 Identities = 116/303 (38%), Positives = 163/303 (53%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLK----- 576
            E++TE++   I  AQ  A R GH                   AA ++   G N +     
Sbjct: 4    EKYTERSRGFIQSAQSLAVREGHQQFSTLHVLKVLLDDNEGLAAGLIDRAGGNSRAILKA 63

Query: 577  --DARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
              DA  +V K+ G G+G    +I   P   R  + + +   + G +++            
Sbjct: 64   TEDALNKVPKVSGGGAG----QIYLAPELARTFDAAEKAGEKAGDSFVTVERLLLGLTLE 119

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
                A  +L   G  P N+   +  +                       L++Y  +LT+ 
Sbjct: 120  KTSEAGTILSKGGVTPQNLNAAIEALRKGRTADSATAENAYDA------LKKYARDLTQA 173

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A +GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI NGDVPE+
Sbjct: 174  ARDGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPES 233

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEG 1287
            ++ KK+++LD+G L+AG KYRGEFEERLK +++E+  S+   ILFIDE+HTLIGAG  +G
Sbjct: 234  LKDKKLLSLDLGALIAGAKYRGEFEERLKAVLQEVTGSEGTFILFIDEMHTLIGAGKGDG 293

Query: 1288 AID 1296
            A+D
Sbjct: 294  AMD 296



>gb:BA000045_743652 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 872

 Score =  196 bits (499), Expect = 7e-49
 Identities = 117/299 (39%), Positives = 166/299 (55%), Gaps = 5/299 (1%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FTEKA   I+   E A+      +                A  +    G+NL      V
Sbjct: 8    QFTEKAWDAIVRTTEVAKEYRQQQLESEHLFKALLDQDGGLAGSIFTKAGVNLTKLGERV 67

Query: 595  EKIIGRGSGFVAVEIPFTPRAKRVLELSLEEA----RQLGHNYIGSXXXXXXXXXXXXXV 762
            E+ I R           +    R L+  L+ A    ++ G ++I S              
Sbjct: 68   EQFINRQPKLT--NPGQSVYLGRSLDALLDRAEGFRKEYGDDFI-SIEHLVLAFAKDVRF 124

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
              ++L     D + ++  V ++                      +L++YG +LT+LA EG
Sbjct: 125  GQQILREFSLDEAKLKAVVAQVRGNQKVTSQNPESTYE------SLDKYGRDLTQLAREG 178

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  QIL RRTKNNP LIGEPGVGKTAIAEGLAQRI +GDVPE+++G+
Sbjct: 179  KLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIAEGLAQRIVSGDVPESLQGR 238

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            K+I LDMG L+AG+KYRGEFEERLK ++ E+ +S+ +I+LFIDE+HT++GAGA +GA+D
Sbjct: 239  KLIALDMGALIAGSKYRGEFEERLKAVLNEVTKSEGQIVLFIDEIHTVVGAGATQGAMD 297



>gb:AE016987_372422 Shigella flexneri 2a str. 2457T section 10 of 16
            of the complete genome.>gb:AE014073_997172 Shigella
            flexneri 2a str. 2457T complete genome.
          Length = 857

 Score =  196 bits (499), Expect = 7e-49
 Identities = 118/293 (40%), Positives = 169/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +A  +L+
Sbjct: 72   PQVEGTGG---DVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLAD-ILK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  ATGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:ECCLPB_125208 E.coli ClpB gene for an analogue of ATP-dependent
            protease regulatory subunit.
          Length = 594

 Score =  196 bits (499), Expect = 7e-49
 Identities = 118/293 (40%), Positives = 169/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +A  +L+
Sbjct: 72   PQVEGTGG---DVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLAD-ILK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  AAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:AE005674_72237 Shigella flexneri 2a str. 301, complete genome.
          Length = 857

 Score =  196 bits (499), Expect = 7e-49
 Identities = 118/293 (40%), Positives = 169/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +A  +L+
Sbjct: 72   PQVEGTGG---DVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLAD-ILK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  ATGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>pir|E85905|E85905 heat shock protein [imported] - Escherichia coli
            (strain O157:H7, substrain EDL933)>gb:AE005174_67704
            Escherichia coli O157:H7 EDL933, complete
            genome.>gb:AE016764_327107 Escherichia coli CFT073
            section 10 of 18 of the complete
            genome.>gb:AE014075_957691 Escherichia coli CFT073
            complete genome.
          Length = 861

 Score =  196 bits (499), Expect = 7e-49
 Identities = 118/293 (40%), Positives = 169/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 16   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 75

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +A  +L+
Sbjct: 76   PQVEGTGG---DVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLAD-ILK 131

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 132  AAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 185

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 186  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 245

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 246  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 298



>sp|P03815|CLPB_ECOLI ClpB protein (Heat shock protein
            F84.1).>pir|C65037|D35905 endopeptidase Clp (EC 3.4.21.-)
            ATP-binding chain clpB [validated] - Escherichia coli
            (strain K-12)>pir|G91060|G91060 heat shock protein
            [imported] - Escherichia coli (strain O157:H7, substrain
            RIMD 0509952)>gb:D90887_123915 E.coli genomic DNA, Kohara
            clone #437(58.6-59.0 min.).>gb:U00096_201627 Escherichia
            coli K-12 MG1655 complete genome.>gb:BA000007_661467
            Escherichia coli O157:H7 DNA, complete genome.
          Length = 857

 Score =  196 bits (499), Expect = 7e-49
 Identities = 118/293 (40%), Positives = 169/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                 + +L S GIN    R ++ + + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +A  +L+
Sbjct: 72   PQVEGTGG---DVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLAD-ILK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
              GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  AAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTIDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:PVI488200_162104 Uncultured bacterium gene for putative clp
            protease, clone 11.
          Length = 949

 Score =  196 bits (497), Expect = 1e-48
 Identities = 105/253 (41%), Positives = 149/253 (58%), Gaps = 3/253 (1%)
 Frame = +1

Query: 547  VLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXX 726
            +L    I + D + ++E    RG      EI  +PR K  L  +   + +LGH+Y+G   
Sbjct: 153  ILGQFKIKVDDLKRQIESEAKRGDKPFEGEIGVSPRVKDALSRAFVASNELGHSYVGPEH 212

Query: 727  XXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEE 906
                       +AA +L   G  P  +R QV ++                     P L++
Sbjct: 213  FLIGLAEEGEGLAANLLRRYGLTPQALRQQVSKVVGKGAEDGRAETPTNT-----PELDK 267

Query: 907  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI 1086
            Y  +LTK+A EGKLDPV+GR  +IE   ++L RR KNNP LIGEPGVGKTAI EGLAQR+
Sbjct: 268  YSRDLTKMAREGKLDPVIGRAQEIETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRM 327

Query: 1087 ANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTL 1263
              G+VPET+  K+++ L++  +VAG KYRGEFEER++K+++E+ +   E+ILFIDEVHT+
Sbjct: 328  VAGEVPETLRDKRLVELNINAMVAGAKYRGEFEERVQKVLKEVTEHQGELILFIDEVHTI 387

Query: 1264 IGA--GAAEGAID 1296
            +GA  G  EG +D
Sbjct: 388  VGAGQGGGEGGLD 400



>gb:BA000035_717394 Corynebacterium efficiens YS-314 DNA, complete
            genome.
          Length = 852

 Score =  195 bits (496), Expect = 1e-48
 Identities = 121/297 (40%), Positives = 165/297 (55%), Gaps = 5/297 (1%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K  + +  A ++A   G+  +                AA VL + G++ K    E +K
Sbjct: 7    TTKTSEAMQAALQQASANGNPDIRPAHLLVAILDQADGVAAPVLTAAGVDPKTILAEAQK 66

Query: 601  IIG---RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            ++    + SG       F   A   L  S E A +LG  Y+ S              AA 
Sbjct: 67   LVDGYPKASGSNLANPNFNRDALNALTASQELAGELGDEYV-STEVLLAGIARGKSDAAD 125

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L+  GA    I+                         +   LE+Y T+LTKLA EGK+D
Sbjct: 126  LLKGKGATYDAIKA------AFQSVRGSQKVTSQDPEGQFQALEKYSTDLTKLAREGKID 179

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA+RI  GDVPE+++GK +I
Sbjct: 180  PVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLARRIVAGDVPESLKGKTLI 239

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAA-EGAID 1296
            +LD+G +VAG KYRGEFEERLK +++EIK ++ EI+ FIDE+HT++GAGA+ E A+D
Sbjct: 240  SLDLGSMVAGAKYRGEFEERLKAVLDEIKGANGEIVTFIDELHTIVGAGASGESAMD 296



>gb:BA000030_705128 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 879

 Score =  195 bits (496), Expect = 1e-48
 Identities = 117/301 (38%), Positives = 162/301 (53%), Gaps = 7/301 (2%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            R T+K+ + +  AQ  A R+GH  V                  ++L+  G   K+ R  V
Sbjct: 5    RLTQKSQEALQEAQTAAGRMGHTEVDGEHLLLALLDQEDGLIPRLLQQAGTEPKELRAAV 64

Query: 595  EKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
             + +       G G    ++  T R  R+L+ +  EA++L   Y+               
Sbjct: 65   REELSHRPKATGPGAAPGQVFVTQRLARLLDAAEREAKRLKDEYVSVEHLLLALAEESSS 124

Query: 760  VAARVL-ENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             AA +L +  G    +  + + ++                       LE+YG +L   A 
Sbjct: 125  TAAGLLLKQAGITRDSFLSALTQVRGNQRVTSANPEVAYEA------LEKYGRDLVLEAR 178

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
             G+LDPV+GR  +I RVTQIL R+TKNNP LIG+PGVGKTAI EGLAQRI  GDVPE + 
Sbjct: 179  SGRLDPVIGRDAEIRRVTQILSRKTKNNPVLIGDPGVGKTAIVEGLAQRIVRGDVPEGLR 238

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
             K V  LDMG LVAG KYRGEFEERLK ++ E+K ++  I+LF+DE+HT++GAGAAEGA+
Sbjct: 239  DKTVFALDMGSLVAGAKYRGEFEERLKAVLSEVKAAEGRILLFVDELHTVVGAGAAEGAM 298

Query: 1294 D 1296
            D
Sbjct: 299  D 299



>gb:AX065723_1459775 Sequence 67 from Patent WO0100842.
          Length = 572

 Score =  195 bits (495), Expect = 2e-48
 Identities = 119/297 (40%), Positives = 166/297 (55%), Gaps = 5/297 (1%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K  + +  A ++A   G+  +                AA VL + G++ K+   E +K
Sbjct: 7    TTKTNEAMQAALQQASSAGNPDIRPAHLLAAILEQTDGVAAPVLMATGVDPKEILAEAKK 66

Query: 601  IIG---RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            ++    + SG       F   A      + E A +LG  Y+ S              AA 
Sbjct: 67   LVASYPKASGANMANPNFNRDALNAFTAAQELAGELGDEYV-STEVLLAGIARGKSDAAD 125

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L N GA    I+     +                   +   LE+Y T+LTKLA EGK+D
Sbjct: 126  LLTNKGATYDAIKEAFPSVRGSQRVTTQDPEG------QFQALEKYSTDLTKLAREGKID 179

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA+RI  GDVPE+++GK +I
Sbjct: 180  PVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLARRIVAGDVPESLKGKTLI 239

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAA-EGAID 1296
            +LD+G +VAG KYRGEFEERLK +++EIK ++ E++ FIDE+HT++GAGA+ E A+D
Sbjct: 240  SLDLGSMVAGAKYRGEFEERLKAVLDEIKGANGEVVTFIDELHTIVGAGASGESAMD 296



>gb:AX065721_1459774 Sequence 65 from Patent WO0100842.
          Length = 584

 Score =  195 bits (495), Expect = 2e-48
 Identities = 119/297 (40%), Positives = 166/297 (55%), Gaps = 5/297 (1%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K  + +  A ++A   G+  +                AA VL + G++ K+   E +K
Sbjct: 7    TTKTNEAMQAALQQASSAGNPDIRPAHLLAAILEQTDGVAAPVLMATGVDPKEILAEAKK 66

Query: 601  IIG---RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            ++    + SG       F   A      + E A +LG  Y+ S              AA 
Sbjct: 67   LVASYPKASGANMANPNFNRDALNAFTAAQELAGELGDEYV-STEVLLAGIARGKSDAAD 125

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L N GA    I+     +                   +   LE+Y T+LTKLA EGK+D
Sbjct: 126  LLTNKGATYDAIKEAFPSVRGSQRVTTQDPEG------QFQALEKYSTDLTKLAREGKID 179

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA+RI  GDVPE+++GK +I
Sbjct: 180  PVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLARRIVAGDVPESLKGKTLI 239

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAA-EGAID 1296
            +LD+G +VAG KYRGEFEERLK +++EIK ++ E++ FIDE+HT++GAGA+ E A+D
Sbjct: 240  SLDLGSMVAGAKYRGEFEERLKAVLDEIKGANGEVVTFIDELHTIVGAGASGESAMD 296



>gb:BX572607_804046 Rhodopseudomonas palustris CGA009 complete genome;
            segment 15/16.
          Length = 879

 Score =  195 bits (495), Expect = 2e-48
 Identities = 113/299 (37%), Positives = 160/299 (53%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E++TE+    I  AQ  A R GH                   A  ++   G N +     
Sbjct: 4    EKYTERVRGFIQSAQSLAMREGHQQFSPLHILKVLLDDSEGLAGGLIDRAGGNSRAILKA 63

Query: 592  VEKIIGRG---SGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             E+ +G+    SG  A ++   P   R  + + + A + G +++                
Sbjct: 64   TEEALGKMPKVSGSGAGQVYLAPATARAFDAAEKAAEKAGDSFVTVERLLLALSLDKDSE 123

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            A ++L   G  P N+   +  +                       L++Y  +LT+ A +G
Sbjct: 124  AGQLLTKGGVTPQNLNAAINALRKGRTADSATAENAYDA------LKKYARDLTQAARDG 177

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA RI NGDVPE+++ K
Sbjct: 178  KLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLALRILNGDVPESLKDK 237

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            K++ LDMG L+AG KYRGEFEERLK ++ E+  ++  IILFIDE+HTL+GAG A+GA+D
Sbjct: 238  KLLALDMGALIAGAKYRGEFEERLKAVLNEVTAAEGGIILFIDEMHTLVGAGKADGAMD 296



>gb:CP000026_77274 Salmonella enterica subsp. enterica serovar
            Paratypi A str. ATCC 9150.
          Length = 857

 Score =  195 bits (495), Expect = 2e-48
 Identities = 117/293 (39%), Positives = 168/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                   +L S GIN    R  +++ + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSIRPLLTSAGINAGQLRTAIDQALSRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +   +L+
Sbjct: 72   PQVEGTGG---DVQPSSELVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLTD-LLK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
            + GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  SAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTVDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>pir|AI0831|AI0831 ClpB protein (heat shock protein f84.1) [imported]
            - Salmonella enterica subsp. enterica serovar Typhi
            (strain CT18)>gb:AE008821_244322 Salmonella typhimurium
            LT2, section 125 of 220 of the complete
            genome.>gb:AE016842_346643 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 9 of 16 of the
            complete genome.>gb:AL627276_542969 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 12/20.>gb:AE014613_983975 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.>gb:AE006468_1001404 Salmonella typhimurium LT2,
            complete genome.
          Length = 857

 Score =  195 bits (495), Expect = 2e-48
 Identities = 117/293 (39%), Positives = 168/293 (57%), Gaps = 8/293 (2%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGR- 612
            + LA  ++  LGH+  F+                   +L S GIN    R  +++ + R 
Sbjct: 12   LALADAQSLALGHDNQFIEPLHLMSALLNQEGGSIRPLLTSAGINAGQLRTAIDQALSRL 71

Query: 613  ----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLE 780
                G+G    ++  +    RVL L  + A++ G N+I S             +   +L+
Sbjct: 72   PQVEGTGG---DVQPSSELVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLTD-LLK 127

Query: 781  NLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVV 960
            + GA  +NI   + +M                   +   L++Y  +LT+ AE+GKLDPV+
Sbjct: 128  SAGATTANITQAIEQMRGGESVNDQGAE------DQRQALKKYTVDLTERAEQGKLDPVI 181

Query: 961  GRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLD 1140
            GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++G++V+ LD
Sbjct: 182  GRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALD 241

Query: 1141 MGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            MG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 242  MGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>sp|P53532|CLPB_CORGL ClpB protein.>gb:BA000036_720507 Corynebacterium
            glutamicum ATCC 13032 DNA, complete
            genome.>gb:BX927156_834311 Corynebacterium glutamicum
            ATCC 13032, IS fingerprint type 4-5, complete genome;
            segment 9/10.>gb:CGU43536_846225 Corynebacterium
            glutamicum heat shock, ATP-binding protein (clpB) gene,
            complete cds.
          Length = 852

 Score =  195 bits (495), Expect = 2e-48
 Identities = 119/297 (40%), Positives = 166/297 (55%), Gaps = 5/297 (1%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K  + +  A ++A   G+  +                AA VL + G++ K+   E +K
Sbjct: 7    TTKTNEAMQAALQQASSAGNPDIRPAHLLAAILEQTDGVAAPVLMATGVDPKEILAEAKK 66

Query: 601  IIG---RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            ++    + SG       F   A      + E A +LG  Y+ S              AA 
Sbjct: 67   LVASYPKASGANMANPNFNRDALNAFTAAQELAGELGDEYV-STEVLLAGIARGKSDAAD 125

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L N GA    I+     +                   +   LE+Y T+LTKLA EGK+D
Sbjct: 126  LLTNKGATYDAIKEAFPSVRGSQRVTTQDPEG------QFQALEKYSTDLTKLAREGKID 179

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA+RI  GDVPE+++GK +I
Sbjct: 180  PVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLARRIVAGDVPESLKGKTLI 239

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAA-EGAID 1296
            +LD+G +VAG KYRGEFEERLK +++EIK ++ E++ FIDE+HT++GAGA+ E A+D
Sbjct: 240  SLDLGSMVAGAKYRGEFEERLKAVLDEIKGANGEVVTFIDELHTIVGAGASGESAMD 296



>pir|A83589|A83589 probable ClpA/B proteinase ATP binding subunit
            PA0459 [imported] - Pseudomonas aeruginosa (strain
            PAO1)>gb:AE004483_54694 Pseudomonas aeruginosa PAO1,
            section 44 of 529 of the complete
            genome.>gb:AE004091_968794 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 850

 Score =  194 bits (494), Expect = 3e-48
 Identities = 109/300 (36%), Positives = 165/300 (55%), Gaps = 5/300 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR-- 585
            E F+++  + +  A + A   G   V                A  VLK  G++  D +  
Sbjct: 5    EYFSKQTTEYLQRAAQVAAEFGKREVDTEHLLYALADADVVQA--VLKQFGLSPADLKQY 62

Query: 586  VEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +E   + G   G  + ++  +PR K  L+ +   +R+LGH+Y+G               A
Sbjct: 63   IEANAVRGASKGEASEDMTISPRVKSALQHAFALSRELGHSYVGPEHLLLGLAAVPDSFA 122

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
              +L+  G     +R + +++                     P L+++  +LT+LA EGK
Sbjct: 123  GTLLKKYGLTEQALRQKAVKVVGKGAEDGRVDGPSNT-----PQLDKFSRDLTRLAREGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR  ++E   ++L RR KNNP LIGEPGVGKTAI EGLAQR+  G+VPE +  K+
Sbjct: 178  LDPVIGRSKEVETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRMVQGEVPEVLRDKR 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFIDEVHTLIGA--GAAEGAID 1296
            ++ L++  +VAG KYRGEFEERLK++M+E++ +  EIILFIDEVHT++GA  G  EG +D
Sbjct: 238  LVELNINAMVAGAKYRGEFEERLKQVMDELQAAQSEIILFIDEVHTIVGAGQGGGEGGLD 297



>gb:AP008226_578944 Thermus thermophilus HB8 genomic DNA, complete
            genome.
          Length = 854

 Score =  192 bits (488), Expect = 1e-47
 Identities = 93/134 (69%), Positives = 115/134 (85%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+YG +LT+LA EGKLDPV+GR ++I RV QIL RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 153  LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLA 212

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE ++GK++++L MG L+AG KYRGEFEERLK +++E+ QS  E+ILFIDE+
Sbjct: 213  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDEL 272

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 273  HTVVGAGKAEGAVD 286



>gb:AE017304_436757 Thermus thermophilus HB27 section 4 of 7 of the
            complete genome.>gb:AE017221_1078735 Thermus thermophilus
            HB27 complete genome.
          Length = 854

 Score =  192 bits (488), Expect = 1e-47
 Identities = 93/134 (69%), Positives = 115/134 (85%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+YG +LT+LA EGKLDPV+GR ++I RV QIL RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 153  LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLA 212

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE ++GK++++L MG L+AG KYRGEFEERLK +++E+ QS  E+ILFIDE+
Sbjct: 213  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDEL 272

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 273  HTVVGAGKAEGAVD 286



>gb:TTDNAKOPN_198426 T.thermophilus DnaK operon.
          Length = 508

 Score =  192 bits (488), Expect = 1e-47
 Identities = 93/134 (69%), Positives = 115/134 (85%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+YG +LT+LA EGKLDPV+GR ++I RV QIL RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 153  LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLA 212

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE ++GK++++L MG L+AG KYRGEFEERLK +++E+ QS  E+ILFIDE+
Sbjct: 213  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDEL 272

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 273  HTVVGAGKAEGAVD 286



>sp|Q9RA63|CLPB_THETH ClpB protein.>gb:AB012390_2043 Thermus
            thermophilus genes for DnaK, GrpE, DnaJ, DafA, ClpB,
            complete cds.>gb:AB032368_5105 Thermus thermophilus clpB,
            dafA, dnaJ, grpE, dnaK, ftsH genes, complete cds.
          Length = 854

 Score =  192 bits (488), Expect = 1e-47
 Identities = 93/134 (69%), Positives = 115/134 (85%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+YG +LT+LA EGKLDPV+GR ++I RV QIL RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 153  LEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGLA 212

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE ++GK++++L MG L+AG KYRGEFEERLK +++E+ QS  E+ILFIDE+
Sbjct: 213  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDEL 272

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 273  HTVVGAGKAEGAVD 286



>gb:AE017175_397368 Porphyromonas gingivalis W83 section 4 of 8 of the
            complete genome.>gb:AE015924_1032979 Porphyromonas
            gingivalis W83 complete genome.
          Length = 863

 Score =  191 bits (486), Expect = 2e-47
 Identities = 113/294 (38%), Positives = 159/294 (54%), Gaps = 1/294 (0%)
 Frame = +1

Query: 418  FTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVE 597
            +T K+ + +  A E  RR G   +                   +   MG+N       V+
Sbjct: 6    YTIKSQEALQQAVELTRRHGQQAIEPQHLLKAVMDQGESLTDFLFAKMGLNKGSIATAVD 65

Query: 598  KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVL 777
            K+I +       E   +    +VL+ + + A ++   Y+ S              A+ +L
Sbjct: 66   KLIEKLPHVSGGEPYLSHETNQVLQAAEDAAHRMKDKYV-SLEHIVLAILTTRCEASTLL 124

Query: 778  ENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPV 957
            ++ GA      T+ +                    ++   LE+Y  NL + A +GKLDPV
Sbjct: 125  KDAGA------TEQLLQSAIEELRKGRNVTSQSAEEQYNALEKYAVNLCQRARDGKLDPV 178

Query: 958  VGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITL 1137
            +GR D+I RV QIL RRTKNNP LIGEPGVGKTAIAEGLA RI  GDVPE +  K++ +L
Sbjct: 179  IGRDDEIRRVLQILSRRTKNNPILIGEPGVGKTAIAEGLAYRIVRGDVPENLRNKQIFSL 238

Query: 1138 DMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            DMG L+AG KY+GEFEERLK ++ E+  ++ EIILFIDE+HTL+GAG +EGA+D
Sbjct: 239  DMGALIAGAKYKGEFEERLKAVVNEVTGAEGEIILFIDEIHTLVGAGKSEGAMD 292



>gb:AE016776_330064 Pseudomonas putida KT2440 section 3 of 21 of the
            complete genome.>gb:AE015451_945141 Pseudomonas putida
            KT2440 complete genome.
          Length = 854

 Score =  191 bits (486), Expect = 2e-47
 Identities = 92/134 (68%), Positives = 113/134 (84%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LTK AEEGKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 161  LDKYTVDLTKRAEEGKLDPVIGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIAEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI NG+VP+ ++GK+++ LDMG L+AG KYRGEFEERLK L+ E+ KQ  +IILFIDE+
Sbjct: 221  QRIINGEVPDGLKGKRLLALDMGALIAGAKYRGEFEERLKSLLNELSKQEGQIILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EGA+D
Sbjct: 281  HTMVGAGKGEGAMD 294



>sp|P74361|CLPB_SYNY3 ClpB protein.>pir|S76197|S76197 endopeptidase
            Clp ATP-binding chain B1 - Synechocystis sp.  (strain PCC
            6803)>gb:BA000022_689235 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 872

 Score =  191 bits (486), Expect = 2e-47
 Identities = 92/138 (66%), Positives = 116/138 (84%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K  +LE+YG +LT+LA EGKLDPV+GR +++ R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 159  KYESLEKYGRDLTELAREGKLDPVIGRDEEVRRTIQILSRRTKNNPVLIGEPGVGKTAIA 218

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI N DVPE++  +K+I+LDMG L+AG KYRGEFEERLK +++E+  S  +IILF
Sbjct: 219  EGLAQRIINHDVPESLRDRKLISLDMGALIAGAKYRGEFEERLKAVLKEVTDSQGQIILF 278

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 279  IDEIHTVVGAGATQGAMD 296



>gb:AE008692_241162 Zymomonas mobilis subsp. mobilis ZM4, complete
            genome.
          Length = 864

 Score =  191 bits (484), Expect = 4e-47
 Identities = 114/301 (37%), Positives = 161/301 (53%), Gaps = 5/301 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMG----INLK 576
            FE+ T++A   I  AQ  A RL H  +                A+ +++  G    I ++
Sbjct: 3    FEKLTDRAKGFIQSAQTVAIRLNHQRIAPEHLLKALLEDDQGMASGLIRRAGGDPMIAVR 62

Query: 577  DARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            D    + KI                   R+L+ + + A + G +Y+              
Sbjct: 63   DTDAALAKIPSVSGSGANTPPGLDNDTVRLLDQAEQIATKAGDSYVTVERLLLAMTLMPE 122

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
                ++L++ G     + T +  +                   +   L+++  +LT  A 
Sbjct: 123  TQVGKILKDSGLKAEALNTAINELRSGRTADTATAE------DRYDALKKFARDLTAAAR 176

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            EGKLDPV+GR ++I R  QIL RRTKNNP LIGEPGVGKTAI EGLA RI NGDVPE + 
Sbjct: 177  EGKLDPVIGRDEEIRRTIQILARRTKNNPVLIGEPGVGKTAIVEGLALRIVNGDVPEGLR 236

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
             + ++ LDMG L+AG KYRGEFEERLK +++E+KQSD +IILFIDE+HTLIGAG ++GA+
Sbjct: 237  DRVLMGLDMGSLIAGAKYRGEFEERLKGVLDEVKQSDGQIILFIDEMHTLIGAGKSDGAM 296

Query: 1294 D 1296
            D
Sbjct: 297  D 297



>gb:BX572096_797791 Prochlorococcus marinus MIT9313 complete genome;
            segment 2/7.
          Length = 865

 Score =  190 bits (483), Expect = 5e-47
 Identities = 112/298 (37%), Positives = 165/298 (55%), Gaps = 3/298 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++FTEK    I+LAQ+ A++  H  +                A ++L+  G+++ + +  
Sbjct: 6    DQFTEKGWAAIVLAQQLAQQRKHQQL-ETEHLLLSLLQQNALAGRILEKAGVSIGNLQTA 64

Query: 592  VEKIIGRGSGFVAV--EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVA 765
            VE  +       A    +        +L+ + +  +  G ++I S               
Sbjct: 65   VEAHLQEQPTMQAAPDSVYLGKGVNDLLDQAEKHKQAFGDSFI-SIEHLLLALAGDNRCG 123

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
             ++L   G D   ++  +  +                      +LE+YG +L+  A EGK
Sbjct: 124  RKLLNQAGVDAGKLKVAIDAVRGNQKVTDQNPEGT------YESLEKYGRDLSAAAREGK 177

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLAQRI NGDVP  ++ ++
Sbjct: 178  LDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPAALQNRQ 237

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            +ITLDMG L+AG KYRGEFEERLK +++E+  S+ +I+LFIDE+HT++GAGA  GA+D
Sbjct: 238  LITLDMGALIAGAKYRGEFEERLKAVLKEVTASEGQIVLFIDEIHTVVGAGATGGAMD 295



>gb:AF061279_474776 Plectonema boryanum heat shock protein (clpB)
            gene, complete cds.
          Length = 883

 Score =  190 bits (483), Expect = 5e-47
 Identities = 92/138 (66%), Positives = 115/138 (83%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K  +LE+YG +LT+ A EGKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 170  KYESLEKYGRDLTQYAREGKLDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIA 229

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILF 1242
            EGLAQRI +GDVP++++ +K+I LDMG L+AG KYRGEFEERLK +++E+  S   IILF
Sbjct: 230  EGLAQRILSGDVPQSLKDRKLIALDMGALIAGAKYRGEFEERLKAVLKEVTDSRGNIILF 289

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 290  IDEIHTVVGAGATQGAMD 307



>gb:AY303998_607429 Meiothermus ruber ClpB-like protein (clpB) gene,
            complete cds.
          Length = 854

 Score =  190 bits (482), Expect = 6e-47
 Identities = 92/134 (68%), Positives = 114/134 (85%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+YG +LT+ AEEGKLDPV+GR ++I RV QIL RRTKNNP LIGEPGVGKTA+ EGLA
Sbjct: 153  LEQYGLDLTRQAEEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAVVEGLA 212

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFIDEV 1254
            QRI  GDVPE ++GK++++L MG L+AG KYRGEFEERLK +++E  QS  +IILFIDE+
Sbjct: 213  QRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQETVQSAGQIILFIDEI 272

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 273  HTVVGAGKAEGAVD 286



>gb:AE016858_350282 Pseudomonas syringae pv. tomato str. DC3000
            section 3 of 21 of the complete
            genome.>gb:AE016853_1035457 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 854

 Score =  190 bits (482), Expect = 6e-47
 Identities = 91/134 (67%), Positives = 113/134 (84%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LTK AEEGKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 161  LDKYTVDLTKRAEEGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIAEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI NG+VP+ + GK++++LDMG L+AG KYRGEFEERLK L+ E+ KQ  +IILFIDE+
Sbjct: 221  QRIINGEVPDGLRGKRLLSLDMGALIAGAKYRGEFEERLKSLLNELSKQEGQIILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 281  HTMVGAGKGEGSMD 294



>gb:BX321864_774731 Nitrosomonas europaea ATCC 19718, complete genome;
            segment 9/10.
          Length = 863

 Score =  189 bits (481), Expect = 8e-47
 Identities = 116/300 (38%), Positives = 165/300 (55%), Gaps = 4/300 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGIN---LKD 579
            F++FT K  + +  AQ  A    H ++                   +L+  G+N   L+ 
Sbjct: 3    FDKFTTKFQQALADAQSMALGQDHPYIEPQHLLLALMQQDDGSITSLLQRAGVNAQPLRQ 62

Query: 580  ARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            A  +  K++ +  G    EI  +     +L L+ +EA++ G  YI S             
Sbjct: 63   ALTQSLKLLPKVEG-TGGEINVSRDLANLLNLTDKEAQKRGDQYIASEMFLLAALEDKGE 121

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
               R+L+  GA  + +   V  +                       L++Y  +LT+ A  
Sbjct: 122  TG-RLLKQYGATRAALEQAVDSVRGGEKVTDAEAEGSREA------LKKYTLDLTERARS 174

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPET++ 
Sbjct: 175  GKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPETLKN 234

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            K+V++LDM  L+AG KYRGEFEERLK +++E+ Q +   I+FIDE+HT++GAG AEGA+D
Sbjct: 235  KRVLSLDMAALLAGAKYRGEFEERLKAVLKELAQDEGRTIVFIDELHTMVGAGKAEGAMD 294



>gb:AF263561_493594 Secondary endosymbiont of Glycaspis brimblecombei
            23S rRNA pseudouridine synthase (rluD) gene, partial cds;
            hypothetical protein YfiH (yfiH) and ClpB protease (clpB)
            genes, complete cds; 16S ribosomal RNA gene, complete
            sequence; intergenic spacer, complete sequence; tRNA-Glu
            gene, complete sequence; and 23S ribosomal RNA gene,
            partial sequence.
          Length = 857

 Score =  189 bits (481), Expect = 8e-47
 Identities = 114/298 (38%), Positives = 165/298 (55%), Gaps = 3/298 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            +R T K  + +  AQ  A    + F+                   +L S+G+N+     +
Sbjct: 4    DRLTNKFQQALADAQSLAIGQDNQFIEPVHLLIALLDQEGGTLRPLLTSIGVNISQLSNK 63

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEE--ARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +  I+              P    +  L+L +  A+Q G  +I S             +A
Sbjct: 64   LNYILNTLPQVHGTAGDIQPSNDLIRHLNLCDKLAQQRGDTFISSELFLLAIFDAKTSLA 123

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
               L+ +GA+ +NI   + +M                  ++   L++Y  +LT+ AE+GK
Sbjct: 124  D-TLKTMGANKANIEKAIEQMRGGDNVNDQGAE------EQRQALKKYTIDLTERAEQGK 176

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++ K+
Sbjct: 177  LDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLKNKR 236

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG L+AG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG AEGA+D
Sbjct: 237  VLSLDMGALLAGAKYRGEFEERLKDVLNDLAKQEGSVILFIDELHTMVGAGKAEGAMD 294



>gb:AE017354_460115 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 858

 Score =  189 bits (481), Expect = 8e-47
 Identities = 114/301 (37%), Positives = 167/301 (55%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++ T K    +  AQ  A    + F+                   +L   G+N+   R  
Sbjct: 4    DKLTSKFQMALADAQSLALGRDNGFIEPEHLMKALLDQQGGSCRPLLSKAGVNIPLLRTL 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +++ + +     G+G    +I  +    R+L L+ + ++Q   N+I S            
Sbjct: 64   IDQALDKLPKVSGTGG---DIHISNALNRLLNLTDKLSQQRKDNFISSELFILAAINEDS 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +A ++L+  G D   I   +  +                  ++   LE+Y  +LT+ AE
Sbjct: 121  NLA-KILKQAGGDNKAIEKAIDELRGGETVNDPNAE------EQRQALEKYTLDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  QGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+++ LDMG L+AG KYRGEFEERLK ++ ++ KQ  +IILFIDE+HT++GAG AEGA+
Sbjct: 234  NKRLLALDMGALIAGAKYRGEFEERLKGVLNDLAKQEGQIILFIDELHTMVGAGKAEGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>gb:CR628337_114917 Legionella pneumophila str. Lens complete genome.
          Length = 858

 Score =  189 bits (481), Expect = 8e-47
 Identities = 114/301 (37%), Positives = 167/301 (55%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++ T K    +  AQ  A    + F+                   +L   G+N+   R  
Sbjct: 4    DKLTSKFQMALADAQSLALGRDNGFIEPEHLMKALLDQQGGSCRPLLSKAGVNIPLLRTL 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +++ + +     G+G    +I  +    R+L L+ + ++Q   N+I S            
Sbjct: 64   IDQALDKLPKVSGTGG---DIHISNALNRLLNLTDKLSQQRKDNFISSELFILAAINEDS 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +A ++L+  G D   I   +  +                  ++   LE+Y  +LT+ AE
Sbjct: 121  NLA-KILKQAGGDNKAIEKAIDELRGGETVNDPNAE------EQRQALEKYTLDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  QGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+++ LDMG L+AG KYRGEFEERLK ++ ++ KQ  +IILFIDE+HT++GAG AEGA+
Sbjct: 234  NKRLLALDMGALIAGAKYRGEFEERLKGVLNDLAKQEGQIILFIDELHTMVGAGKAEGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>gb:CR628336_111830 Legionella pneumophila str. Paris complete genome.
          Length = 858

 Score =  189 bits (481), Expect = 8e-47
 Identities = 114/301 (37%), Positives = 167/301 (55%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++ T K    +  AQ  A    + F+                   +L   G+N+   R  
Sbjct: 4    DKLTSKFQMALADAQSLALGRDNGFIEPEHLMKALLDQQGGSCRPLLSKAGVNIPLLRTL 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +++ + +     G+G    +I  +    R+L L+ + ++Q   N+I S            
Sbjct: 64   IDQALDKLPKVSGTGG---DIHISNALNRLLNLTDKLSQQRKDNFISSELFVLAAINEDS 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +A ++L+  G D   I   +  +                  ++   LE+Y  +LT+ AE
Sbjct: 121  NLA-KILKQAGGDNKAIEKAIDELRGGETVNDPNAE------EQRQALEKYTLDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  QGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+++ LDMG L+AG KYRGEFEERLK ++ ++ KQ  +IILFIDE+HT++GAG AEGA+
Sbjct: 234  NKRLLALDMGALIAGAKYRGEFEERLKGVLNDLAKQEGQIILFIDELHTMVGAGKAEGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>pir|A81707|A81707 ATP-dependent Clp proteinase, chain B TC0389
            [imported] - Chlamydia muridarum (strain
            Nigg)>gb:AE002306_44977 Chlamydia muridarum Nigg section
            37 of 85 of the complete genome.>gb:AE002160_1149117
            Chlamydia muridarum Nigg, complete genome.
          Length = 867

 Score =  189 bits (481), Expect = 8e-47
 Identities = 116/299 (38%), Positives = 164/299 (54%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+F++   + +  A E A+   H++V                   V+K +  NL      
Sbjct: 2    EKFSDAVSEALEKAFELAKDAKHSYVTENHLLKSLLQNPGSLFCLVIKDVHGNLGLLTSA 61

Query: 592  VEKIIGRGSGFV---AVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            V+  + R    V   A+  P +P  +++L  + EEAR +G  Y+                
Sbjct: 62   VDDALHREPTVVEGAAIPKP-SPSLQQLLLNAQEEARSMGDEYLSGDHLLLAFWKTTKEP 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
             A   + +   P  ++  +I++                  + +  LE+Y  NLT LA EG
Sbjct: 121  FASWRKTVKTSPEALKELIIKLRQGSRMDSPSAE------ENLKGLEKYCKNLTILAREG 174

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI  GDVPE+++ K
Sbjct: 175  KLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLALRIVQGDVPESLKDK 234

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             +  LDMG L+AG KYRGEFEERLK +++ ++ S+   ILFIDEVHTL+GAGA +GA+D
Sbjct: 235  HLYVLDMGALIAGAKYRGEFEERLKSVLKGVEASEGACILFIDEVHTLVGAGATDGAMD 293



>gb:AE012973_287736 Chlorobium tepidum TLS section 194 of 194 of the
            complete genome.>gb:AE006470_934904 Chlorobium tepidum
            TLS complete genome.
          Length = 442

 Score =  189 bits (480), Expect = 1e-46
 Identities = 102/213 (47%), Positives = 137/213 (64%), Gaps = 1/213 (0%)
 Frame = +1

Query: 661  RVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXX 840
            +V + +L+EA QL   YI S             V+ ++L++ G D + I      +    
Sbjct: 92   KVFDTALKEAEQLKDEYISSEHLFIAMSEAGVKVS-KLLKDAGIDRNAI------LKVLT 144

Query: 841  XXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNN 1020
                          +   +L++Y  NL  L  +GKLDPV+GR D+I RV QIL RRTKNN
Sbjct: 145  SFRGSQRVTSQNAEESYQSLKKYSRNLNDLVIKGKLDPVIGRDDEIRRVLQILSRRTKNN 204

Query: 1021 PCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKK 1200
            P LIGEPGVGKTAI EG+AQRI  GDVPE ++ K++  LD+  LVAGTK+RGEFEERLK 
Sbjct: 205  PVLIGEPGVGKTAIVEGIAQRIVGGDVPENLKSKQIAALDIAALVAGTKFRGEFEERLKA 264

Query: 1201 LMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            L++E++ SD E+ILFIDE+H L+GAG+AEG++D
Sbjct: 265  LVKEVQASDGEVILFIDELHLLVGAGSAEGSMD 297



>gb:AE017241_414558 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 15 of 16 of the complete
            genome.>gb:AE016958_1057962 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 848

 Score =  189 bits (479), Expect = 1e-46
 Identities = 119/304 (39%), Positives = 161/304 (52%), Gaps = 12/304 (3%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K    +  A + A   G+  +                AA +L+++G+     R E E+
Sbjct: 7    TTKTQAALTAALQAASAAGNPEIRPAHLLMALLTQADGIAAPLLEAVGVEPATIRAEAER 66

Query: 601  IIGRGSGFVAVEIPFTPRAKRVLELSLEE----------ARQLGHNYIGSXXXXXXXXXX 750
            ++ R        +P    A    +LS E           A +L   Y+ +          
Sbjct: 67   MLAR--------LPQASGASSQPQLSRESLAAITTAQHLATELDDEYVSTEHLMVGLATG 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
               VA ++L   GA P  +R   +++                       LE+Y T+LT  
Sbjct: 119  DSDVA-KLLTGHGASPQALREAFVKVRGSARVTSPDPEATYQA------LEKYSTDLTAR 171

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A EGKLDPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI  GDVPE+
Sbjct: 172  AREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVAGDVPES 231

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFIDEVHTLIGAGA-AE 1284
            +  K VI LD+G +VAG KYRGEFEERLK ++++IK S  +II FIDE+HT++GAGA  E
Sbjct: 232  LRDKTVIALDLGSMVAGAKYRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGE 291

Query: 1285 GAID 1296
            GA+D
Sbjct: 292  GAMD 295



>gb:BX294148_770050 Pirellula sp. strain 1 complete genome; segment
            16/24.
          Length = 899

 Score =  188 bits (478), Expect = 2e-46
 Identities = 113/300 (37%), Positives = 168/300 (56%), Gaps = 5/300 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV- 588
            ++ T +A  V+  AQ +A   G+  +                   +L+ + +++   +  
Sbjct: 24   DKLTTQAQNVVAEAQAQATSAGNAEIDPLHVLSAAVNQRDGITTPLLEKINVDVPKLKSL 83

Query: 589  ---EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
               E+EK+    SG     +  + + +  LE S   A  L   Y+ S             
Sbjct: 84   LTSELEKL-PHASGMGQARV--SAKLQAALEASATSAESLKDEYV-STEHLLVGLARTDN 139

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
             A  +L  LG   +++ T + ++                       LE++G +LT+LA+ 
Sbjct: 140  KAKNLLSLLGVSDNDLLTAMSQIRGSARVTDPNAESTYQA------LEKFGIDLTQLAQS 193

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPV+GR ++I RV Q+L RRTKNNP LIG+PGVGKTAIAEGLA RI  GDVP++++G
Sbjct: 194  GKLDPVIGRDNEIRRVIQVLSRRTKNNPVLIGQPGVGKTAIAEGLALRIFEGDVPQSLKG 253

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            KKV++LDMG LVAG K+RG+FEERLK ++ E+K SD ++ILFIDE+H ++GAG AEG+ D
Sbjct: 254  KKVVSLDMGALVAGAKFRGDFEERLKSVLREVKDSDGKVILFIDELHLVVGAGNAEGSAD 313



>gb:AP006841_572936 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 844

 Score =  188 bits (477), Expect = 2e-46
 Identities = 109/325 (33%), Positives = 173/325 (53%), Gaps = 28/325 (8%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M  +F++K   +I+ ++EEA RL  +++                A ++L  +  NL D +
Sbjct: 1    MNNQFSQKVSDIIVYSKEEANRLKSSYIGPEHLLLGMLRDGEGKAIEILSKLKTNLTDIK 60

Query: 586  VEVEKIIGRGSGFVAV---EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
             ++E I+   +  + +   ++P +  A ++L+L + EAR +      +            
Sbjct: 61   KQIEAILKEHADDMLLPDADVPLSNGAAKILKLCILEARVMKSQVADTEHVLLAILKDKD 120

Query: 757  XVAARVLE---------------------NLGADPSNIRTQVIRMXXXXXXXXXXXXXXX 873
             +AA VLE                      +G    +   + +                 
Sbjct: 121  NLAATVLEANHVNYQQVFEQLSLQPDISAGMGFTEDDDDEEEMNQSRSSHGSGERQQQAQ 180

Query: 874  XXXQK----MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEP 1041
               +K     P L+ +GT++TK AEEG+LDPVVGR+ +IER+ QIL RR KNNP LIGEP
Sbjct: 181  TASRKPTNDTPVLDNFGTDMTKAAEEGRLDPVVGREQEIERLAQILSRRKKNNPILIGEP 240

Query: 1042 GVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ 1221
            GVGK+AI EGLA RI    V   +  K+V+ LDM  +VAGTKYRG+FEER++ ++ E+++
Sbjct: 241  GVGKSAIVEGLALRIIQKKVSRILFDKRVVALDMTAVVAGTKYRGQFEERIRSILNELQK 300

Query: 1222 SDEIILFIDEVHTLIGAGAAEGAID 1296
            +  +ILFIDE+HT++GAG+A G++D
Sbjct: 301  NPNVILFIDEIHTIVGAGSAAGSMD 325



>gb:AE016786_332737 Pseudomonas putida KT2440 section 13 of 21 of the
            complete genome.>gb:AE015451_947814 Pseudomonas putida
            KT2440 complete genome.
          Length = 940

 Score =  188 bits (477), Expect = 2e-46
 Identities = 102/253 (40%), Positives = 148/253 (58%), Gaps = 3/253 (1%)
 Frame = +1

Query: 547  VLKSMGINLKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXX 726
            +L    I + + + ++E    RG      E+  +PR K  L  +   + +LGH Y+G   
Sbjct: 170  ILSQFKIKVDELKRQIEAEAKRGDKPFEGEVGVSPRVKDALSRAFVASNELGHAYVGPEH 229

Query: 727  XXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEE 906
                       +AA +L   G  P  +R  V ++                   + P L++
Sbjct: 230  FLIGLAEEGEGLAANLLRRYGLMPQALRQCVSKVVGKGAEDGRAEAPT-----ETPELDK 284

Query: 907  YGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRI 1086
            Y  +LT++A +GKLDPV+GR  +IE   ++L RR KNNP LIGEPGVGKTAI EGLAQR+
Sbjct: 285  YSRDLTRMARDGKLDPVIGRAQEIETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRM 344

Query: 1087 ANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTL 1263
              G+VPET+  K+++ L++  LVAG KYRGEFEER++K+++EI +   E+ILFIDEVHT+
Sbjct: 345  VAGEVPETLRDKRLVELNINSLVAGAKYRGEFEERVQKVLKEIAEHQGELILFIDEVHTI 404

Query: 1264 IGA--GAAEGAID 1296
            +GA  G  EG +D
Sbjct: 405  VGAGQGGGEGGLD 417



>pir|T51523|T51523 clpB heat shock protein-like - Arabidopsis
            thaliana>gb:ATT20K14_1554985 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T20K14 (ESSA project).
          Length = 968

 Score =  188 bits (477), Expect = 2e-46
 Identities = 90/138 (65%), Positives = 113/138 (81%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT +A EGKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI+
Sbjct: 233  KYEALEKYGKDLTAMAREGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAIS 292

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVP+ +  +K+I+LDMG L+AG KYRGEFE+RLK +++E+  S+ +IILF
Sbjct: 293  EGLAQRIVQGDVPQALMNRKLISLDMGALIAGAKYRGEFEDRLKAVLKEVTDSEGQIILF 352

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA  GA+D
Sbjct: 353  IDEIHTVVGAGATNGAMD 370



>gb:BA000012_668607 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 868

 Score =  187 bits (476), Expect = 3e-46
 Identities = 118/304 (38%), Positives = 162/304 (53%), Gaps = 9/304 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+++E+    I  AQ  A    H                   AA +++  G N++D ++ 
Sbjct: 4    EKYSERVRGFIQSAQTMALSRNHQQFTPEHILKVLVDDDEGLAASLIERAGGNVRDVKLG 63

Query: 592  VEKII--------GRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXX 747
            VE  +        G G  ++A      P AK V   + E A++ G +++           
Sbjct: 64   VETALEAMPKVEGGNGQLYLA-----QPLAK-VFSTAEELAKKAGDSFVTVERLLQALTM 117

Query: 748  XXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTK 927
                  A +L   G     +  QVI                    Q    L++Y  +LT 
Sbjct: 118  EKSAKTADILAKAGVTAQALN-QVIN-----DVRKGRTADSASAEQNYDALKKYARDLTA 171

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A  GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI NGDVPE
Sbjct: 172  DARAGKLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPE 231

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAE 1284
            +++ K+++ LDMG L+AG KYRGEFEERLK ++ E+  ++  IILFIDE+HTL+GAG A+
Sbjct: 232  SLKDKQLMALDMGALIAGAKYRGEFEERLKAVLSEVTSANGNIILFIDEMHTLVGAGKAD 291

Query: 1285 GAID 1296
            GA+D
Sbjct: 292  GAMD 295



>gb:AP008231_580155 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 883

 Score =  187 bits (476), Expect = 3e-46
 Identities = 89/138 (64%), Positives = 115/138 (83%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT++A  GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 168  KYEALEKYGRDLTEMARRGKLDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIA 227

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDE-IILF 1242
            EGLAQRI NGDVP++++ +++I LDMG L+AG K+RGEFEERLK +++E+  S+  IILF
Sbjct: 228  EGLAQRIINGDVPQSLKDRRLIALDMGALIAGAKFRGEFEERLKAVLKEVTDSEGIIILF 287

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +G++D
Sbjct: 288  IDEIHTVVGAGAVQGSMD 305



>gb:AP006841_571732 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 862

 Score =  187 bits (476), Expect = 3e-46
 Identities = 108/297 (36%), Positives = 157/297 (52%), Gaps = 1/297 (0%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F  FT K+ + +  A   A+  G   +                   + + +G+N +   +
Sbjct: 3    FNNFTIKSQEAVQEAINLAQSRGQQAIETAHILYGVMKVGENVTNFIFQKLGLNGQQISL 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
             ++K I         E   +  A  V + + + ++++G  ++               V+ 
Sbjct: 63   VLDKQIDSFPKVSGGEPYLSREANEVFQKATQYSKEMGDEFVSLEHLLLALLTVKSTVST 122

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKL 948
             +L++ G     +R  +  +                      +LE+Y  NL + A  GKL
Sbjct: 123  -ILKDAGMTEKELRGAISELRKGEKVTSQSSE------DNYQSLEKYAINLNEAARSGKL 175

Query: 949  DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKV 1128
            DPV+GR ++I RV QIL RRTKNNP LIGEPG GKTAI EGLA RI  GDVPE ++ K+V
Sbjct: 176  DPVIGRDEEIRRVLQILSRRTKNNPILIGEPGTGKTAIVEGLAHRILRGDVPENLKNKQV 235

Query: 1129 ITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             +LDMG LVAG KY+GEFEERLK ++ E+K+S+  IILFIDE+HTL+GAG  EGA+D
Sbjct: 236  YSLDMGALVAGAKYKGEFEERLKSVVNEVKKSEGNIILFIDEIHTLVGAGKGEGAMD 292



>gb:AE016945_363963 Bacteroides thetaiotaomicron VPI-5482, section 20
            of 21 of the complete genome.>gb:AE015928_990451
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 862

 Score =  187 bits (476), Expect = 3e-46
 Identities = 108/297 (36%), Positives = 158/297 (53%), Gaps = 1/297 (0%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F  FT K+ + +  A    +  G   +                   + + +G+N +   +
Sbjct: 3    FNNFTIKSQEAVQEAVNLVQSRGQQAIEPAHILHGVMKVGENVTNFIFQKLGMNGQQVAL 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
             V+K I         E   +  +  VL+ + + ++++G  ++               V+ 
Sbjct: 63   VVDKQIESLPKVSGGEPYLSRESNEVLQKATQYSKEMGDEFVSLEHILLALLTVKSTVST 122

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKL 948
             +L++ G     +R  +  +                      +LE+Y  NL + A  GKL
Sbjct: 123  -ILKDAGMTEKELRNAINELRKGEKVTSQSSE------DNYQSLEKYAINLNEAARSGKL 175

Query: 949  DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKV 1128
            DPV+GR ++I RV QIL RRTKNNP LIGEPG GKTAI EGLA RI  GDVPE ++ K+V
Sbjct: 176  DPVIGRDEEIRRVLQILSRRTKNNPILIGEPGTGKTAIVEGLAHRILRGDVPENLKNKQV 235

Query: 1129 ITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             +LDMG LVAG KY+GEFEERLK ++ E+K+S+ +IILFIDE+HTL+GAG  EGA+D
Sbjct: 236  YSLDMGALVAGAKYKGEFEERLKSVVNEVKKSEGDIILFIDEIHTLVGAGKGEGAMD 292



>gb:AE016827_343412 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 856

 Score =  187 bits (476), Expect = 3e-46
 Identities = 111/301 (36%), Positives = 166/301 (55%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+FT K  + +  AQ  A    + ++                 A +L S G+N+   + E
Sbjct: 4    EKFTTKFQQALAEAQSLALGKDNQYIEPVHVLSALINQQDGSVAPILTSAGVNVGALKAE 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +   I +     G+G    ++  + +   +L L  + A++    +I S            
Sbjct: 64   LNSEINKLPQVSGNGG---DVQISRQLLNLLNLCDKIAQRNNDKFISSELFLLAALEEKG 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +   +L+  GA   ++   +                     +    LE+Y  +LT+ AE
Sbjct: 121  SLGD-LLKKCGAKKESLEQAI------KTIRGGQSVNDQNAEESRQALEKYTIDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
             GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  SGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
            GK+V++LDMG L+AG KYRGEFEERLK +++E+ Q + ++ILFIDE+HT++GAG  +GA+
Sbjct: 234  GKRVLSLDMGALIAGAKYRGEFEERLKAVLKELAQEEGKVILFIDEIHTMVGAGKTDGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>gb:OSJN00288_1698009 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OJ000315_02, complete sequence.
          Length = 877

 Score =  187 bits (475), Expect = 4e-46
 Identities = 131/406 (32%), Positives = 192/406 (47%), Gaps = 57/406 (14%)
 Frame = +1

Query: 235  AMLCSSQS-PSLK-LRSFTGLR--------GGNALDTMARSGQTLHSKXXXXXXXXXXXX 384
            A  CSS S PS   L +  GLR        GG        +G+ + +             
Sbjct: 3    ACCCSSSSVPSASILATGAGLRRRFSPAGAGGGGRAVAVAAGRPIRASAALLAAPAPRRR 62

Query: 385  XXXXXKAMFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMG 564
                 +A+FERFTE+A+K ++ +Q EAR +G   V                   +  + G
Sbjct: 63   GGVVVRAVFERFTERAVKAVVFSQREARGMGDETVAPHHLLLGLVAEDRSPLGFL--ASG 120

Query: 565  INLKDARVEVEKIIGRGSGF------VAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXX 726
            + ++ AR      +G+  G       +A ++PF+  +KRV E ++E +R +G N+I    
Sbjct: 121  VRVERAREACRAAVGK-EGLAQAPVGLATDVPFSGASKRVFEAAVEFSRNMGCNFISPEH 179

Query: 727  XXXXXXXXXXXVAARVLENLGADPSNIRTQV----------------------IRMXXXX 840
                           VL++LG D S +  Q                       +R     
Sbjct: 180  IALGLFNLNDPTTNNVLKSLGVDSSQLAKQALTRVQGELAKDGREPVGLSSFKVREKFTP 239

Query: 841  XXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNN 1020
                          ++   L  +  +LT  A  G +DPV+GR+D+IERV QI+ RRTKNN
Sbjct: 240  GGGKSAIVKYSNKNKEKSALALFCLDLTMRASGGLIDPVIGRKDEIERVVQIICRRTKNN 299

Query: 1021 PCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKK 1200
            P L+GE GVGKTAIAEGLA +IANGDVP  + GK++++LD+ LL+AG K RGE E R+  
Sbjct: 300  PILLGEAGVGKTAIAEGLAHKIANGDVPIFLVGKRILSLDVALLMAGAKERGELEARVTS 359

Query: 1201 LMEEIKQSD-------------------EIILFIDEVHTLIGAGAA 1281
            L+ E++++D                   ++ILFIDEVHTLIG+G A
Sbjct: 360  LIREVRKADPKLPFLVFNLQRAPKFHAGDVILFIDEVHTLIGSGIA 405



>gb:MBU73653_142929 Mycobacterium bovis 63 kDa protein, 47 kDa protein
            and clpB gene, complete cds.
          Length = 877

 Score =  187 bits (475), Expect = 4e-46
 Identities = 107/258 (41%), Positives = 154/258 (59%), Gaps = 5/258 (1%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGR---GSGFVAVEIPFTPRAKRVLELSLEEARQLGHN 708
            AA +L+++G+     R E ++++ R    +G  + +   +  +   +  + + A +L   
Sbjct: 75   AAPLLEAVGVEPATVRAETQRLLDRLPQATG-ASTQPQLSRESLAAITTAQQLATELDDE 133

Query: 709  YIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQK 888
            Y+ +             VA ++L   GA P  +R   +++                  QK
Sbjct: 134  YVSTEHVMVGLATGDSDVA-KLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK 192

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
                  Y T+LT  A EGKLDPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI E
Sbjct: 193  ------YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVE 246

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFI 1245
            GLAQRI  GDVPE++  K ++ LD+G +VAG+KYRGEFEERLK ++++IK S  +II FI
Sbjct: 247  GLAQRIVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFI 306

Query: 1246 DEVHTLIGAGA-AEGAID 1296
            DE+HT++GAGA  EGA+D
Sbjct: 307  DELHTIVGAGATGEGAMD 324



>sp|O53719|CLPB_MYCTU ClpB protein.>pir|C70834|C70834 probable
            endopeptidase Clp ATP-binding chain B - Mycobacterium
            tuberculosis (strain H37RV)>gb:AE000516_20388
            Mycobacterium tuberculosis CDC1551, complete
            genome.>gb:BX248335_757749 Mycobacterium bovis subsp.
            bovis AF2122/97 complete genome; segment
            2/14.>gb:BX842573_818426 Mycobacterium tuberculosis H37Rv
            complete genome; segment 2/13.
          Length = 848

 Score =  187 bits (475), Expect = 4e-46
 Identities = 107/258 (41%), Positives = 154/258 (59%), Gaps = 5/258 (1%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGR---GSGFVAVEIPFTPRAKRVLELSLEEARQLGHN 708
            AA +L+++G+     R E ++++ R    +G  + +   +  +   +  + + A +L   
Sbjct: 46   AAPLLEAVGVEPATVRAETQRLLDRLPQATG-ASTQPQLSRESLAAITTAQQLATELDDE 104

Query: 709  YIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQK 888
            Y+ +             VA ++L   GA P  +R   +++                  QK
Sbjct: 105  YVSTEHVMVGLATGDSDVA-KLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK 163

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
                  Y T+LT  A EGKLDPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI E
Sbjct: 164  ------YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVE 217

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFI 1245
            GLAQRI  GDVPE++  K ++ LD+G +VAG+KYRGEFEERLK ++++IK S  +II FI
Sbjct: 218  GLAQRIVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFI 277

Query: 1246 DEVHTLIGAGA-AEGAID 1296
            DE+HT++GAGA  EGA+D
Sbjct: 278  DELHTIVGAGATGEGAMD 295



>gb:BA000039_727173 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 871

 Score =  187 bits (474), Expect = 5e-46
 Identities = 91/138 (65%), Positives = 114/138 (82%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT LA +GKLDPV+GR D+I RV QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 158  KYAALEKYGRDLTLLARQGKLDPVIGRDDEIRRVIQILSRRTKNNPVLIGEPGVGKTAIA 217

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI   DVP+++  +++I LDMG L+AG KYRGEFEERLK +++E+  S+ +IILF
Sbjct: 218  EGLAQRIVARDVPDSLRDRQLIALDMGALIAGAKYRGEFEERLKAVLKEVTDSNGQIILF 277

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 278  IDEIHTVVGAGATQGAMD 295



>gb:AE017295_434201 Leptospira interrogans serovar Copenhageni str.
            Fiocruz L1-130, chromosome I, section 9 of 14 of the
            complete sequence.>gb:AE016823_1067212 Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130,
            chromosome I, complete sequence.
          Length = 860

 Score =  187 bits (474), Expect = 5e-46
 Identities = 108/299 (36%), Positives = 158/299 (52%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++ T K  + I  AQ  A +LG+  +                   ++  + ++ K     
Sbjct: 4    DKLTSKLNEAIYNAQASAEKLGNPEISEEHILKEVLSQPDGLVPLLISKLNLSPKSFLES 63

Query: 592  VEKIIGRG---SGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             E  +G+     G  + ++ F+  A  +L+ + E  ++L   Y+ +              
Sbjct: 64   TENALGKQPKVGGNTSADVGFSRSAVSLLKAADEVRKELKDEYLSTDHILLGLMKNGTGS 123

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
                   LG +   +      +                   K   L +Y  NL +LA++G
Sbjct: 124  LKTEFLKLGLEYHKL------LKITLENRKGKTIMDDSPEGKTDALAKYAKNLNELAKQG 177

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA +I  G+VPE I+ K
Sbjct: 178  KLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLANKIVQGEVPEGIKNK 237

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             + TLD+G ++AG KYRGEFE+RLK L++E+K SD E+ILFIDE+HTL+GAGA EGA+D
Sbjct: 238  TLYTLDLGSMIAGAKYRGEFEDRLKALLDEVKSSDGEVILFIDEIHTLVGAGATEGALD 296



>gb:AE016996_374682 Chlamydophila caviae GPIC section 3 of 4 of the
            complete genome.>gb:AE015925_994361 Chlamydophila caviae
            GPIC complete genome.
          Length = 864

 Score =  187 bits (474), Expect = 5e-46
 Identities = 90/134 (67%), Positives = 112/134 (83%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  NLT LA+EGKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 160  LEKYCKNLTLLAKEGKLDPVIGRDEEIRRTVQVLSRRTKNNPMLIGEPGVGKTAIAEGLA 219

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
             RI  GD+PE+++GK++  LDMG L+AG KYRGEFEERLK ++++++  D E ILFIDEV
Sbjct: 220  LRIVQGDIPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESVDGESILFIDEV 279

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAGA +GA+D
Sbjct: 280  HTLVGAGATDGAMD 293



>gb:AE011362_272116 Leptospira interrogans serovar lai str. 56601
            chromosome I, section 171 of 397 of the complete
            sequence.>gb:AE010300_1005515 Leptospira interrogans
            serovar lai str. 56601 chromosome I, complete sequence.
          Length = 860

 Score =  187 bits (474), Expect = 5e-46
 Identities = 108/299 (36%), Positives = 158/299 (52%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++ T K  + I  AQ  A +LG+  +                   ++  + ++ K     
Sbjct: 4    DKLTSKLNEAIYNAQASAEKLGNPEISEEHILKEVLSQPDGLVPLLISKLNLSPKSFLES 63

Query: 592  VEKIIGRG---SGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
             E  +G+     G  + ++ F+  A  +L+ + E  ++L   Y+ +              
Sbjct: 64   TENALGKQPKVGGNTSADVGFSRSAVSLLKAADEVRKELKDEYLSTDHILLGLMKNGTGS 123

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
                   LG +   +      +                   K   L +Y  NL +LA++G
Sbjct: 124  LKTEFLKLGLEYHKL------LKITLENRKGKTIMDDSPEGKTDALAKYAKNLNELAKQG 177

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA +I  G+VPE I+ K
Sbjct: 178  KLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLANKIVQGEVPEGIKNK 237

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             + TLD+G ++AG KYRGEFE+RLK L++E+K SD E+ILFIDE+HTL+GAGA EGA+D
Sbjct: 238  TLYTLDLGSMIAGAKYRGEFEDRLKALLDEVKSSDGEVILFIDEIHTLVGAGATEGALD 296



>gb:CR925678_118881 Ehrlichia ruminantium str. Welgevonden, complete
            genome.
          Length = 863

 Score =  187 bits (474), Expect = 5e-46
 Identities = 114/302 (37%), Positives = 164/302 (54%), Gaps = 8/302 (2%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FT+ +   I+ AQ  A  LGH  +                   +L S G N++  R +V
Sbjct: 9    KFTDISKNFIVQAQTSAVALGHQSLVPEHLLKVMLDDKDEIVEVLLTSCGCNVETLRNDV 68

Query: 595  EKII-------GRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
               +       G GSG     I  +    +VL+ ++  A++   +Y+             
Sbjct: 69   ISALNKLPVVSGPGSG----HIHLSKEMAQVLQEAVNLAKRHQDSYVTVERLLQALTIIK 124

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                +R+L   G  P  + + ++ M                  QK   L++Y  ++T++A
Sbjct: 125  DSNVSRILIAHGVTPQKLESLIVNMRNGARADSVNSE------QKFNALKKYAKDVTEVA 178

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA +I  GDVP  +
Sbjct: 179  RAGKLDPVIGRDEEIRRTIQVLLRRTKNNPVLIGEPGVGKTAIIEGLAHKIVKGDVPIGL 238

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGA 1290
               ++++LD+G+LVAGTKYRGEFEERLK ++ EI  S+  IILFIDE+HTL+GAGA +GA
Sbjct: 239  RDMRIMSLDLGMLVAGTKYRGEFEERLKAVVNEIVSSNGSIILFIDELHTLVGAGATDGA 298

Query: 1291 ID 1296
            +D
Sbjct: 299  MD 300



>gb:CR767821_117004 Ehrlichia ruminantium strain Welgevonden, complete
            genome.
          Length = 859

 Score =  187 bits (474), Expect = 5e-46
 Identities = 114/302 (37%), Positives = 164/302 (54%), Gaps = 8/302 (2%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FT+ +   I+ AQ  A  LGH  +                   +L S G N++  R +V
Sbjct: 5    KFTDISKNFIVQAQTSAVALGHQSLVPEHLLKVMLDDKDEIVEVLLTSCGCNVETLRNDV 64

Query: 595  EKII-------GRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
               +       G GSG     I  +    +VL+ ++  A++   +Y+             
Sbjct: 65   ISALNKLPVVSGPGSG----HIHLSKEMAQVLQEAVNLAKRHQDSYVTVERLLQALTIIK 120

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                +R+L   G  P  + + ++ M                  QK   L++Y  ++T++A
Sbjct: 121  DSNVSRILIAHGVTPQKLESLIVNMRNGARADSVNSE------QKFNALKKYAKDVTEVA 174

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA +I  GDVP  +
Sbjct: 175  RAGKLDPVIGRDEEIRRTIQVLLRRTKNNPVLIGEPGVGKTAIIEGLAHKIVKGDVPIGL 234

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGA 1290
               ++++LD+G+LVAGTKYRGEFEERLK ++ EI  S+  IILFIDE+HTL+GAGA +GA
Sbjct: 235  RDMRIMSLDLGMLVAGTKYRGEFEERLKAVVNEIVSSNGSIILFIDELHTLVGAGATDGA 294

Query: 1291 ID 1296
            +D
Sbjct: 295  MD 296



>gb:AF203700_1776622 Phaseolus lunatus ClpB (clpB) mRNA, complete cds;
            nuclear gene for chloroplast product.
          Length = 977

 Score =  186 bits (473), Expect = 7e-46
 Identities = 90/138 (65%), Positives = 114/138 (82%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   L++YG +LT+LA+ GKLDPV+GR D+I R  QIL RRTKNNP +IGEPGVGKTAIA
Sbjct: 245  KYEALDKYGNDLTELAKRGKLDPVIGRDDEIRRCIQILSRRTKNNPVIIGEPGVGKTAIA 304

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVPE +  +K+I+LDMG L+AG KYRG+FEERLK +++E+  S+ +IILF
Sbjct: 305  EGLAQRIVRGDVPEPLMNRKLISLDMGSLLAGAKYRGDFEERLKAVLKEVTASNGQIILF 364

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA  GA+D
Sbjct: 365  IDEIHTVVGAGATSGAMD 382



>gb:SCO939131_181189 Streptomyces coelicolor A3(2) complete genome;
            segment 28/29.
          Length = 837

 Score =  186 bits (472), Expect = 9e-46
 Identities = 104/237 (43%), Positives = 146/237 (61%), Gaps = 2/237 (0%)
 Frame = +1

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            + +++ R +G  + E   TP AKR L  +   +R  G +YIG               AAR
Sbjct: 98   IAEVLPREAGEPSAEPGLTPAAKRTLATAYARSRASGVSYIGPEHILGALLADGDTGAAR 157

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L   G D   +                         +   TL+EYG +LT  A+ GKLD
Sbjct: 158  LLGAQGQDIGKLE------GLTEQAARPGGAPGDDGGRPATTLDEYGRDLTDEAKAGKLD 211

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PVVGR ++IE+  +IL RR+KNNP LIGEPGVGKTAI EGLAQRI  G+VP T++ K+V+
Sbjct: 212  PVVGRAEEIEQTVEILSRRSKNNPVLIGEPGVGKTAIVEGLAQRIVAGEVPNTLKDKRVV 271

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFIDEVHTLIGAGAA-EGAID 1296
             LD+  +VAG +YRG+FEERLKK++E+++Q+  +IILFIDE+HT++GAGA+ E ++D
Sbjct: 272  ALDLSAMVAGAQYRGQFEERLKKVIEDVQQARGDIILFIDELHTVVGAGASGESSMD 328



>pir|AC3070|AC3070 ATP-dependent Clp proteinase, ATP-binding subunit
            clpB [imported] - Agrobacterium tumefaciens (strain C58,
            Dupont)>gb:AE009347_251004 Agrobacterium tumefaciens str.
            C58 linear chromosome, section 117 of 187 of the complete
            sequence.>gb:AE008689_1088847 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete sequence.
          Length = 874

 Score =  186 bits (472), Expect = 9e-46
 Identities = 107/260 (41%), Positives = 155/260 (59%), Gaps = 7/260 (2%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGR------GSGFVAVEIPFTPRAKRVLELSLEEARQL 699
            AA +++  G + K+AR+  +  + +      G+G +++  P      +V   + + A++ 
Sbjct: 46   AASLIERAGGDAKEARLANDAALAKLPKVSGGNGGLSLTAPLA----KVFSTAEDLAKKA 101

Query: 700  GHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXX 879
            G +++                 +  L+  GA    +  QVI                   
Sbjct: 102  GDSFVTVERLLQALAIESSASTSASLKKAGATAQALN-QVIN-----DIRKGRTADSANA 155

Query: 880  XQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA 1059
             Q    L++Y  +LT+ A EG+LDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTA
Sbjct: 156  EQGFDALKKYARDLTEEAREGRLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKTA 215

Query: 1060 IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEII 1236
            IAEGLA RI NGDVPE+++ KK++ LDMG L+AG KYRGEFEERLK ++ E++ ++  II
Sbjct: 216  IAEGLALRIVNGDVPESLKDKKLMALDMGALIAGAKYRGEFEERLKAVLNEVQAENGGII 275

Query: 1237 LFIDEVHTLIGAGAAEGAID 1296
            LFIDE+HTL+GAG A+GA+D
Sbjct: 276  LFIDEMHTLVGAGKADGAMD 295



>pir|D71555|D71555 endopeptidase Clp ATP-binding chain - Chlamydia
            trachomatis  (serotype D, strain
            UW3/Cx)>gb:AE001285_34039 Chlamydia trachomatis D/UW-3/CX
            section 12 of 87 of the complete
            genome.>gb:AE001273_1098065 Chlamydia trachomatis
            D/UW-3/CX, complete genome.
          Length = 867

 Score =  186 bits (472), Expect = 9e-46
 Identities = 115/299 (38%), Positives = 163/299 (54%), Gaps = 4/299 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+F++   + +  A E A+   H++V                   V+K +  NL      
Sbjct: 2    EKFSDAVSEALEKAFELAKNSKHSYVTENHLLKSLLQNPGSLFCLVIKDVHGNLGLLTSA 61

Query: 592  VEKIIGRGSGFV---AVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            V+  + R    V   AV  P +P  +++L  + +EAR +G  Y+                
Sbjct: 62   VDDALRREPTVVEGTAVASP-SPSLQQLLLNAHQEARSMGDEYLSGDHLLLAFWRSTKEP 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
             A   + +      ++  + ++                  + +  LE+Y  NLT LA EG
Sbjct: 121  FASWRKTVKTTSEALKELITKLRQGSRMDSPSAE------ENLKGLEKYCKNLTVLAREG 174

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI  GDVPE+++ K
Sbjct: 175  KLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLALRIVQGDVPESLKEK 234

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             +  LDMG L+AG KYRGEFEERLK +++ ++ S+ E ILFIDEVHTL+GAGA +GA+D
Sbjct: 235  HLYVLDMGALIAGAKYRGEFEERLKSVLKGVEASEGECILFIDEVHTLVGAGATDGAMD 293



>pir|F98216|F98216 endopeptidase clp ATP-binding chain B [imported] -
            Agrobacterium tumefaciens (strain C58,
            Cereon)>gb:AE008266_235197 Agrobacterium tumefaciens str.
            C58 linear chromosome, section 70 of 187 of the complete
            sequence.>gb:AE007870_1080310 Agrobacterium tumefaciens
            str. C58 linear chromosome, complete sequence.
          Length = 887

 Score =  186 bits (472), Expect = 9e-46
 Identities = 107/260 (41%), Positives = 155/260 (59%), Gaps = 7/260 (2%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGR------GSGFVAVEIPFTPRAKRVLELSLEEARQL 699
            AA +++  G + K+AR+  +  + +      G+G +++  P      +V   + + A++ 
Sbjct: 59   AASLIERAGGDAKEARLANDAALAKLPKVSGGNGGLSLTAPLA----KVFSTAEDLAKKA 114

Query: 700  GHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXX 879
            G +++                 +  L+  GA    +  QVI                   
Sbjct: 115  GDSFVTVERLLQALAIESSASTSASLKKAGATAQALN-QVIN-----DIRKGRTADSANA 168

Query: 880  XQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTA 1059
             Q    L++Y  +LT+ A EG+LDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTA
Sbjct: 169  EQGFDALKKYARDLTEEAREGRLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKTA 228

Query: 1060 IAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEII 1236
            IAEGLA RI NGDVPE+++ KK++ LDMG L+AG KYRGEFEERLK ++ E++ ++  II
Sbjct: 229  IAEGLALRIVNGDVPESLKDKKLMALDMGALIAGAKYRGEFEERLKAVLNEVQAENGGII 288

Query: 1237 LFIDEVHTLIGAGAAEGAID 1296
            LFIDE+HTL+GAG A+GA+D
Sbjct: 289  LFIDEMHTLVGAGKADGAMD 308



>gb:AE017152_392104 Haemophilus ducreyi strain 35000HP section 2 of 6
            of the complete genome.>gb:AE017143_1026366 Haemophilus
            ducreyi strain 35000HP complete genome.
          Length = 856

 Score =  186 bits (471), Expect = 1e-45
 Identities = 106/297 (35%), Positives = 163/297 (54%), Gaps = 1/297 (0%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            FE+FT K  + +  AQ  A    + ++                 A +  ++ ++ +    
Sbjct: 3    FEKFTTKLQEALNEAQSLAVAKDNAYIEPVHLLYALVKQQDGAIAPLFTTLNVSTQTLIN 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAA 768
            E+E I+ +           + +  R+L  + + A+Q   ++I S             +  
Sbjct: 63   ELELILNQLPQVTGTTTQASQQLIRLLNQTAKLAQQFNDSFISSELFLLAALDDHGSLG- 121

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKL 948
            ++ +  G    N+   + +M                  Q    L++Y  +LT+ A+ GKL
Sbjct: 122  KLFKAFGLTKENVTQAISQMRGGESVNNQNAE------QTRQALQKYTIDLTERAKTGKL 175

Query: 949  DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKV 1128
            DPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++ K+V
Sbjct: 176  DPVIGRDEEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLKNKRV 235

Query: 1129 ITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            ++LDMG L+AG KYRGEFEERLK ++ E+ K+  ++ILFIDE+HT++GAG  +GA+D
Sbjct: 236  LSLDMGALIAGAKYRGEFEERLKAVLNELAKEEGQVILFIDEIHTMVGAGKTDGAMD 292



>pir|C97707|C97707 clpB protein [imported] - Rickettsia conorii
            (strain Malish 7)>gb:AE008573_238423 Rickettsia conorii
            str. Malish 7, section 5 of 114 of the complete
            genome.>gb:AE006914_1120541 Rickettsia conorii str.
            Malish 7, complete genome.
          Length = 857

 Score =  186 bits (471), Expect = 1e-45
 Identities = 114/303 (37%), Positives = 166/303 (54%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMG--INLKDAR 585
            ++FT  A  VI  +Q  A +  H  +                   ++ + G  INL   +
Sbjct: 4    DKFTAHAKSVIASSQLLAAKNDHQQILPLHLLSSLLSEETGIIQTLINNTGGNINLLKDQ 63

Query: 586  VEVE-----KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
            V++E     K+   G G    ++  +  A +VLE +   A+  G +++ +          
Sbjct: 64   VQLELNKIPKVQVEGGG----QVYSSAEALKVLEKASSIAKDNGDSFV-TIERIFEALTY 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
               +A ++L N G +   I T +++                        L++YG ++T+L
Sbjct: 119  DNTIAGKILTNNGINNKKIATAILQFRKGKKADTESAE------NSYDALKKYGRDVTEL 172

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            AE GKLDP++GR ++I R  Q+L RR KNNP LIGEPGVGKTAI EGLAQRI + DVPE+
Sbjct: 173  AESGKLDPIIGRDEEIRRTVQVLSRRMKNNPVLIGEPGVGKTAIIEGLAQRIFSKDVPES 232

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEG 1287
            +   ++I LDMG L+AG KYRGEFEERLK ++ EIK+S  EIILFIDE+H L+G G  +G
Sbjct: 233  LINCRIIELDMGALIAGAKYRGEFEERLKAVLSEIKESSGEIILFIDELHLLVGTGKTDG 292

Query: 1288 AID 1296
            A+D
Sbjct: 293  AMD 295



>gb:AC137999_1743918 Oryza sativa chromosome 3 BAC OSJNBa0020H02
            genomic sequence, complete sequence.
          Length = 978

 Score =  185 bits (470), Expect = 2e-45
 Identities = 88/138 (63%), Positives = 111/138 (80%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   L++YG +LT +A +GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 240  KYEALDKYGKDLTAMARQGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAIA 299

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVP+ +  +++I LDMG L+AG KYRGEFE+RLK +++E+  SD + ILF
Sbjct: 300  EGLAQRIVQGDVPQALTNRRLIALDMGALIAGAKYRGEFEDRLKAVLKEVTDSDGQTILF 359

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA  GA+D
Sbjct: 360  IDEIHTVVGAGATNGAMD 377



>gb:BX908798_830284 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 868

 Score =  185 bits (470), Expect = 2e-45
 Identities = 89/137 (64%), Positives = 116/137 (84%), Gaps = 1/137 (0%)
 Frame = +1

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
            +  LE+Y  NLT LA +GKLDPV+GR ++I R  Q+L RRTKNNP LIG+PGVGKTAIAE
Sbjct: 158  LQALEKYCKNLTDLARQGKLDPVIGRDEEIRRTMQVLCRRTKNNPMLIGDPGVGKTAIAE 217

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFI 1245
            GLAQRI   D+P++++ K+++ LDMG L+AGTKYRGEFEERLK ++++I++S+ +IILFI
Sbjct: 218  GLAQRIVQQDIPDSLKNKQLLALDMGSLIAGTKYRGEFEERLKGILQDIEKSEGQIILFI 277

Query: 1246 DEVHTLIGAGAAEGAID 1296
            DEVHTLIGAGA +GA+D
Sbjct: 278  DEVHTLIGAGATDGAMD 294



>gb:BX248360_763361 Corynebacterium diphtheriae gravis NCTC13129,
            complete genome; segment 7/8.
          Length = 849

 Score =  185 bits (470), Expect = 2e-45
 Identities = 117/297 (39%), Positives = 160/297 (53%), Gaps = 5/297 (1%)
 Frame = +1

Query: 421  TEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEK 600
            T K  + +  A ++A   G+  +                A  VL++ G++    R E E 
Sbjct: 7    TTKTQEALQEALQKASAAGNPDIRPEHLLAAILGQEDGIAIPVLRATGVDPDVVRREAEA 66

Query: 601  IIGR---GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            ++ +     G       F   A  VL  + E A +LG  Y+ S              AA 
Sbjct: 67   LVAKLPKAEGANLANPNFNRDALSVLNNAQELAGELGDEYV-STEVLLAAVARGTNDAAE 125

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            +L   GA      T  +                     +   LE+Y T+LT  A EGK+D
Sbjct: 126  LLTKRGA------TYDVIKGVFPSVRGNKKVTTESPEDQFQALEKYSTDLTARAREGKID 179

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA+RI  GDVPE+++GK +I
Sbjct: 180  PVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLARRIVAGDVPESLKGKTLI 239

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGA-AEGAID 1296
            +LD+G +VAG KYRGEFEERLK +++EIK ++ EII FIDE+HT++GAGA  + A+D
Sbjct: 240  SLDLGSMVAGAKYRGEFEERLKAVLDEIKSAEGEIITFIDELHTIVGAGATGDSAMD 296



>gb:AE017157_393490 Chlamydophila pneumoniae TW-183, section 1 of 4 of
            the complete genome.>gb:AE009440_1027752 Chlamydophila
            pneumoniae TW-183, complete genome.
          Length = 869

 Score =  185 bits (470), Expect = 2e-45
 Identities = 89/134 (66%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  NLT LA EGKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 163  LEKYCKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLA 222

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
             R+  GDVPE+++GK++  LDMG L+AG KYRGEFEERLK ++++++  D E I+FIDEV
Sbjct: 223  LRLIQGDVPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESGDGEHIIFIDEV 282

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAGA +GA+D
Sbjct: 283  HTLVGAGATDGAMD 296



>pir|H81556|H81556 ATP-dependent Clp proteinase, chain B CP0629
            [imported] - Chlamydophila pneumoniae (strain
            AR39)>gb:AE002220_44106 Chlamydophila pneumoniae AR39,
            section 48 of 94 of the complete
            genome.>gb:AE002161_886231 Chlamydophila pneumoniae AR39,
            complete genome.
          Length = 872

 Score =  185 bits (470), Expect = 2e-45
 Identities = 89/134 (66%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  NLT LA EGKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 166  LEKYCKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLA 225

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
             R+  GDVPE+++GK++  LDMG L+AG KYRGEFEERLK ++++++  D E I+FIDEV
Sbjct: 226  LRLIQGDVPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESGDGEHIIFIDEV 285

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAGA +GA+D
Sbjct: 286  HTLVGAGATDGAMD 299



>pir|E72113|E72113 clp proteinase ATPase - Chlamydophila pneumoniae
            (strain CWL029)>pir|H86508|H86508 Clp proteinase ATPase
            [imported] - Chlamydophila pneumoniae  (strain
            J138)>gb:AE001601_37009 Chlamydia pneumoniae section 17
            of 103 of the complete genome.>gb:BA000008_663517
            Chlamydophila pneumoniae J138 genomic DNA, complete
            sequence.>gb:AE001363_941566 Chlamydia pneumoniae,
            complete genome.
          Length = 866

 Score =  185 bits (470), Expect = 2e-45
 Identities = 89/134 (66%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  NLT LA EGKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 160  LEKYCKNLTALAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPMLIGEPGVGKTAIAEGLA 219

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
             R+  GDVPE+++GK++  LDMG L+AG KYRGEFEERLK ++++++  D E I+FIDEV
Sbjct: 220  LRLIQGDVPESLKGKQLYVLDMGALIAGAKYRGEFEERLKSVLKDVESGDGEHIIFIDEV 279

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAGA +GA+D
Sbjct: 280  HTLVGAGATDGAMD 293



>gb:CP000009_863456 Gluconobacter oxydans 621H, complete genome.
          Length = 866

 Score =  185 bits (469), Expect = 2e-45
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 1/240 (0%)
 Frame = +1

Query: 580  ARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            A  ++ K+ G G+G    +   TP   R+L+ +   A+  G +++               
Sbjct: 67   ALAKLPKVQGAGAG----QPQMTPDLARLLDAAESAAKVAGDSHVAQDRLLVAIAASHTP 122

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
                +++     P+  R                             L++Y  ++T +A+ 
Sbjct: 123  AGKALVDGKAGAPALERA-------VAEIRKGRTVTSASAENTFDALKKYARDVTAVAQA 175

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPV+GR ++I R  Q+L RR+KNNP LIGEPGVGKTAI EGLAQRI NGDVPE +  
Sbjct: 176  GKLDPVIGRDEEIRRTIQVLARRSKNNPVLIGEPGVGKTAIVEGLAQRIVNGDVPEALRN 235

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            KK+++LDMG L+AG KYRGEFEERLK +++EI+ ++ EIILFIDE+HTL+GAG ++GA+D
Sbjct: 236  KKLLSLDMGALIAGAKYRGEFEERLKAVLKEIETAEGEIILFIDEMHTLVGAGRSDGAMD 295



>gb:BX569693_776405 Synechococcus sp. WH8102 complete genome; segment
            5/7.
          Length = 875

 Score =  185 bits (469), Expect = 2e-45
 Identities = 87/135 (64%), Positives = 113/135 (83%), Gaps = 1/135 (0%)
 Frame = +1

Query: 895  TLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGL 1074
            +L +YG +LT  A +G+LDPV+GR ++I R  QIL RRTKNNP LIGEPGVGKTAI EGL
Sbjct: 174  SLAKYGRDLTAAARDGQLDPVIGRDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIVEGL 233

Query: 1075 AQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDE 1251
            AQRI NGDVP+ ++ +++ITLDMG L+AG KYRGEFEERLK +++E+  SD +I+LFIDE
Sbjct: 234  AQRIVNGDVPQALQNRQLITLDMGALIAGAKYRGEFEERLKAVLKEVTTSDGQIVLFIDE 293

Query: 1252 VHTLIGAGAAEGAID 1296
            +HT++GAGA+ GA+D
Sbjct: 294  IHTVVGAGASGGAMD 308



>gb:CR543861_103235 Acinetobacter sp. ADP1 complete genome.
          Length = 859

 Score =  185 bits (469), Expect = 2e-45
 Identities = 110/299 (36%), Positives = 167/299 (55%), Gaps = 3/299 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            FE+FT +  +V+  AQ  A    H  +                +  +L+  G  L + + 
Sbjct: 3    FEKFTNRLQQVLSDAQSLATGKDHTAIDGLHILATMLEEPSNLS--LLQQAGARLPELKQ 60

Query: 589  EVEKIIGRGSGFV--AVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXV 762
            ++E+ +           ++   P A +VL L+   A++ G  ++ +              
Sbjct: 61   KLEQALKDAPTITNPTGDVNLNPEAVKVLNLADRHAQKAGDEFLSTDWVLLALTETGSTK 120

Query: 763  AARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEG 942
            +  +L ++G     + T  +R                   Q+  +L +Y  +LT+ A  G
Sbjct: 121  S--LLNSVG-----VTTDTLRKVIESIRGNDKVMSNNHEDQR-DSLNKYTIDLTERALAG 172

Query: 943  KLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGK 1122
            KLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE+++ K
Sbjct: 173  KLDPVIGRDDEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPESLKNK 232

Query: 1123 KVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            +V++LD+G L+AG KYRGEFEERLK ++ ++ KQ  ++ILFIDE+HTL+GAG ++GA+D
Sbjct: 233  RVLSLDLGSLLAGAKYRGEFEERLKAVLNDLAKQDGQVILFIDELHTLVGAGKSDGAMD 291



>pir|AD2441|AD2441 endopeptidase Clp ATP-binding chain B [imported] -
            Nostoc sp. (strain PCC 7120)>gb:BA000019_686073 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 835

 Score =  185 bits (469), Expect = 2e-45
 Identities = 87/138 (63%), Positives = 116/138 (84%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K  +LE+YG +LT+ A +G+LDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 122  KYQSLEKYGRDLTEAARKGQLDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIA 181

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILF 1242
            EGLAQRI  GDVP++++ +K+I+LDMG ++AG K+RGEFEERLK +++E+ +S   I+LF
Sbjct: 182  EGLAQRIVAGDVPQSLKDRKLISLDMGAMIAGAKFRGEFEERLKAVLKEVTESGGNIVLF 241

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 242  IDEIHTVVGAGATQGAMD 259



>gb:BX842654_825843 Bdellovibrio bacteriovorus complete genome, strain
            HD100; segment 9/11.
          Length = 855

 Score =  184 bits (468), Expect = 3e-45
 Identities = 108/246 (43%), Positives = 143/246 (58%), Gaps = 4/246 (1%)
 Frame = +1

Query: 571  LKDARVEVEK---IIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXX 741
            L + R +++K   + G G    A     +PR +++ + +  EA++ G +YI +       
Sbjct: 56   LAELRTKIDKFPQVTGGGQKMFA-----SPRLEKIFQAAETEAQEWGDSYISTEHFFMAM 110

Query: 742  XXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNL 921
                        E  G    N  T                        K   L +Y  +L
Sbjct: 111  LKGGDS------ELNGLFKKNKVTAEAARTALTEIRGKQKVTDDDPENKYEVLNKYARDL 164

Query: 922  TKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDV 1101
            T LA EGKLDPVVGR ++I RV Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI   DV
Sbjct: 165  TALAAEGKLDPVVGRDEEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIIKQDV 224

Query: 1102 PETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGA 1278
            P+ + GKK+++LDMG L+AG KYRGEFE+RLK +++E+  SD +IILFIDE+HTL+GAG 
Sbjct: 225  PDNLIGKKLMSLDMGALIAGAKYRGEFEDRLKAVIKEVTSSDGQIILFIDELHTLVGAGK 284

Query: 1279 AEGAID 1296
             EGA+D
Sbjct: 285  TEGAMD 290



>gb:AP006618_561803 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 853

 Score =  184 bits (468), Expect = 3e-45
 Identities = 111/258 (43%), Positives = 149/258 (57%), Gaps = 5/258 (1%)
 Frame = +1

Query: 538  AAKVLKSMGINLKDARVEVEKIIGR---GSGFVAVEIPFTPRAKRVLELSLEEARQLGHN 708
            AA +LK++G++    R E + ++ R    +G    +      A   +  +   A +LG  
Sbjct: 46   AAPLLKAVGVDPATVRREAQDLVDRLPRATG-ATTQPQLGREALAAITAAQRLATELGDE 104

Query: 709  YIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQK 888
            Y+ +             V   +L+  GA    +R     +                    
Sbjct: 105  YVSTEHVLVGLADGDSDVTM-LLKKYGATADALREAFTTVRGSARVTTPDPEATYQA--- 160

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
               LE+Y T+LT+ A  GKLDPV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTAI E
Sbjct: 161  ---LEKYSTDLTEAARTGKLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVE 217

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQS-DEIILFI 1245
            GLAQRI  GDVPE++ GKKVI+LD+G +VAG KYRGEFEERLK ++E+IK S  +II FI
Sbjct: 218  GLAQRIVAGDVPESLRGKKVISLDLGAMVAGAKYRGEFEERLKAVLEDIKNSAGQIITFI 277

Query: 1246 DEVHTLIGAGA-AEGAID 1296
            DE+HT++GAGA  E A+D
Sbjct: 278  DELHTIVGAGATGESAMD 295



>gb:AE017252_417077 Treponema denticola ATCC 35405, section 7 of 10 of
            the complete genome.>gb:AE017226_1070673 Treponema
            denticola ATCC 35405, complete genome.
          Length = 832

 Score =  184 bits (468), Expect = 3e-45
 Identities = 102/299 (34%), Positives = 167/299 (55%), Gaps = 2/299 (0%)
 Frame = +1

Query: 406  MFERFTEKAIKVIML-AQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDA 582
            M +  ++ A K++ L  Q+EARR+  +                     +L+ + I++ + 
Sbjct: 1    MCQGLSQDAHKLLTLFGQQEARRVNADLFQPEHILSALIRNKVGRGYIILQKLNIDILNL 60

Query: 583  RVEVEKIIGRGSGFVAV-EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            ++ +E+     +G   + EIP + R K +++++  EAR +  + +G+             
Sbjct: 61   QLFIEQNTPIRTGDRIIGEIPPSRRIKTLVDIATIEARTMRQSVVGTEHLLVALVREENS 120

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
            + +           +IR  ++++                   K   L E+G NLT +   
Sbjct: 121  IISDFFMRYNIVTEDIRMIILKITDQMDSVRTAKAADVSKS-KSSALSEFGRNLTDIVSS 179

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            G LDP++GR+ +I R+ QIL RRTKNNP L+GEPG+GKT+I EGLA  I N +VP  +  
Sbjct: 180  GSLDPIIGREKEIRRLIQILSRRTKNNPILVGEPGIGKTSIVEGLAFSIINENVPHDLLN 239

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAID 1296
            K +++LD+G ++AGTKYRG+FEERLK+++ EIK++  IILFIDE+HTLIG G ++GA+D
Sbjct: 240  KSIVSLDLGSVIAGTKYRGQFEERLKQIINEIKENKNIILFIDEIHTLIGTGGSQGAMD 298



>gb:HPCLPB_137553 H.pylori clpB gene.
          Length = 856

 Score =  184 bits (468), Expect = 3e-45
 Identities = 87/136 (63%), Positives = 115/136 (84%)
 Frame = +1

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
            + +LE++G +LT+ A E KLDPV+GR ++I R+ QIL R+TKNNP L+GEPGVGKTA+ E
Sbjct: 156  LESLEKFGIDLTQKALENKLDPVIGRDEEIIRMMQILIRKTKNNPILLGEPGVGKTAVVE 215

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFID 1248
            GLAQRI N +VP+T+  K+VI LD+ LLVAG KYRGEFEERLKK++EE+K+S  +ILFID
Sbjct: 216  GLAQRIVNKEVPKTLLNKRVIALDLSLLVAGAKYRGEFEERLKKVIEEVKKSANVILFID 275

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HT++GAGA+EG +D
Sbjct: 276  EIHTIVGAGASEGGMD 291



>sp|P53533|CLPB_SYNP7 ClpB protein.>gb:SSU20646_191420 Synechococcus
            sp. PCC 7942 heat shock protein ClpB (clpB) gene,
            complete cds.
          Length = 883

 Score =  184 bits (468), Expect = 3e-45
 Identities = 88/138 (63%), Positives = 114/138 (82%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT++A  GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIA
Sbjct: 168  KYEALEKYGRDLTEMARRGKLDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIA 227

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDE-IILF 1242
            EGLAQRI NGDVP++++ +++I LDMG L+AG K+RGEFEERL  +++E+  S+  IILF
Sbjct: 228  EGLAQRIINGDVPQSLKDRRLIALDMGALIAGAKFRGEFEERLTAVLKEVTDSEGIIILF 287

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +G++D
Sbjct: 288  IDEMHTVVGAGAVQGSMD 305



>gb:AC133398_1741455 Oryza sativa chromosome 3 BAC OSJNBa0083F15
            genomic sequence, complete sequence.
          Length = 736

 Score =  184 bits (467), Expect = 3e-45
 Identities = 87/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++YG +LT +A +GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAIAEGLA
Sbjct: 2    LDKYGKDLTAMARQGKLDPVIGRDDEIRRCIQILSRRTKNNPVLIGEPGVGKTAIAEGLA 61

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVP+ +  +++I LDMG L+AG KYRGEFE+RLK +++E+  SD + ILFIDE+
Sbjct: 62   QRIVQGDVPQALTNRRLIALDMGALIAGAKYRGEFEDRLKAVLKEVTDSDGQTILFIDEI 121

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAGA  GA+D
Sbjct: 122  HTVVGAGATNGAMD 135



>gb:AE006206_216592 Pasteurella multocida subsp. multocida str. Pm70
            section 173 of 204 of the complete
            genome.>gb:AE004439_1119322 Pasteurella multocida subsp.
            multocida str. Pm70, complete genome.
          Length = 855

 Score =  184 bits (467), Expect = 3e-45
 Identities = 114/301 (37%), Positives = 161/301 (53%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+FT K  + +  AQ  A    + F+                 A +L + G NL   R E
Sbjct: 4    EKFTTKFQQALQEAQSLAIGKDNQFIEPVHLLTALLNQQGGSTAPILTASGANLPLLRNE 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +   + +     GSG    ++  +     +L L  + A+Q    +I S            
Sbjct: 64   LNAELSKLPQVSGSGG---DVQVSRSLVNLLNLCDKLAQQRQDKFISSELFLLAALEDKT 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
                 VL+  G    N++  + ++                  +    LE+Y  +LT  AE
Sbjct: 121  L--GDVLKKCGVKKENLQQAIEKVRGGQNVNDPNAE------ESRQALEKYTIDLTARAE 172

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
             GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 173  SGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 232

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+V++LDMG L+AG KYRGEFEERLK ++ E+ K+   +ILFIDE+HT++GAG  +GA+
Sbjct: 233  NKRVLSLDMGALIAGAKYRGEFEERLKAVLNELSKEEGRVILFIDEIHTMVGAGKTDGAM 292

Query: 1294 D 1296
            D
Sbjct: 293  D 293



>gb:CR925677_117922 Ehrlichia ruminantium str. Gardel, complete
            genome.
          Length = 863

 Score =  184 bits (467), Expect = 3e-45
 Identities = 112/302 (37%), Positives = 164/302 (54%), Gaps = 8/302 (2%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FT+ +   I+ AQ  A  LGH  +                   +L S G +++  R +V
Sbjct: 9    KFTDISKNFIVQAQTSAVALGHQSLVPEHLLKVMLDDKDEIVEVLLTSCGCDVETLRNDV 68

Query: 595  EKII-------GRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
               +       G GSG     I  +    +VL+ ++  A++   +Y+             
Sbjct: 69   VSALNKLPVVSGPGSG----HIHLSKEMAQVLQEAVNLAKRHQDSYVTVERLLQALTIIK 124

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                +R+L   G  P  + + ++ M                  Q+   L++Y  ++T++A
Sbjct: 125  DSNVSRILIAHGVTPQKLESLIVNMRNGAKADSVNSE------QRFNALKKYAKDVTEVA 178

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA +I  GDVP  +
Sbjct: 179  RAGKLDPVIGRDEEIRRTIQVLLRRTKNNPVLIGEPGVGKTAIIEGLAHKIVKGDVPIGL 238

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGA 1290
               ++++LD+G+LVAGTKYRGEFEERLK ++ EI  S+  IILFIDE+HTL+GAGA +GA
Sbjct: 239  RDMRIMSLDLGMLVAGTKYRGEFEERLKAVVNEIVSSNGSIILFIDELHTLVGAGATDGA 298

Query: 1291 ID 1296
            +D
Sbjct: 299  MD 300



>sp|P71404|CLPB_HELPY ClpB protein.>pir|H64552|H64552 endopeptidase
            Clp ATP-binding chain B - Helicobacter pylori  (strain
            26695)>gb:AE000545_24441 Helicobacter pylori 26695
            section 23 of 134 of the complete
            genome.>gb:AE000511_879880 Helicobacter pylori 26695
            complete genome.
          Length = 856

 Score =  184 bits (467), Expect = 3e-45
 Identities = 87/136 (63%), Positives = 115/136 (84%)
 Frame = +1

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
            + +LE++G +LT+ A E KLDPV+GR ++I R+ QIL R+TKNNP L+GEPGVGKTA+ E
Sbjct: 156  LESLEKFGIDLTQKALENKLDPVIGRDEEIIRMMQILIRKTKNNPILLGEPGVGKTAVVE 215

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFID 1248
            GLAQRI N +VP+T+  K+VI LD+ LLVAG KYRGEFEERLKK++EE+K+S  +ILFID
Sbjct: 216  GLAQRIMNKEVPKTLLNKRVIALDLSLLVAGAKYRGEFEERLKKVIEEVKKSANVILFID 275

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HT++GAGA+EG +D
Sbjct: 276  EIHTIVGAGASEGGMD 291



>sp|Q9ZMH1|CLPB_HELPJ ClpB protein.>pir|C71956|C71956 probable
            endopeptidase Clp ATP-binding chain - Helicobacter pylori
            (strain J99)>gb:AE001462_35243 Helicobacter pylori,
            strain J99 section 23 of 132 of the complete
            genome.>gb:AE001439_884013 Helicobacter pylori, strain
            J99 complete genome.
          Length = 856

 Score =  184 bits (467), Expect = 3e-45
 Identities = 86/136 (63%), Positives = 115/136 (84%)
 Frame = +1

Query: 889  MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAE 1068
            + +LE++G +LT+ A E KLDPV+GR ++I R+ QIL R+TKNNP L+GEPGVGKTA+ E
Sbjct: 156  LESLEKFGIDLTQKALENKLDPVIGRDEEIIRMMQILIRKTKNNPILLGEPGVGKTAVVE 215

Query: 1069 GLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFID 1248
            GLAQRI N +VP+T+  K+V+ LD+ LLVAG KYRGEFEERLKK++EE+K+S  +ILFID
Sbjct: 216  GLAQRIVNKEVPKTLLNKRVVALDLSLLVAGAKYRGEFEERLKKVIEEVKKSANVILFID 275

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HT++GAGA+EG +D
Sbjct: 276  EIHTIVGAGASEGGMD 291



>sp|P44403|CLPB_HAEIN ClpB protein.>pir|F64098|F64098 endopeptidase
            Clp (EC 3.4.21.-) ATP-binding chain [similarity] -
            Haemophilus influenzae (strain Rd KW20)>gb:U32767_204531
            Haemophilus influenzae Rd KW20 section 82 of 163 of the
            complete genome.>gb:L42023_1097080 Haemophilus influenzae
            Rd KW20 complete genome.
          Length = 856

 Score =  184 bits (467), Expect = 3e-45
 Identities = 112/303 (36%), Positives = 163/303 (53%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+FT K  + +   Q  A    + F+                 A +L + G+N+   R E
Sbjct: 4    EKFTTKFQEALSERQSLAIGKDNQFIEPVHLLTALLNQQGGSIAPILTASGVNVALLRNE 63

Query: 592  VE-------KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
            ++       ++IG G      ++  + +   +L L  + A+Q    +I S          
Sbjct: 64   LKTELNKLPQVIGNGG-----DVQLSRQLINLLNLCDKFAQQNQDKFISSELFLFAALEE 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
               ++  +L+  GA    I   +  +                  +    LE+Y  +LT  
Sbjct: 119  RGTISD-ILKKCGAKKEQISQAIQHIRGGQNVNDQNAE------ESRQALEKYTIDLTAR 171

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            AE GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE 
Sbjct: 172  AESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEG 231

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEG 1287
            ++ K+V++LDMG L+AG KYRGEFEERLK ++ E+ K+   +ILFIDE+HT++GAG  +G
Sbjct: 232  LKNKRVLSLDMGALIAGAKYRGEFEERLKAVLNELSKEEGRVILFIDEIHTMVGAGKTDG 291

Query: 1288 AID 1296
            A+D
Sbjct: 292  AMD 294



>gb:AY070722_1566874 Arabidopsis thaliana At2g25140/F13D4.100 mRNA,
            complete cds.>gb:BT002223_1635826 Arabidopsis thaliana
            At2g25140/F13D4.100 mRNA, complete cds.
          Length = 964

 Score =  184 bits (466), Expect = 5e-45
 Identities = 89/138 (64%), Positives = 113/138 (81%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT++A  GKLDPV+GR D+I R  QIL RRTKNNP +IGEPGVGKTAIA
Sbjct: 238  KYQALEKYGNDLTEMARRGKLDPVIGRDDEIRRCIQILCRRTKNNPVIIGEPGVGKTAIA 297

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVPE +  +K+I+LDMG L+AG K+RG+FEERLK +M+E+  S+ + ILF
Sbjct: 298  EGLAQRIVRGDVPEPLMNRKLISLDMGSLLAGAKFRGDFEERLKAVMKEVSASNGQTILF 357

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 358  IDEIHTVVGAGAMDGAMD 375



>gb:AF076980_476899 Streptomyces albus G heat shock protein ClpB
            (clpB) gene, complete cds.
          Length = 857

 Score =  184 bits (466), Expect = 5e-45
 Identities = 86/134 (64%), Positives = 112/134 (83%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++GT+ T  A E KLDPV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTA+ EGLA
Sbjct: 162  LEKFGTDFTAAARERKLDPVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLA 221

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE+++ K++++LD+G +VAG KYRGEFEERLK ++ EIK+SD +I+ FIDE+
Sbjct: 222  QRIVKGDVPESLKDKRLVSLDLGAMVAGAKYRGEFEERLKTVLSEIKESDGQIVTFIDEL 281

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAGAA+ A+D
Sbjct: 282  HTVVGAGAADSAMD 295



>pir|G84644|G84644 probable ATP-dependent CLPB protein [imported] -
            Arabidopsis thaliana
          Length = 874

 Score =  184 bits (466), Expect = 5e-45
 Identities = 89/138 (64%), Positives = 113/138 (81%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT++A  GKLDPV+GR D+I R  QIL RRTKNNP +IGEPGVGKTAIA
Sbjct: 148  KYQALEKYGNDLTEMARRGKLDPVIGRDDEIRRCIQILCRRTKNNPVIIGEPGVGKTAIA 207

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVPE +  +K+I+LDMG L+AG K+RG+FEERLK +M+E+  S+ + ILF
Sbjct: 208  EGLAQRIVRGDVPEPLMNRKLISLDMGSLLAGAKFRGDFEERLKAVMKEVSASNGQTILF 267

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA +GA+D
Sbjct: 268  IDEIHTVVGAGAMDGAMD 285



>pir|D83077|D83077 ClpB protein PA4542 [imported] - Pseudomonas
            aeruginosa  (strain PAO1)>gb:AE004868_58777 Pseudomonas
            aeruginosa PAO1, section 429 of 529 of the complete
            genome.>gb:AY273871_605036 Pseudomonas aeruginosa PA14
            tRNA-Lys, tRNA-Pro, and tRNA-Asn genes, complete
            sequence; and ClpB (clpB), conserved hypothetical
            protein, pseudouridine synthase (rluD), competence
            protein (comL), putative D-amino acid oxidase (dadA), and
            drug tolerance protein (lytB) genes, complete cds; and
            pilus gene cluster, complete sequence.>gb:AE004091_972877
            Pseudomonas aeruginosa PAO1, complete genome.
          Length = 854

 Score =  183 bits (465), Expect = 6e-45
 Identities = 87/134 (64%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  ++TK AEEGKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LDKYTVDMTKRAEEGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI NG+VP+ ++ K+++ LDMG L+AG K+RGEFEERLK ++ E+ KQ   +ILFIDE+
Sbjct: 221  QRIINGEVPDGLKDKRLLALDMGALIAGAKFRGEFEERLKAVLNELGKQEGRVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 281  HTMVGAGKAEGAMD 294



>gb:BX950851_842080 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 858

 Score =  183 bits (464), Expect = 8e-45
 Identities = 109/298 (36%), Positives = 160/298 (53%), Gaps = 3/298 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            +R T K    +  AQ  +    H F+                   +L   G NL   + E
Sbjct: 4    DRLTNKFQLALADAQSLSLGRDHQFIEPLHLMSALLHQAGGTVGPLLTVAGANLNHLKAE 63

Query: 592  VEKIIGRGSGFVAVEIPFTPRAKRVLELSLEE--ARQLGHNYIGSXXXXXXXXXXXXXVA 765
            +++ I R       +    P  + V  L++ +  A++ G  +I S             + 
Sbjct: 64   IDQAITRLPQVEGTDGDVQPSNELVRALNMCDKLAQKRGDTFISSELFVLAALESRGTLG 123

Query: 766  ARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGK 945
              +L+  G     +   + ++                   +   L+++  +LT+ AE+GK
Sbjct: 124  D-ILKKAGVTQQGVTNAIDQVRGGDQVNDQGAE------DQRQALKKFTIDLTERAEQGK 176

Query: 946  LDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKK 1125
            LDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++ K+
Sbjct: 177  LDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLKNKR 236

Query: 1126 VITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            V++LDMG LVAG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 237  VLSLDMGALVAGAKYRGEFEERLKGVLNDLSKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:AE017164_395538 Prochlorococcus marinus subsp. marinus str.
            CCMP1375 section 4 of 6 of the complete
            genome.>gb:AE017126_1031207 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 864

 Score =  183 bits (464), Expect = 8e-45
 Identities = 88/138 (63%), Positives = 110/138 (79%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K  +L++YG +LT  A EG LDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI 
Sbjct: 158  KYESLKKYGRDLTSAAREGILDPVIGRDDEIRRTIQILSRRTKNNPVLIGEPGVGKTAIV 217

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI NGDVP  ++ +++I LDMG L+AG KYRGEFEERLK +++E+  S  +I+LF
Sbjct: 218  EGLAQRIINGDVPSALQNRQLIALDMGALIAGAKYRGEFEERLKAVLKEVTSSQGQIVLF 277

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA  GA+D
Sbjct: 278  IDEIHTVVGAGATGGAMD 295



>sp|O83110|CLPB_TREPA ClpB protein.>pir|G71371|G71371 probable
            endopeptidase Clp ATP-binding chain B - syphilis
            spirochete>gb:AE001191_32901 Treponema pallidum subsp.
            pallidum str. Nichols section 7 of 87 of the complete
            genome.>gb:AE000520_1049129 Treponema pallidum subsp.
            pallidum str. Nichols complete genome.
          Length = 878

 Score =  183 bits (464), Expect = 8e-45
 Identities = 87/134 (64%), Positives = 116/134 (86%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  +LT LA E K+DPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LEKYCRDLTTLAREEKIDPVIGRDEEIRRVMQVLSRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            +RI +GDVPE+++GK++++LD+G LVAG K+RGEFEERLK ++E +++SD  +ILFIDE+
Sbjct: 221  RRIVSGDVPESLKGKRLLSLDLGALVAGAKFRGEFEERLKAVIEAVQKSDGGVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAGA+EG++D
Sbjct: 281  HTLVGAGASEGSMD 294



>gb:BX640447_815939 Bordetella bronchiseptica strain RB50, complete
            genome; segment 11/16.
          Length = 865

 Score =  182 bits (463), Expect = 1e-44
 Identities = 113/301 (37%), Positives = 158/301 (52%), Gaps = 5/301 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F++ T K  + +  AQ  A R  H ++                AA +L   G+ +   + 
Sbjct: 3    FDKLTTKFQQALADAQSLAARNDHPYIEPVHVLAALLGDPDSGAASLLARAGVAVNRVQP 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSL----EEARQLGHNYIGSXXXXXXXXXXXX 756
             ++  +    G   V+     +  R L+  L    +EA + G  YI S            
Sbjct: 63   AIDSAL---KGLPQVQGEDNVQVGRELQSVLVRTDKEAARRGDTYIASELFLLALADDKG 119

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
              A R+L   G     +   +                          L +Y  +LT+ A 
Sbjct: 120  D-AGRILREAGLQKKALEAAI------DAVRGGENVSGAEGESNREALSKYTLDLTERAR 172

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLAQRI N +VPET+ 
Sbjct: 173  QGKLDPVIGRDDEIRRTIQILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNDEVPETLR 232

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
            GK+V++LD+  L+AG K+RGEFEERLK +++E+ Q D + I+FIDE+HT++GAG AEGA+
Sbjct: 233  GKRVLSLDLAALLAGAKFRGEFEERLKAVLKELAQDDGQNIVFIDELHTMVGAGKAEGAM 292

Query: 1294 D 1296
            D
Sbjct: 293  D 293



>gb:BX640428_810068 Bordetella parapertussis strain 12822, complete
            genome; segment 6/14.
          Length = 865

 Score =  182 bits (463), Expect = 1e-44
 Identities = 113/301 (37%), Positives = 158/301 (52%), Gaps = 5/301 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F++ T K  + +  AQ  A R  H ++                AA +L   G+ +   + 
Sbjct: 3    FDKLTTKFQQALADAQSLAARNDHPYIEPVHVLAALLGDPDSGAASLLARAGVAVNRVQP 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSL----EEARQLGHNYIGSXXXXXXXXXXXX 756
             ++  +    G   V+     +  R L+  L    +EA + G  YI S            
Sbjct: 63   AIDSAL---KGLPQVQGEDNVQVGRELQSVLVRTDKEAARRGDTYIASELFLLALADDKG 119

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
              A R+L   G     +   +                          L +Y  +LT+ A 
Sbjct: 120  D-AGRILREAGLQKKALEAAI------DAVRGGENVSGAEGESNREALSKYTLDLTERAR 172

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLAQRI N +VPET+ 
Sbjct: 173  QGKLDPVIGRDDEIRRTIQILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNDEVPETLR 232

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
            GK+V++LD+  L+AG K+RGEFEERLK +++E+ Q D + I+FIDE+HT++GAG AEGA+
Sbjct: 233  GKRVLSLDLAALLAGAKFRGEFEERLKAVLKELAQDDGQNIVFIDELHTMVGAGKAEGAM 292

Query: 1294 D 1296
            D
Sbjct: 293  D 293



>gb:SPU97124_189704 Synechococcus PCC 7942 heat shock protein
            ClpB/HSP100 (clpB2) gene, complete
            cds.>gb:AP008231_580583 Synechococcus elongatus PCC 6301
            DNA, complete genome.
          Length = 895

 Score =  182 bits (463), Expect = 1e-44
 Identities = 110/292 (37%), Positives = 163/292 (55%), Gaps = 2/292 (0%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            RFT++A   I+ +Q  AR+L    +                AA++L   G+ + + R  +
Sbjct: 8    RFTDQAWDAIVESQTVARQLRQQQLEVEHVLLALLDQESGVAAEILAKAGVAVANLRQPL 67

Query: 595  EKIIGRGSGFVAVEIPFTPRA-KRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAAR 771
            E    R     +    +  R   R+L+L+ E AR+L  +                 +  R
Sbjct: 68   EDFARRQPRNASGTQLYLGRGLDRLLDLA-ERARELWQDEFIGVEHLLMGFVEDDRIGRR 126

Query: 772  VLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLD 951
            + + L  D   + T +  +                     P L +YG +LT LAE+ KLD
Sbjct: 127  LAQGLKLDAKTLETTIQALRSPAADEAEAEESE----PSYPFLSKYGRDLTALAEQEKLD 182

Query: 952  PVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVI 1131
            PV+GR  +I RV Q+L RR+KNNP LIGEPGVGKTAIAEGLAQRI  G+VP++++ +++I
Sbjct: 183  PVIGRDLEIRRVIQVLSRRSKNNPVLIGEPGVGKTAIAEGLAQRIVAGEVPDSLKQRRLI 242

Query: 1132 TLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAE 1284
            +LDMG L+AG KYRGEFEERL+ ++ E+  SD +++LFIDE+HT++GAGA +
Sbjct: 243  SLDMGSLIAGAKYRGEFEERLRAVLHEVTHSDGQMVLFIDELHTVVGAGAGQ 294



>gb:CR555306_109215 Azoarcus sp. EbN1 complete genome.
          Length = 860

 Score =  182 bits (463), Expect = 1e-44
 Identities = 114/302 (37%), Positives = 159/302 (52%), Gaps = 6/302 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F++ T K  + +  AQ  A      F+                   +L+  G+N+   + 
Sbjct: 3    FDKLTTKFQQALSDAQSIAVGNDQQFIEPQHLLLAMLGQEDAGIVSLLQRAGVNVPPLKA 62

Query: 589  EVEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
             ++K + R     G G    E+        +L ++  EA++ G  +I S           
Sbjct: 63   ALDKALTRLPKVEGHGG---EVQIGRDLSNLLNIADREAQKRGDQFIASEMFLLALAEDK 119

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                 R+L+  G     +   +  +                   +   L +Y  +LT  A
Sbjct: 120  GETG-RLLKEHGLSRKPLEAAITAVRGGSGVGSQDAEG------QREALNKYCLDLTDRA 172

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLAQRI N +VPET+
Sbjct: 173  RAGKLDPVIGRDDEIRRAIQILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNDEVPETL 232

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGA 1290
            +GK+V++LDM  L+AG KYRGEFEERLK +++EI Q +  II+FIDE+HT++GAG AEGA
Sbjct: 233  KGKRVLSLDMAALLAGAKYRGEFEERLKAVLKEIAQEEGRIIVFIDELHTMVGAGKAEGA 292

Query: 1291 ID 1296
            ID
Sbjct: 293  ID 294



>gb:AE015794_317905 Shewanella oneidensis MR-1 section 343 of 457 of
            the complete genome.>gb:AE014299_953502 Shewanella
            oneidensis MR-1 complete genome.
          Length = 857

 Score =  182 bits (462), Expect = 1e-44
 Identities = 86/134 (64%), Positives = 112/134 (83%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L+++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LKKFTVDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI NG+VPE I+ K+V++LDMG L+AG KYRGEFEERLK ++ E+ Q + ++ILFIDE+
Sbjct: 221  QRIVNGEVPEGIKNKRVLSLDMGALIAGAKYRGEFEERLKAVLNELAQEEGQVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  +GA+D
Sbjct: 281  HTMVGAGKGDGAMD 294



>gb:AE010496_263741 Fusobacterium nucleatum subsp. nucleatum ATCC
            25586, section 38 of 197 of the complete
            genome.>gb:AE009951_910909 Fusobacterium nucleatum subsp.
            nucleatum ATCC 25586, complete genome.
          Length = 864

 Score =  182 bits (462), Expect = 1e-44
 Identities = 84/134 (62%), Positives = 112/134 (83%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE+Y  +L +LA EGK+DP++GR  +I R  QI+ RRTKN+P LIGEPGVGKTAI EGLA
Sbjct: 166  LEKYAKDLVELAREGKIDPIIGRDSEIRRAIQIISRRTKNDPILIGEPGVGKTAIVEGLA 225

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI NGDVPE+++ KK+ +LDMG LVAG KY+GEFEER+K +++E+++S+  IILFIDE+
Sbjct: 226  QRILNGDVPESLKNKKIFSLDMGALVAGAKYKGEFEERMKGVLKEVEESNGNIILFIDEI 285

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 286  HTIVGAGKGEGSLD 299



>gb:AE004969_60747 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 859

 Score =  182 bits (462), Expect = 1e-44
 Identities = 109/304 (35%), Positives = 161/304 (52%), Gaps = 8/304 (2%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            +++ T K  + +  AQ  A     +++                AA +L   G+N+   + 
Sbjct: 3    YDKLTAKFQQALAEAQSLALAADSSYLEAGFVLKALLDDQNSGAAALLAHAGVNVPQVKQ 62

Query: 589  EVE-------KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXX 747
             ++       K+ G+G      EI  +   + VL L  + A + G  YI S         
Sbjct: 63   RLQQHLNSLPKVSGQGG-----EILPSRELQAVLNLMDKAATKRGDAYIASELFLLALVQ 117

Query: 748  XXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTK 927
                 A ++L+  GA   NI   +                      +   L++Y  +LT+
Sbjct: 118  QNDA-AGKILKEAGATEQNINAAI------DAVRGGQNVNDANAEDQRDALKKYTLDLTQ 170

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE
Sbjct: 171  RARDGKLDPVIGRDDEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPE 230

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAE 1284
            ++  K+++ LD+  L+AG KYRGEFEERLK ++ ++ + D   ++FIDE+HTL+GAG  +
Sbjct: 231  SLRNKRLLVLDLAALIAGAKYRGEFEERLKGVLNDLAKDDGNTLIFIDEIHTLVGAGKTD 290

Query: 1285 GAID 1296
            GA+D
Sbjct: 291  GAMD 294



>sp|P33416|HSP7_YEAST Heat shock protein 78, mitochondrial
            precursor.>pir|S67315|S67315 endopeptidase Clp
            ATP-binding chain precursor, mitochondrial - yeast
            (Saccharomyces cerevisiae)>gb:SC9320A_1705809
            S.cerevisiae chromosome IV cosmid
            9320A.>gb:SC9320X_1705826 S.cerevisiae chromosome IV
            cosmid 9320X.
          Length = 811

 Score =  182 bits (462), Expect = 1e-44
 Identities = 85/136 (62%), Positives = 112/136 (82%), Gaps = 1/136 (0%)
 Frame = +1

Query: 892  PTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEG 1071
            P LE++GTNLTKLA +GKLDPV+GR ++I R  QIL RRTKNNPCLIG  GVGKTA+ +G
Sbjct: 96   PALEQFGTNLTKLARDGKLDPVIGRDEEIARAIQILSRRTKNNPCLIGRAGVGKTALIDG 155

Query: 1072 LAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFID 1248
            LAQRI  G+VP++++ K ++ LD+G L+AG KYRGEFEERLKK++EEI K + ++I+FID
Sbjct: 156  LAQRIVAGEVPDSLKDKDLVALDLGSLIAGAKYRGEFEERLKKVLEEIDKANGKVIVFID 215

Query: 1249 EVHTLIGAGAAEGAID 1296
            EVH L+G G  +G++D
Sbjct: 216  EVHMLLGLGKTDGSMD 231



>gb:AF449501_1800726 Paracoccidioides brasiliensis ClpB ATP protease
            gene, complete cds.
          Length = 792

 Score =  182 bits (461), Expect = 2e-44
 Identities = 87/135 (64%), Positives = 112/135 (82%), Gaps = 1/135 (0%)
 Frame = +1

Query: 895  TLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGL 1074
            +L +Y  +LT+ A  GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGL
Sbjct: 90   SLNKYTVDLTERALAGKLDPVIGRDDEIRRTVQVLSRRTKNNPVLIGEPGVGKTAIVEGL 149

Query: 1075 AQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDE 1251
            AQRI NG+VPE+++GK+V++LD+G L+AG KYRGEFEERLK +++++ K   EIILFIDE
Sbjct: 150  AQRIVNGEVPESLKGKRVLSLDLGSLLAGAKYRGEFEERLKAVLKDLAKHEGEIILFIDE 209

Query: 1252 VHTLIGAGAAEGAID 1296
            +HTL+GAG  +GA+D
Sbjct: 210  LHTLVGAGKGDGAMD 224



>gb:BX571863_786128 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 5/17.
          Length = 857

 Score =  181 bits (460), Expect = 2e-44
 Identities = 112/290 (38%), Positives = 163/290 (56%), Gaps = 5/290 (1%)
 Frame = +1

Query: 442  IMLAQEEARRLGHN--FVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEVEKIIGRG 615
            + LA  ++  LGH+  F+                   +L S+GI+      ++E  + R 
Sbjct: 12   LALADAQSFALGHDNQFIEPIHLMSSLLKQEGGSIRPLLTSIGIDAGRFSNQLELALERL 71

Query: 616  SGFVAVEIPFTPRAKRVLELSLEE--ARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLG 789
                 +     P    V  L+L +  A++ G N+I S             ++  +L+ +G
Sbjct: 72   PRVQGIGGDVQPSNDLVRHLNLCDKLAQKAGDNFISSELFVLAALEERGTLSD-ILKAVG 130

Query: 790  ADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQ 969
            A    I   + +M                   +   L++Y  +LT+ AE+GKLDPV+GR 
Sbjct: 131  ATKEKITKAIEQMRGGEKVDDQGAE------DQRQALKKYTIDLTERAEQGKLDPVIGRD 184

Query: 970  DQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGL 1149
            ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++ K+V++LDMG 
Sbjct: 185  EEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKNKRVLSLDMGA 244

Query: 1150 LVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAID 1296
            L+AG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG A+GA+D
Sbjct: 245  LLAGAKYRGEFEERLKGVLNDLAKQEGNVILFIDELHTMVGAGKADGAMD 294



>gb:AE014291_309273 Brucella suis 1330 chromosome I, complete
            sequence.>gb:BSU251205_751490 Brucella suis clpB gene for
            ClpB protein.
          Length = 874

 Score =  181 bits (460), Expect = 2e-44
 Identities = 109/302 (36%), Positives = 161/302 (53%), Gaps = 7/302 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E++TE+    I  AQ  A   G+                   AA +++  G  + D R+ 
Sbjct: 4    EKYTERVRGFIQSAQTFALSSGNQQFTPEHILKVLIDDDEGLAASLVERAGGRVGDVRMG 63

Query: 592  VEKIIGR------GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
            ++  + +      G+  + +  P      +V  L+ E A + G +++             
Sbjct: 64   LQSALEKLPKVSGGNDQLYLSQPLA----KVFSLAEELASKAGDSFVTVERLLTALAMEK 119

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                + +L   G  P+ +   +  M                       L++Y  +LT+ A
Sbjct: 120  SAKTSEILSAAGVTPTALNRVINDMRKGRTADSASAES------NYDALKKYARDLTEDA 173

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI NGDVPE++
Sbjct: 174  RAGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPESL 233

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEGA 1290
            + K+++ LDMG L+AG KYRGEFEERLK ++ E++  + +IILFIDE+HTL+GAG  +GA
Sbjct: 234  KDKQLMALDMGALIAGAKYRGEFEERLKAVLSEVQTAAGQIILFIDEMHTLVGAGKTDGA 293

Query: 1291 ID 1296
            +D
Sbjct: 294  MD 295



>gb:AE013598_295038 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 898

 Score =  181 bits (460), Expect = 2e-44
 Identities = 86/139 (61%), Positives = 114/139 (82%), Gaps = 1/139 (0%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            ++   LE+Y  +LT  AE GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI
Sbjct: 193  EQRQALEKYTIDLTARAESGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAI 252

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIIL 1239
             EGLAQRI NG+VPE + GK+V++LDMG L+AG K+RGEFEERLK ++ ++ +++ +IIL
Sbjct: 253  VEGLAQRIINGEVPEGLRGKRVLSLDMGALIAGAKFRGEFEERLKAVLSDLSKTEGQIIL 312

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAG A+GA+D
Sbjct: 313  FIDELHTMVGAGKADGAMD 331



>gb:AE012421_282297 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 329 of 460 of the complete
            genome.>gb:AE008922_915579 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 861

 Score =  181 bits (460), Expect = 2e-44
 Identities = 87/139 (62%), Positives = 112/139 (80%), Gaps = 1/139 (0%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            ++   LE+Y  +LT  AE GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI
Sbjct: 156  EQRQALEKYTIDLTARAESGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAI 215

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIIL 1239
             EGLAQRI NG+VPE + GK+V++LDMG L+AG K+RGEFEERLK ++ ++ K   +IIL
Sbjct: 216  VEGLAQRIINGEVPEGLRGKRVLSLDMGALIAGAKFRGEFEERLKAVLSDLSKNEGQIIL 275

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAG A+GA+D
Sbjct: 276  FIDELHTMVGAGKADGAMD 294



>gb:AE011965_278110 Xanthomonas axonopodis pv. citri str. 306, section
            343 of 469 of the complete genome.>gb:AE008923_919885
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 871

 Score =  181 bits (460), Expect = 2e-44
 Identities = 87/139 (62%), Positives = 112/139 (80%), Gaps = 1/139 (0%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            ++   LE+Y  +LT  AE GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI
Sbjct: 166  EQRQALEKYTIDLTARAESGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAI 225

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIIL 1239
             EGLAQRI NG+VPE + GK+V++LDMG L+AG K+RGEFEERLK ++ ++ K   +IIL
Sbjct: 226  VEGLAQRIINGEVPEGLRGKRVLSLDMGALIAGAKFRGEFEERLKAVLSDLSKNEGQIIL 285

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDE+HT++GAG A+GA+D
Sbjct: 286  FIDELHTMVGAGKADGAMD 304



>pir|AF3276|AF3276 ATP-dependent clp proteinase, ATP-binding chain
            clpb BMEI0195 [imported] - Brucella melitensis (strain
            16M)>gb:AE009461_252114 Brucella melitensis 16M
            chromosome I, section 18 of 195 of the complete
            sequence.>gb:AE008917_978026 Brucella melitensis 16M
            chromosome I, complete sequence.
          Length = 931

 Score =  181 bits (460), Expect = 2e-44
 Identities = 109/302 (36%), Positives = 161/302 (53%), Gaps = 7/302 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E++TE+    I  AQ  A   G+                   AA +++  G  + D R+ 
Sbjct: 61   EKYTERVRGFIQSAQTFALSSGNQQFTPEHILKVLIDDDEGLAASLVERAGGRVGDVRMG 120

Query: 592  VEKIIGR------GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
            ++  + +      G+  + +  P      +V  L+ E A + G +++             
Sbjct: 121  LQSALEKLPKVSGGNDQLYLSQPLA----KVFSLAEELASKAGDSFVTVERLLTALAMEK 176

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                + +L   G  P+ +   +  M                       L++Y  +LT+ A
Sbjct: 177  SAKTSEILSAAGVTPTALNRVINDMRKGRTADSASAES------NYDALKKYARDLTEDA 230

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
              GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEGLA RI NGDVPE++
Sbjct: 231  RAGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIAEGLALRIVNGDVPESL 290

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEGA 1290
            + K+++ LDMG L+AG KYRGEFEERLK ++ E++  + +IILFIDE+HTL+GAG  +GA
Sbjct: 291  KDKQLMALDMGALIAGAKYRGEFEERLKAVLSEVQTAAGQIILFIDEMHTLVGAGKTDGA 350

Query: 1291 ID 1296
            +D
Sbjct: 351  MD 352



>pir|C70445|C70445 ATPase subunit of ATP-dependent proteinase (EC
            3.4.-.-) - Aquifex aeolicus>gb:AE000750_26942 Aquifex
            aeolicus VF5 section 82 of 109 of the complete
            genome.>gb:AE000657_977473 Aquifex aeolicus VF5 complete
            genome.
          Length = 1006

 Score =  181 bits (460), Expect = 2e-44
 Identities = 85/138 (61%), Positives = 114/138 (82%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            +K P LE +G NL +LA +GKLDPV+GR+ +I +V +IL RRTKNNP L+G+PGVGKTAI
Sbjct: 291  EKSP-LERFGVNLNELARQGKLDPVIGREREINQVIEILLRRTKNNPVLVGDPGVGKTAI 349

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 1242
             EGLAQRI N +VP  ++ K++ ++DM  L+AG+KYRGEFEERLK L++E+K+   +ILF
Sbjct: 350  VEGLAQRIVNKEVPPELQDKEIWSIDMASLLAGSKYRGEFEERLKALLDEVKEKGNVILF 409

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGAAEGA+D
Sbjct: 410  IDEIHTVVGAGAAEGAVD 427



>gb:BX640414_805622 Bordetella pertussis strain Tohama I, complete
            genome; segment 4/12.
          Length = 865

 Score =  181 bits (459), Expect = 3e-44
 Identities = 113/301 (37%), Positives = 157/301 (52%), Gaps = 5/301 (1%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            F++ T K  + +  AQ  A R  H ++                AA +L   G+ +   + 
Sbjct: 3    FDKLTTKFQQALADAQSLAARNDHPYIEPVHVLAALLGDPDSGAASLLARAGVAVNRVQP 62

Query: 589  EVEKIIGRGSGFVAVEIPFTPRAKRVLELSL----EEARQLGHNYIGSXXXXXXXXXXXX 756
             ++  +    G   V+     +  R L+  L    +EA + G  YI S            
Sbjct: 63   AIDSAL---KGLPQVQGDDNVQVGRELQSVLVRTDKEAARRGDTYIASELFLLALADDKG 119

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
              A R+L   G     +   +                          L +Y  +LT+ A 
Sbjct: 120  D-AGRILREAGLQKKALEAAI------DAVRGGENVSGAEGESNREALSKYTLDLTERAR 172

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLAQRI N +VPET+ 
Sbjct: 173  QGKLDPVIGRDDEIRRTIQILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNDEVPETLR 232

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAI 1293
            GK+V++LD+  L+AG K+RGEFEERLK +++E+ Q D + I+FIDE+HT+ GAG AEGA+
Sbjct: 233  GKRVLSLDLAALLAGAKFRGEFEERLKAVLKELAQDDGQNIVFIDELHTMAGAGKAEGAM 292

Query: 1294 D 1296
            D
Sbjct: 293  D 293



>gb:AE016929_360266 Bacteroides thetaiotaomicron VPI-5482, section 4
            of 21 of the complete genome.>gb:AE015928_986754
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 841

 Score =  181 bits (459), Expect = 3e-44
 Identities = 108/325 (33%), Positives = 170/325 (52%), Gaps = 28/325 (8%)
 Frame = +1

Query: 406  MFERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDAR 585
            M  +F+++   +I+ ++EEA RL    +                A ++L  +  NL   +
Sbjct: 1    MNNQFSQRVSDIIVYSKEEANRLRSRHIGPEHLLLGMLRDGEGKAIEILSKLNTNLAAVK 60

Query: 586  VEVEKIIGRGSGFVAV---EIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
             ++E  +   +  + +   EIP +  A ++L++ + EAR +  N   +            
Sbjct: 61   QQIEARLKTEADDMLLPDAEIPLSNDAAKILKMCILEARGMKSNIADTEHVLLAILRERN 120

Query: 757  XVAARVLE---------------------NLGADPSNIRTQVIRMXXXXXXXXXXXXXXX 873
             +AA VLE                      +G    +   ++                  
Sbjct: 121  NMAASVLEANDVNYVKVLEQATLQPDVNSGMGFPEDDDDEEMSSPRSGGSGSEERQQQAQ 180

Query: 874  XXXQK----MPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEP 1041
               +K     P L+ +GT++TK AEEG+LDPVVGR+ +IER+ QIL RR KNNP LIGEP
Sbjct: 181  TASKKPANDTPVLDNFGTDMTKAAEEGRLDPVVGREKEIERLAQILSRRKKNNPILIGEP 240

Query: 1042 GVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ 1221
            GVGK+AI EGLA RI    V   +  K+V+ LDM  +VAGTKYRG+FEER++ ++ E+++
Sbjct: 241  GVGKSAIVEGLALRIIQKKVSRILFDKRVVALDMTAVVAGTKYRGQFEERIRSILNELQR 300

Query: 1222 SDEIILFIDEVHTLIGAGAAEGAID 1296
            +  +ILFIDE+HT++GAG+A G++D
Sbjct: 301  NPNVILFIDEIHTIVGAGSAAGSMD 325



>pir|F81863|F81863 ClpB protein NMA1683 [imported] - Neisseria
            meningitidis  (strain Z2491 serogroup
            A)>gb:NMA5Z2491_154567 Neisseria meningitidis serogroup A
            strain Z2491 complete genome; segment 5/7.
          Length = 859

 Score =  181 bits (459), Expect = 3e-44
 Identities = 107/304 (35%), Positives = 160/304 (52%), Gaps = 8/304 (2%)
 Frame = +1

Query: 409  FERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARV 588
            +++ T K  + +  AQ  A     +++                AA +L   G+N+   + 
Sbjct: 3    YDKLTAKFQQALAEAQSLALAADSSYLEAGFVLKALLDDQNSGAAALLAHAGVNVPQVKQ 62

Query: 589  EVE-------KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXX 747
             ++       K+ G+G   +      +   + VL L  + A + G  YI S         
Sbjct: 63   RLQQHLNSLPKVSGQGGDILP-----SRELQAVLNLMDKAATKRGDAYIASELFLLALVQ 117

Query: 748  XXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTK 927
                 A ++L+  GA   NI   +                      +   L++Y  +LT+
Sbjct: 118  QNDA-AGKILKEAGATEQNINAAI------DAVRGGQNVNDANAEDQRDALKKYTLDLTQ 170

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
             A +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE
Sbjct: 171  RARDGKLDPVIGRDDEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPE 230

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAE 1284
            ++  K+++ LD+  L+AG KYRGEFEERLK ++ ++ + D   ++FIDE+HTL+GAG  +
Sbjct: 231  SLRNKRLLVLDLAALIAGAKYRGEFEERLKGVLNDLAKDDGNTLIFIDEIHTLVGAGKTD 290

Query: 1285 GAID 1296
            GA+D
Sbjct: 291  GAMD 294



>gb:CR380959_1654031 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 787

 Score =  181 bits (458), Expect = 4e-44
 Identities = 84/136 (61%), Positives = 113/136 (83%), Gaps = 1/136 (0%)
 Frame = +1

Query: 892  PTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEG 1071
            P LE++GTNLTKLA +GKLDPV+GR ++I R  QIL RRTKNNP LIG  GVGKTA+ +G
Sbjct: 73   PPLEQFGTNLTKLARDGKLDPVIGRDEEISRAIQILSRRTKNNPVLIGRAGVGKTALIDG 132

Query: 1072 LAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFID 1248
            LAQRI  G+VPE+++ K+++ LD+G L+AG KYRGEFEERLKK++E+I ++D ++I+FID
Sbjct: 133  LAQRIVAGEVPESLKDKELVALDLGALIAGAKYRGEFEERLKKVLEDIDKADGKVIVFID 192

Query: 1249 EVHTLIGAGAAEGAID 1296
            EVH L+G G  +G++D
Sbjct: 193  EVHMLLGLGKTDGSMD 208



>gb:BX936398_835493 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 857

 Score =  181 bits (458), Expect = 4e-44
 Identities = 114/301 (37%), Positives = 165/301 (54%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            +R T K    +  AQ  A    + F+                   +L S GIN+   R +
Sbjct: 4    DRLTSKFQLALADAQSLALGRDNQFIEPLHLMSALLNQDGGTVRPLLTSAGINVARLRSD 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +E+ +GR     G+G    ++  +    RVL L  + A++    +I S            
Sbjct: 64   IEQALGRLPQVEGTGG---DVQPSNELVRVLNLCDKLAQKRSDKFISSELFVLAVLEDRG 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +   +L+  GA  + I   +  M                   +   L+++  +LT+ AE
Sbjct: 121  TLTD-MLKAAGATVAIIDKAIETMRGGDKVDDQGAE------DQRQALKKFTIDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  QGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+V++LDMG L+AG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG  +GA+
Sbjct: 234  HKRVLSLDMGSLIAGAKYRGEFEERLKGVLNDLSKQEGSVILFIDELHTMVGAGKGDGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>gb:BX897700_829318 Bartonella quintana str. Toulouse, complete
            genome.
          Length = 879

 Score =  181 bits (458), Expect = 4e-44
 Identities = 110/303 (36%), Positives = 160/303 (52%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINL------ 573
            E+++E+    +  AQ +A    H                   AA +++  G +L      
Sbjct: 4    EKYSERLQGFLQTAQNKALSSDHQQFMPEHLLKVLLEDSQGLAASLIQRAGGDLSLIQKA 63

Query: 574  -KDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
             K+A   + K+ G G+G + +  P      +V +++ + A++ G  ++            
Sbjct: 64   LKEALDVLPKVQG-GNGQLYLSQPLA----KVFDMAEDLAQKAGDQFVTVERLLQALIME 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
                 A +L   G  P  +   +  +                  QK      Y  NLTK 
Sbjct: 119  KTAKTADILTTAGLTPQALNQAINALRKGKKATTPHAESQYDALQK------YACNLTKN 172

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A EGKLDPV+GR+++I R  Q+L RRTKNNP LIGEPGVGKTAI EGL  RI NGDVPET
Sbjct: 173  AREGKLDPVIGREEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLVLRIINGDVPET 232

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEG 1287
            +  K++  LDMG L+AG KYRGEFEERLK ++ E++ ++ +IILFIDE+H L+GAG ++G
Sbjct: 233  LRDKQLYALDMGALIAGAKYRGEFEERLKAVLAEVQAENGQIILFIDELHNLVGAGKSDG 292

Query: 1288 AID 1296
             +D
Sbjct: 293  PMD 295



>gb:BX572091_796206 Prochlorococcus marinus MED4 complete genome;
            segment 2/5.
          Length = 860

 Score =  181 bits (458), Expect = 4e-44
 Identities = 84/135 (62%), Positives = 113/135 (83%), Gaps = 1/135 (0%)
 Frame = +1

Query: 895  TLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGL 1074
            TL+++G +LTK A +G LDPV+GR ++I R  QIL RRTKNNP LIGEPGVGKTAI EGL
Sbjct: 158  TLDKFGIDLTKSARDGILDPVIGRDEEIRRTIQILSRRTKNNPVLIGEPGVGKTAIVEGL 217

Query: 1075 AQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDE 1251
            AQRI NGDVP ++  +++I++DMG L+AG KYRGEFEER+K +++++K S+ +IILFIDE
Sbjct: 218  AQRIVNGDVPSSLNNRQLISIDMGSLIAGAKYRGEFEERIKNVLKKVKSSEGKIILFIDE 277

Query: 1252 VHTLIGAGAAEGAID 1296
            +HT++GAGA  G++D
Sbjct: 278  IHTVVGAGATGGSLD 292



>gb:AE017282_429790 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 859

 Score =  181 bits (458), Expect = 4e-44
 Identities = 87/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LT+ AE GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LQKYTIDLTERAERGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI NG+VPE ++GK+++ LDM  L+AG K+RGEFEERLK ++ +I KQ   +ILFIDE+
Sbjct: 221  QRIVNGEVPEGVKGKRLLALDMAGLIAGAKFRGEFEERLKGVLNDIAKQEGRVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 281  HTMVGAGKAEGAMD 294



>gb:AE016960_367349 Coxiella burnetii strain RSA 493, section 1 of 7
            of the complete genome.>gb:AE016828_1008085 Coxiella
            burnetii strain RSA 493, complete genome.
          Length = 859

 Score =  181 bits (458), Expect = 4e-44
 Identities = 114/301 (37%), Positives = 160/301 (53%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            ++FT      +  AQ  A    H F+                 A +L+   +NL      
Sbjct: 4    DKFTTAFQTALADAQSLAVGRDHQFIEPAHVMKVLLEQTQGTVAPLLEQSKVNLSRLIDG 63

Query: 592  VEKIIG-----RGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            V K I       G+G    E+  +    ++L L  + A+Q    YI S            
Sbjct: 64   VNKAIDSYPQVEGTGG---EVHVSRELSKILTLMDKFAQQNKDQYISSEWFIPAALEAKG 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +   ++E  GAD   I   ++ +                   +   L +Y  +LT+ AE
Sbjct: 121  QLRDVLIE-AGADKKAIEKNIMNLRKGERVTEQSAE------DQRQALAKYTIDLTEKAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
             GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  TGKLDPVIGRDEEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+++ LDMG L+AG K+RGEFEERLK ++++I K+   +ILFIDE+HT++GAG AEGA+
Sbjct: 234  QKRLLALDMGALIAGAKFRGEFEERLKAVLKDIAKEEGRVILFIDELHTMVGAGKAEGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>gb:AE013694_299238 Yersinia pestis KIM section 94 of 415 of the
            complete genome.>gb:AE017129_386500 Yersinia pestis
            biovar Medievalis str. 91001 section 3 of 16 of the
            complete genome.>gb:AE009952_929421 Yersinia pestis KIM
            complete genome.>gb:AE017042_1143066 Yersinia pestis
            biovar Medievalis str. 91001 complete genome.
          Length = 864

 Score =  181 bits (458), Expect = 4e-44
 Identities = 114/301 (37%), Positives = 165/301 (54%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            +R T K    +  AQ  A    + F+                   +L S GIN+   R +
Sbjct: 11   DRLTSKFQLALADAQSLALGRDNQFIEPLHLMSALLNQDGGTVRPLLTSAGINVARLRSD 70

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +E+ +GR     G+G    ++  +    RVL L  + A++    +I S            
Sbjct: 71   IEQALGRLPQVEGTGG---DVQPSNELVRVLNLCDKLAQKRSDKFISSELFVLAVLEDRG 127

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +   +L+  GA  + I   +  M                   +   L+++  +LT+ AE
Sbjct: 128  TLTD-MLKAAGATVAIIDKAIETMRGGDKVDDQGAE------DQRQALKKFTIDLTERAE 180

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 181  QGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 240

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+V++LDMG L+AG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG  +GA+
Sbjct: 241  HKRVLSLDMGSLIAGAKYRGEFEERLKGVLNDLSKQEGSVILFIDELHTMVGAGKGDGAM 300

Query: 1294 D 1296
            D
Sbjct: 301  D 301



>pir|AI0397|AI0397 Clp ATPase [imported] - Yersinia pestis (strain
            CO92)>gb:AJ414156_525038 Yersinia pestis strain CO92
            complete genome; segment 16/20.
          Length = 857

 Score =  181 bits (458), Expect = 4e-44
 Identities = 114/301 (37%), Positives = 165/301 (54%), Gaps = 6/301 (1%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            +R T K    +  AQ  A    + F+                   +L S GIN+   R +
Sbjct: 4    DRLTSKFQLALADAQSLALGRDNQFIEPLHLMSALLNQDGGTVRPLLTSAGINVARLRSD 63

Query: 592  VEKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXX 756
            +E+ +GR     G+G    ++  +    RVL L  + A++    +I S            
Sbjct: 64   IEQALGRLPQVEGTGG---DVQPSNELVRVLNLCDKLAQKRSDKFISSELFVLAVLEDRG 120

Query: 757  XVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAE 936
             +   +L+  GA  + I   +  M                   +   L+++  +LT+ AE
Sbjct: 121  TLTD-MLKAAGATVAIIDKAIETMRGGDKVDDQGAE------DQRQALKKFTIDLTERAE 173

Query: 937  EGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIE 1116
            +GKLDPV+GR ++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE ++
Sbjct: 174  QGKLDPVIGRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPEGLK 233

Query: 1117 GKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEVHTLIGAGAAEGAI 1293
             K+V++LDMG L+AG KYRGEFEERLK ++ ++ KQ   +ILFIDE+HT++GAG  +GA+
Sbjct: 234  HKRVLSLDMGSLIAGAKYRGEFEERLKGVLNDLSKQEGSVILFIDELHTMVGAGKGDGAM 293

Query: 1294 D 1296
            D
Sbjct: 294  D 294



>pir|D71711|D71711 endopeptidase Clp ATP-binding chain B - Rickettsia
            prowazekii>gb:RPXX01_166841 Rickettsia prowazekii strain
            Madrid E, complete genome; segment 1/4.
          Length = 858

 Score =  181 bits (458), Expect = 4e-44
 Identities = 112/303 (36%), Positives = 164/303 (54%), Gaps = 8/303 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMG--INLKDAR 585
            ++FT  A  VI   Q  A +  H  +                   ++ ++G  INL   +
Sbjct: 4    DKFTAHAKSVIANHQSLAIKNDHQQILPLHLLSSLLSEETGIIQALINNIGGNINLLKDQ 63

Query: 586  VEVE-----KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
            V++E     KI   G G    +I ++    +VLE S   A+  G +++ +          
Sbjct: 64   VQLELNKIPKIQVDGGG----QIYYSAEDLKVLEKSSSIAKDSGDSFV-TIERIFEALTY 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
               +A ++L N G +   + T ++ +                       L+ YG ++T+L
Sbjct: 119  DNTIAGKILTNNGINSKKLATAILHLRKGKKADTESAE------NNYDALKRYGRDVTEL 172

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            AE GKLDP++GR ++I R  Q+L RR KNNP LIG PGVGKTAI EGLAQRI + DVPET
Sbjct: 173  AENGKLDPIIGRDEEIRRAVQVLSRRMKNNPVLIGAPGVGKTAIIEGLAQRIFSKDVPET 232

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEG 1287
            +   ++I LD+G L+AG +YRGEFE+RLK ++ EIK+S  EIILFIDE+H L+G G  +G
Sbjct: 233  LINCRIIELDIGALIAGAQYRGEFEKRLKAVLSEIKESSGEIILFIDELHLLVGTGKVDG 292

Query: 1288 AID 1296
            A+D
Sbjct: 293  AMD 295



>pir|T34902|T34902 clp proteinase ATP-binding chain - Streptomyces
            coelicolor>gb:SCO939127_180075 Streptomyces coelicolor
            A3(2) complete genome; segment 24/29.
          Length = 842

 Score =  181 bits (458), Expect = 4e-44
 Identities = 95/223 (42%), Positives = 136/223 (60%), Gaps = 3/223 (1%)
 Frame = +1

Query: 637  IPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQ 816
            +  TP  KR L  + E AR  G  YIG               A  +L      PSN+ T+
Sbjct: 111  LSLTPAVKRALLDAHELARSTGTGYIGPEHVLSALAANPDSAAGHILNAARFAPSNLPTE 170

Query: 817  VIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQI 996
                                     PTL++YG +LT LA++G++DPV+GR+++IE+  ++
Sbjct: 171  TPEAAKGRTESARTTNT--------PTLDKYGRDLTDLAQQGRIDPVIGREEEIEQTVEV 222

Query: 997  LGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRG 1176
            L RR KNNP LIG+ GVGKTAI EGLAQRI +GDVP+ + G++V+ LD+  +VAGT+YRG
Sbjct: 223  LSRRGKNNPVLIGDAGVGKTAIVEGLAQRITDGDVPDVLIGRRVVALDLTGVVAGTRYRG 282

Query: 1177 EFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAA--EGAID 1296
            +FEER+  ++ EI+  SDE+I+FIDE+HT++GAG     G++D
Sbjct: 283  DFEERMNNIVGEIRAHSDELIIFIDELHTVVGAGGGGESGSMD 325



>gb:LDHSP100_1387258 L.donovani hsp100 gene.
          Length = 867

 Score =  180 bits (457), Expect = 5e-44
 Identities = 90/177 (50%), Positives = 122/177 (68%), Gaps = 1/177 (0%)
 Frame = +1

Query: 769  RVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEEGKL 948
            R+L+  GA    IR  ++ M                      +L +Y  +L K AE+GKL
Sbjct: 123  RILDAAGAGKKAIRATLLEMRKGKKINSDFQD------DNYESLNKYAVDLCKQAEDGKL 176

Query: 949  DPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKV 1128
            DPV+GR D+I R  ++L RRTKNNP LIGEPGVGKTAI EG+AQ++  GDVP+T+ G ++
Sbjct: 177  DPVIGRADEILRTIRVLSRRTKNNPVLIGEPGVGKTAIVEGIAQQVVRGDVPDTLSGIRI 236

Query: 1129 ITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
             +LDMG L+AG KYRGEFEERLK ++ E+K+SD +IILFIDE+H ++GAG ++GA+D
Sbjct: 237  FSLDMGALIAGAKYRGEFEERLKAVLNEVKESDNKIILFIDEIHLVLGAGKSDGAMD 293



>gb:CP000025_878384 Campylobacter jejuni RM1221, complete genome.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 84/138 (60%), Positives = 114/138 (82%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            + + +L ++G +LT  A EGKLDPV+GR+++IER+ QIL R+TKNNP L+GEPGVGKTAI
Sbjct: 157  ETLDSLNKFGIDLTLKASEGKLDPVIGREEEIERLMQILIRKTKNNPILLGEPGVGKTAI 216

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 1242
             E LAQRI   DVP++++ KKVI LDM  L+AG KYRGEFE+RLK ++ E+ +S+ IILF
Sbjct: 217  VEALAQRIIKKDVPKSLQNKKVIALDMSALIAGAKYRGEFEDRLKAVVNEVIKSENIILF 276

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA+EG++D
Sbjct: 277  IDEIHTIVGAGASEGSMD 294



>gb:CP000020_870742 Vibrio fischeri ES114 chromosome I, complete
            sequence.
          Length = 861

 Score =  180 bits (457), Expect = 5e-44
 Identities = 85/139 (61%), Positives = 113/139 (81%), Gaps = 1/139 (0%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            +K   LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IG+PGVGKTAI
Sbjct: 156  EKRQALEKFTVDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGQPGVGKTAI 215

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIIL 1239
             EGLAQRI NG+VPE ++ K+V++LD+G LVAG K+RGEFEERLK ++ E+ K+   +IL
Sbjct: 216  VEGLAQRIINGEVPEGLKNKRVLSLDIGALVAGAKFRGEFEERLKAVLNELAKEEGSVIL 275

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            FIDEVHT++GAG  EG++D
Sbjct: 276  FIDEVHTMVGAGKGEGSMD 294



>gb:CJY13333_848434 Campylobacter jejuni clpB gene.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 84/138 (60%), Positives = 114/138 (82%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            + + +L ++G +LT  A EGKLDPV+GR+++IER+ QIL R+TKNNP L+GEPGVGKTAI
Sbjct: 157  ETLDSLNKFGIDLTLKASEGKLDPVIGREEEIERLMQILIRKTKNNPILLGEPGVGKTAI 216

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 1242
             E LAQRI   DVP++++ KKVI LDM  L+AG KYRGEFE+RLK ++ E+ +S+ IILF
Sbjct: 217  VEALAQRIIKKDVPKSLQNKKVIALDMSALIAGAKYRGEFEDRLKAVVNEVIKSENIILF 276

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA+EG++D
Sbjct: 277  IDEIHTIVGAGASEGSMD 294



>gb:BA000037_721541 Vibrio vulnificus YJ016 DNA, chromosome I,
            complete sequence.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IGEPGVGKTAI EGLA
Sbjct: 161  LEKFTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI N +VPE + G++V++LDMG LVAG KYRGEFEERLK ++ E+ K+   IILFIDE+
Sbjct: 221  QRIINNEVPEGLRGRRVLSLDMGALVAGAKYRGEFEERLKSVLNELSKEEGNIILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 281  HTMVGAGKGEGSMD 294



>gb:BA000031_706021 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 1, complete sequence.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 85/134 (63%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IGEPGVGKTAI EGLA
Sbjct: 161  LEKFTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI N +VPE + G++V++LDMG LVAG KYRGEFEERLK ++ E+ K+   +ILFIDE+
Sbjct: 221  QRIVNNEVPEGLRGRRVLSLDMGALVAGAKYRGEFEERLKSVLNELAKEEGNVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 281  HTMVGAGKGEGSMD 294



>gb:AE016798_335254 Vibrio vulnificus CMCP6 chromosome I section 2 of
            11 of the complete sequence.>gb:AE016795_1044978 Vibrio
            vulnificus CMCP6 chromosome I complete sequence.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IGEPGVGKTAI EGLA
Sbjct: 161  LEKFTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI N +VPE + G++V++LDMG LVAG KYRGEFEERLK ++ E+ K+   IILFIDE+
Sbjct: 221  QRIINNEVPEGLRGRRVLSLDMGALVAGAKYRGEFEERLKSVLNELSKEEGNIILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 281  HTMVGAGKGEGSMD 294



>gb:CP000031_87271 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 872

 Score =  180 bits (457), Expect = 5e-44
 Identities = 85/134 (63%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LT+ A EGK+DP++GR ++I R  Q+L RRTKNNP LIGEPGVGKTAIAEG+A
Sbjct: 161  LKKYARDLTEAAAEGKIDPIIGRDEEIRRSMQVLSRRTKNNPVLIGEPGVGKTAIAEGMA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQ-SDEIILFIDEV 1254
             RI NGDVPE++  KK++ LDMG L+AG KYRGEFEERLK ++ E+ + + EIILFIDE+
Sbjct: 221  LRIVNGDVPESLRDKKLLALDMGALIAGAKYRGEFEERLKAVLTEVTEAAGEIILFIDEM 280

Query: 1255 HTLIGAGAAEGAID 1296
            HTL+GAG ++GA+D
Sbjct: 281  HTLVGAGKSDGAMD 294



>pir|A82290|A82290 clpB protein VC0711 [imported] - Vibrio cholerae
            (strain N16961 serogroup O1)>gb:AE004157_51106 Vibrio
            cholerae O1 biovar eltor str. N16961 chromosome I,
            section 65 of 251 of the complete
            chromosome.>gb:AE003852_1051880 Vibrio cholerae O1 biovar
            eltor str. N16961 chromosome I, complete chromosome.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 86/134 (64%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IGEPGVGKTAI EGLA
Sbjct: 161  LEKFTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI N +VPE + G++V++LDMG LVAG KYRGEFEERLK ++ E+ K+   IILFIDE+
Sbjct: 221  QRIINNEVPEGLRGRRVLSLDMGALVAGAKYRGEFEERLKSVLNELAKEEGNIILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 281  HTMVGAGKGEGSMD 294



>pir|F81396|F81396 ATP-dependent CLP proteinase ATP-binding chain
            Cj0509c [imported] - Campylobacter jejuni (strain NCTC
            11168)>gb:CJ11168X2_846911 Campylobacter jejuni subsp.
            jejuni NCTC 11168 complete genome; segment 2/6.
          Length = 857

 Score =  180 bits (457), Expect = 5e-44
 Identities = 84/138 (60%), Positives = 114/138 (82%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            + + +L ++G +LT  A EGKLDPV+GR+++IER+ QIL R+TKNNP L+GEPGVGKTAI
Sbjct: 157  ETLDSLNKFGIDLTLKASEGKLDPVIGREEEIERLMQILIRKTKNNPILLGEPGVGKTAI 216

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 1242
             E LAQRI   DVP++++ KKVI LDM  L+AG KYRGEFE+RLK ++ E+ +S+ IILF
Sbjct: 217  VEALAQRIIKKDVPKSLQNKKVIALDMSALIAGAKYRGEFEDRLKAVVNEVIKSENIILF 276

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAGA+EG++D
Sbjct: 277  IDEIHTIVGAGASEGSMD 294



>gb:YSCHSP78A_1729354 Saccharomyces cerevisiae nuclear-encoded
            mitochondrial heat shock protein 78 (HSP78) gene,
            complete cds.
          Length = 811

 Score =  180 bits (456), Expect = 7e-44
 Identities = 84/136 (61%), Positives = 111/136 (81%), Gaps = 1/136 (0%)
 Frame = +1

Query: 892  PTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEG 1071
            P LE++GTNL KLA +GKLDPV+GR ++I R  QIL RRTKNNPCLIG  GVGKTA+ +G
Sbjct: 96   PALEQFGTNLKKLARDGKLDPVIGRDEEIARAIQILSRRTKNNPCLIGRAGVGKTALIDG 155

Query: 1072 LAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFID 1248
            LAQRI  G+VP++++ K ++ LD+G L+AG KYRGEFEERLKK++EEI K + ++I+FID
Sbjct: 156  LAQRIVAGEVPDSLKDKDLVALDLGSLIAGAKYRGEFEERLKKVLEEIDKANGKVIVFID 215

Query: 1249 EVHTLIGAGAAEGAID 1296
            EVH L+G G  +G++D
Sbjct: 216  EVHMLLGLGKTDGSMD 231



>gb:AE017315_440123 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 7 of 12 of the complete
            genome.>gb:AE017285_1073284 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 865

 Score =  180 bits (456), Expect = 7e-44
 Identities = 112/300 (37%), Positives = 163/300 (54%), Gaps = 6/300 (2%)
 Frame = +1

Query: 415  RFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVEV 594
            +FTEK+ + +  AQ  A R GH  V                  ++L  MG   +     +
Sbjct: 5    KFTEKSQQALAEAQNIAVRFGHQEVDAEHLADALVRQEQGLVPRLLDRMGQKPEAFAEAL 64

Query: 595  EKIIGR-----GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXXXX 759
            E+ +G+     G G    +I  + R   VL  + + ARQL   Y+               
Sbjct: 65   ERELGKRPAVSGPGAAPGQIFVSKRLNAVLVKAQDFARQLKDEYVS---VEHIFCVLLEE 121

Query: 760  VAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLAEE 939
             A+ ++  +  + S  R +V+ +                   +   L++YG +L + A +
Sbjct: 122  PASTIMGRIAREFSLSREKVLGVLEDVRGSQRVTSANPEDTYE--ALQKYGRDLVEEARK 179

Query: 940  GKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEG 1119
            GKLDPV+GR  +I RV +IL RRTKNNP LIGE GVGKTAI EGLA RI  GDVPE ++ 
Sbjct: 180  GKLDPVIGRDAEIRRVIRILSRRTKNNPVLIGEAGVGKTAIVEGLAHRILKGDVPEGLKE 239

Query: 1120 KKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEGAID 1296
            + +  LDMG L+AG KYRGEFEERLK +++E+++S+  II+FIDE+HT++GAG  +GA+D
Sbjct: 240  RGLFALDMGALIAGAKYRGEFEERLKAVLKEVEKSEGRIIMFIDELHTIVGAGKTDGAMD 299



>gb:BX897699_827993 Bartonella henselae strain Houston-1, complete
            genome.
          Length = 859

 Score =  179 bits (455), Expect = 9e-44
 Identities = 108/302 (35%), Positives = 157/302 (51%), Gaps = 7/302 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGINLKDARVE 591
            E+++E+    +  AQ +A    H                   AA +++  G +L   +  
Sbjct: 4    EKYSERLQGFLQTAQNKALSSDHQQFMPEHFLKVLLEDSQGLAASLIQKAGGDLSLIQKA 63

Query: 592  VEKIIGR------GSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXXX 753
            +E+ +        G+G + +  P      +V  L+ + A + G  ++             
Sbjct: 64   LEEALDALPKVQGGNGQLYLSQPLA----KVFTLAEDLAHKAGDQFVTVERVLQALIMEK 119

Query: 754  XXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKLA 933
                A +L   G  P  +   +  +                  QK      Y  +LTK A
Sbjct: 120  TAKTADILTKAGLTPQALNQAINALRKGKTATSPHAESQYDALQK------YARDLTKDA 173

Query: 934  EEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETI 1113
             EGKLDPV+GR+++I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA RI NGDVPET+
Sbjct: 174  REGKLDPVIGREEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLALRIVNGDVPETL 233

Query: 1114 EGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIK-QSDEIILFIDEVHTLIGAGAAEGA 1290
              K++  LDMG L+AG KYRGEFEERLK ++ E++ ++ +IILFIDE+H L+GAG ++G 
Sbjct: 234  RDKRLYALDMGALIAGAKYRGEFEERLKAVLAEVQAENGQIILFIDELHNLVGAGKSDGP 293

Query: 1291 ID 1296
            +D
Sbjct: 294  MD 295



>gb:BA000039_728236 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 887

 Score =  179 bits (455), Expect = 9e-44
 Identities = 84/136 (61%), Positives = 114/136 (83%), Gaps = 1/136 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   LE+YG +LT+ A +GKLDPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAIA
Sbjct: 158  KYAALEKYGRDLTEAARQGKLDPVIGRDEEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIA 217

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI NGDVPE+++ +++I+LD+G LVAG K+RG+FE+RLK ++ E+  S+ +I+LF
Sbjct: 218  EGLAQRIINGDVPESLKNRRLISLDLGSLVAGAKFRGDFEDRLKAVLHEVTHSEGQIVLF 277

Query: 1243 IDEVHTLIGAGAAEGA 1290
            IDE+HT++GAGA + +
Sbjct: 278  IDELHTVVGAGANQNS 293



>gb:AJ749949_532226 Francisella tularensis subsp. tularensis complete
            genome.
          Length = 859

 Score =  179 bits (455), Expect = 9e-44
 Identities = 84/134 (62%), Positives = 111/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LT LA +GK+DP++GR  +I R  Q+L RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LDKYTVDLTDLARKGKIDPIIGRDSEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI N +VPE ++GKKV++LDMG L+AG K+RG+FEERLK +++E+ KQ   +ILFIDE+
Sbjct: 221  QRIVNDEVPEGVKGKKVLSLDMGALLAGAKFRGDFEERLKSVLKELSKQEGNVILFIDEL 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEG++D
Sbjct: 281  HTMVGAGKAEGSMD 294



>gb:AE017253_417365 Treponema denticola ATCC 35405, section 8 of 10 of
            the complete genome.>gb:AE017226_1070961 Treponema
            denticola ATCC 35405, complete genome.
          Length = 859

 Score =  179 bits (455), Expect = 9e-44
 Identities = 83/135 (61%), Positives = 118/135 (87%), Gaps = 1/135 (0%)
 Frame = +1

Query: 895  TLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGL 1074
            +LE++  +LT+LA+  K+DPV+GR ++I RV Q+L RRTKNNP LIGEPGVGKTAI EGL
Sbjct: 160  SLEKFCRDLTQLAKNEKIDPVIGRDEEIRRVMQVLSRRTKNNPVLIGEPGVGKTAIVEGL 219

Query: 1075 AQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDE 1251
            A+RI +GDVP++++GK++++LD+G LVAG K+RGEFEERLK ++ E+++S+  +ILFIDE
Sbjct: 220  ARRIVSGDVPDSLKGKRLLSLDLGALVAGAKFRGEFEERLKAVISEVQKSEGRVILFIDE 279

Query: 1252 VHTLIGAGAAEGAID 1296
            +HTL+GAGA+EG++D
Sbjct: 280  LHTLVGAGASEGSMD 294



>gb:SCO939117_177333 Streptomyces coelicolor A3(2) complete genome;
            segment 14/29.
          Length = 865

 Score =  179 bits (455), Expect = 9e-44
 Identities = 96/205 (46%), Positives = 129/205 (62%), Gaps = 2/205 (0%)
 Frame = +1

Query: 688  ARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXX 867
            A++LG  Y+ S              A  VLE  GA    ++    +              
Sbjct: 99   AKELGDEYL-STEHLLLGIAAKGGAAGEVLEGQGASAKKLQEAFRKARGGRRVTTADPEG 157

Query: 868  XXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGV 1047
                  +   LE++GT+LT  A +GKLDPV+GR  +I RV Q+L RRTKNNP LIGEPGV
Sbjct: 158  ------QYKALEKFGTDLTAAARDGKLDPVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGV 211

Query: 1048 GKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD 1227
            GKTA+ EGLAQRI  GDVPE+++ K+++ LD+G +VAG KYRGEFEERLK ++ EIK SD
Sbjct: 212  GKTAVVEGLAQRIVKGDVPESLKDKRLVALDLGAMVAGAKYRGEFEERLKTVLAEIKDSD 271

Query: 1228 -EIILFIDEVHTLIGAGA-AEGAID 1296
             +++ FIDE+HT++GAGA  + A+D
Sbjct: 272  GQVVTFIDELHTVVGAGAGGDSAMD 296



>pir|T36551|T36551 probable ATP-dependent proteinase ATP-binding chain
            - Streptomyces coelicolor (fragment)
          Length = 853

 Score =  179 bits (455), Expect = 9e-44
 Identities = 96/205 (46%), Positives = 129/205 (62%), Gaps = 2/205 (0%)
 Frame = +1

Query: 688  ARQLGHNYIGSXXXXXXXXXXXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXX 867
            A++LG  Y+ S              A  VLE  GA    ++    +              
Sbjct: 87   AKELGDEYL-STEHLLLGIAAKGGAAGEVLEGQGASAKKLQEAFRKARGGRRVTTADPEG 145

Query: 868  XXXXXQKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGV 1047
                  +   LE++GT+LT  A +GKLDPV+GR  +I RV Q+L RRTKNNP LIGEPGV
Sbjct: 146  ------QYKALEKFGTDLTAAARDGKLDPVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGV 199

Query: 1048 GKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD 1227
            GKTA+ EGLAQRI  GDVPE+++ K+++ LD+G +VAG KYRGEFEERLK ++ EIK SD
Sbjct: 200  GKTAVVEGLAQRIVKGDVPESLKDKRLVALDLGAMVAGAKYRGEFEERLKTVLAEIKDSD 259

Query: 1228 -EIILFIDEVHTLIGAGA-AEGAID 1296
             +++ FIDE+HT++GAGA  + A+D
Sbjct: 260  GQVVTFIDELHTVVGAGAGGDSAMD 284



>pir|G75442|G75442 ATP-dependent Clp proteinase, ATP-binding subunit
            ClpB - Deinococcus radiodurans (strain
            R1)>gb:AE001956_41317 Deinococcus radiodurans R1 section
            93 of 229 of the complete chromosome
            1.>gb:AE000513_882212 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 875

 Score =  179 bits (455), Expect = 9e-44
 Identities = 86/139 (61%), Positives = 112/139 (80%), Gaps = 1/139 (0%)
 Frame = +1

Query: 883  QKMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAI 1062
            Q+   L +YGT+LT+ A +GK DPV+GR ++I RV QIL RR+KNNP LIGEPGVGKTAI
Sbjct: 171  QQFDALNKYGTDLTQRARDGKFDPVIGRDEEIRRVMQILLRRSKNNPVLIGEPGVGKTAI 230

Query: 1063 AEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEE-IKQSDEIIL 1239
            AEGLA RI  GDVPE +  KK+++L+MG L+AG K+RGEFEERLK +++E +K + EIIL
Sbjct: 231  AEGLAMRIVKGDVPEGLRDKKIVSLEMGSLLAGAKFRGEFEERLKGVIDEVVKSAGEIIL 290

Query: 1240 FIDEVHTLIGAGAAEGAID 1296
            F+DE+HT++GAG  EG+ D
Sbjct: 291  FVDEIHTIVGAGKTEGSPD 309



>gb:AY596495S1_1616760 Helicosporidium sp. ex Simulium jonesii plastid
            clpB gene, partial cds; nuclear gene for plastid product.
          Length = 326

 Score =  179 bits (454), Expect = 1e-43
 Identities = 83/138 (60%), Positives = 111/138 (80%), Gaps = 1/138 (0%)
 Frame = +1

Query: 886  KMPTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIA 1065
            K   L +YG +LT  A EGKLDPV+GR D++ R  QIL RRTKNNP LIGEPGVGKTA+A
Sbjct: 128  KYEALAKYGRDLTAAAREGKLDPVIGRDDEVRRCIQILSRRTKNNPVLIGEPGVGKTAVA 187

Query: 1066 EGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILF 1242
            EGLAQRI  GDVP++++ + +I+LD+G L+AG K+RGEFEERLK +++E++ S   ++LF
Sbjct: 188  EGLAQRIVQGDVPDSLQNRTLISLDVGALIAGAKFRGEFEERLKAVIKEVQDSQGGVVLF 247

Query: 1243 IDEVHTLIGAGAAEGAID 1296
            IDE+HT++GAG  EG++D
Sbjct: 248  IDEIHTIVGAGRGEGSMD 265



>gb:BA000016_674468 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 866

 Score =  179 bits (454), Expect = 1e-43
 Identities = 83/134 (61%), Positives = 112/134 (83%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++YGTNL +L ++ KLDPV+GR ++I R  +IL R+TKNNP LIGEPGVGKTAI EGLA
Sbjct: 166  LDKYGTNLIELVKQHKLDPVIGRDEEIRRAVRILSRKTKNNPILIGEPGVGKTAIVEGLA 225

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            +RI  GDVPE ++ K +I+LDMG L+AG KYRGEFEERLK +++E++ S+ +I+LFIDE+
Sbjct: 226  ERIVRGDVPEGLKDKVIISLDMGALIAGAKYRGEFEERLKAVLKEVQSSEGKILLFIDEI 285

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  +GA+D
Sbjct: 286  HTIVGAGKTDGAMD 299



>gb:CR378672_96323 Photobacterium profundum SS9; segment 10/12.
          Length = 861

 Score =  179 bits (454), Expect = 1e-43
 Identities = 84/134 (62%), Positives = 110/134 (82%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++  +LT+ AE+GKLDPV+GR D+I R  Q+L RRTKNNP +IG+PGVGKTAI EGLA
Sbjct: 165  LEKFTIDLTERAEQGKLDPVIGRDDEIRRTIQVLQRRTKNNPVIIGQPGVGKTAIVEGLA 224

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI NG+VPE +  K+V++LDMG L+AG KYRGEFEERLK ++ E+ Q +  +ILFIDE+
Sbjct: 225  QRIVNGEVPEGLRHKRVLSLDMGSLIAGAKYRGEFEERLKSVLNELSQEEGSVILFIDEL 284

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG  EG++D
Sbjct: 285  HTMVGAGKGEGSMD 298



>gb:AF487263_1804255 Leptosphaeria maculans major facilitator
            superfamily (mfs1), elongation factor 1 beta subunit
            (ef1B), heat shock protein 78 (hsp78), mismatch repair
            protein 5 (msh5), Zn-II 2Cys6 regulatory protein (znr1),
            monomodular non-ribosomal peptide synthetase (maa1),
            putative endo-exoxylanase (xyl38), and protein kinase C
            (pkc1) genes, complete cds; and unknown gene.
          Length = 807

 Score =  179 bits (453), Expect = 1e-43
 Identities = 84/136 (61%), Positives = 113/136 (83%), Gaps = 1/136 (0%)
 Frame = +1

Query: 892  PTLEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEG 1071
            P LE+YG +LT+ A +GKLDPV+GR  +I+R  QIL RRTKNNP LIG+ G GKTAI EG
Sbjct: 97   PALEQYGIDLTERARDGKLDPVIGRDGEIQRTIQILSRRTKNNPVLIGKAGTGKTAILEG 156

Query: 1072 LAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDE-IILFID 1248
            LAQRI  GDVPE+I+ K+VI+LD+G L+AG K+RG+FEERLK +++E++++ + +ILF+D
Sbjct: 157  LAQRIVKGDVPESIKDKRVISLDLGSLIAGAKFRGDFEERLKSVLKEVEEAKKGVILFVD 216

Query: 1249 EVHTLIGAGAAEGAID 1296
            E+HTL+G G AEG+ID
Sbjct: 217  ELHTLLGLGKAEGSID 232



>gb:BA000030_702401 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 870

 Score =  179 bits (453), Expect = 1e-43
 Identities = 86/135 (63%), Positives = 110/135 (81%), Gaps = 2/135 (1%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            LE++GT+ T  A +GKLDPV+GR  +I RV Q+L RRTKNNP LIGEPGVGKTA+ EGLA
Sbjct: 162  LEKFGTDFTAAARDGKLDPVIGRDQEIRRVVQVLSRRTKNNPVLIGEPGVGKTAVVEGLA 221

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEV 1254
            QRI  GDVPE+++ K+++ LD+G +VAG KYRGEFEERLK ++ EIK SD +II FIDE+
Sbjct: 222  QRIVKGDVPESLKNKRLVALDLGAMVAGAKYRGEFEERLKTVLAEIKDSDGQIITFIDEL 281

Query: 1255 HTLIGAGA-AEGAID 1296
            HT++GAGA  + A+D
Sbjct: 282  HTVVGAGAGGDSAMD 296



>gb:AE017197_402085 Rickettsia typhi str. Wilmington complete genome.
          Length = 858

 Score =  179 bits (453), Expect = 1e-43
 Identities = 113/304 (37%), Positives = 164/304 (53%), Gaps = 9/304 (2%)
 Frame = +1

Query: 412  ERFTEKAIKVIMLAQEEARRLGHNFVXXXXXXXXXXXXXXXXAAKVLKSMGIN---LKDA 582
            ++FT  A  VI   Q  A +  H  +                   ++ ++G N   LKD 
Sbjct: 4    DKFTAHAKSVIANHQSLAIKNDHQQILPLHLLSSLLSEETGIIQALINNIGGNIHLLKD- 62

Query: 583  RVEVE-----KIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXX 747
            +V++E     KI   G G    +I ++    +VLE S   A+  G +++ +         
Sbjct: 63   QVQLELNKIPKIQVDGGG----QIYYSAEDLKVLEKSRSIAKDSGDSFV-TIERIFEALT 117

Query: 748  XXXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTK 927
                +A ++L N G +   +   ++ +                       L+ YG ++T+
Sbjct: 118  YDNTIAGKILTNNGINSKKLAAAILHLRKGKKADTESAE------NSYDALKRYGRDVTE 171

Query: 928  LAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPE 1107
            LA+ GKLDP++GR ++I R  Q+L RR KNNP LIG PGVGKTAI EGLAQRI N DVPE
Sbjct: 172  LAKNGKLDPIIGRDEEIRRAVQVLSRRMKNNPVLIGAPGVGKTAIIEGLAQRIFNKDVPE 231

Query: 1108 TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAE 1284
            T+   ++I LD+G L+AG +YRGEFE+RLK ++ EIK+S  EIILFIDE+H L+G G  E
Sbjct: 232  TLINCRIIELDIGALIAGAQYRGEFEKRLKSVLSEIKESSGEIILFIDELHLLVGTGKVE 291

Query: 1285 GAID 1296
            GA+D
Sbjct: 292  GAMD 295



>gb:AE016916_356905 Chromobacterium violaceum ATCC 12472 section 7 of
            16 of the complete genome.>gb:AE016825_1042059
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 859

 Score =  179 bits (453), Expect = 1e-43
 Identities = 99/243 (40%), Positives = 147/243 (60%), Gaps = 1/243 (0%)
 Frame = +1

Query: 571  LKDARVEVEKIIGRGSGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSXXXXXXXXXX 750
            LK A   + ++ G G      EI  +     +L ++ + A +LG  +I S          
Sbjct: 64   LKQAIDRLPRVQGHGG-----EITVSRDLANLLNIADKIAMKLGDEFIASELYLSALSQD 118

Query: 751  XXXVAARVLENLGADPSNIRTQVIRMXXXXXXXXXXXXXXXXXXQKMPTLEEYGTNLTKL 930
                A R+L+  G + ++I+  +  +                   +   L++Y  +LT+ 
Sbjct: 119  KGE-AGRLLKEHGGNHASIQAAIDAVRGGESVNSADAEG------QREALKKYTMDLTER 171

Query: 931  AEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPET 1110
            A +GKLDPV+GR D+I R  Q+L RRTKNNP LIGEPGVGKTAI EGLAQRI NG+VPE+
Sbjct: 172  ARQGKLDPVIGRDDEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIVNGEVPES 231

Query: 1111 IEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDEVHTLIGAGAAEG 1287
            ++ K+++ LD+  L+AG KYRGEFEERLK ++ ++ + D + ++FIDE+HTL+GAG A+G
Sbjct: 232  LKNKRLLVLDLAALIAGAKYRGEFEERLKAVLNDLSKDDGQTLIFIDEIHTLVGAGKADG 291

Query: 1288 AID 1296
            A+D
Sbjct: 292  AMD 294



>gb:CP000010_865650 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 865

 Score =  178 bits (451), Expect = 2e-43
 Identities = 87/134 (64%), Positives = 108/134 (80%), Gaps = 1/134 (0%)
 Frame = +1

Query: 898  LEEYGTNLTKLAEEGKLDPVVGRQDQIERVTQILGRRTKNNPCLIGEPGVGKTAIAEGLA 1077
            L++Y  +LT+ A  GKLDPV+GR D+I R  QIL RRTKNNP LIGEPGVGKTAI EGLA
Sbjct: 161  LKKYTVDLTERARAGKLDPVIGRDDEIRRSIQILQRRTKNNPVLIGEPGVGKTAIVEGLA 220

Query: 1078 QRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI-KQSDEIILFIDEV 1254
            QRI NG+VPET++ K+V++LDM  L+AG KYRGEFEERLK ++ +I K     I+FIDE+
Sbjct: 221  QRIVNGEVPETLKNKRVLSLDMAALLAGAKYRGEFEERLKAVLNDIAKDEGRTIVFIDEI 280

Query: 1255 HTLIGAGAAEGAID 1296
            HT++GAG AEGA+D
Sbjct: 281  HTMVGAGKAEGAMD 294


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.317    0.135    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,157,298,682
Number of Sequences: 1806583
Number of extensions: 22300333
Number of successful extensions: 72251
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 66716
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 70438
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 107506989870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)