BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3700
         (684 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q9Y871|FAEB_PIREQ|FAEB_PIREQ Feruloyl esterase B precursor (EC 3.1.1.73)...    23   1e-05   Piromyces equi
gb:AE014187_939103 Plasmodium falciparum 3D7 chromosome 14 compl...    35   1.6     
gb:BT001273_1356046 Drosophila melanogaster AT05468 full insert ...    34   2.1     
gb:AB025255_1194308 Drosophila melanogaster mRNA for male-specif...    34   2.1     
gb:AE014296_1136796 Drosophila melanogaster chromosome 3L, compl...    34   2.1     
gb:BC047257_2549876 Xenopus laevis similar to membrane protein, ...    34   2.7     
gb:AE017346_1757572 Cryptococcus neoformans var. neoformans JEC2...    34   2.7     
gb:CP000009_863718 Gluconobacter oxydans 621H, complete genome.        34   2.7     
gb:BC081365_2562248 Xenopus tropicalis MGC89895 protein, mRNA (c...    33   3.6     
gb:CR382398_1374912 Plasmodium falciparum chromosome 6, complete...    33   3.6     
gb:AE014188_967922 Plasmodium falciparum 3D7 chromosome 12, comp...    33   3.6     
gb:BC045260_2549109 Xenopus laevis heterogeneous ribonuclear par...    22   4.2     
gb:PFMAL1P2_1394293 Plasmodium falciparum DNA from MAL1P2.             33   4.7     
gb:CR382125_1658271 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   6.1     
gb:CEY11D7A_1369438 Caenorhabditis elegans YAC Y11D7A, complete ...    33   6.1     
pir|T26467|T26467 hypothetical protein Y11D7A.14 - Caenorhabditi...    33   6.1     Caenorhabditis elegans [roundworm]
gb:BC089300_2566178 Xenopus laevis cDNA clone IMAGE:6867868, par...    32   8.0     


>sp|Q9Y871|FAEB_PIREQ Feruloyl esterase B precursor (EC 3.1.1.73)
           (Ferulic acid esterase B) (Esterase A) (EstA) (Cinnamoyl
           ester hydrolase).>gb:A84068_1451001 Sequence 3 from
           Patent WO9846768.>gb:AF164516_1773702 Piromyces equi
           cinnamoyl ester hydrolase EstA (estA) mRNA, complete
           cds.
          Length = 536

 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 234 FGGNQGGG 241



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 221 FGGNQGGG 228



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 191 FGGNQGGG 198



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 161 FGGNQGGG 168



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 114 FGGNQGGG 121



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 101 FGGNQGGG 108



 Score = 22.7 bits (47), Expect(9) = 1e-05
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +2

Query: 344 FGGNQGGG 367
           FGGNQGGG
Sbjct: 88  FGGNQGGG 95



 Score = 20.4 bits (41), Expect(9) = 1e-05
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 344 FGGNQGG 364
           FGGNQGG
Sbjct: 247 FGGNQGG 253



 Score = 20.4 bits (41), Expect(9) = 1e-05
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +2

Query: 347 GGNQGGG 367
           GGNQGGG
Sbjct: 76  GGNQGGG 82



>gb:AE014187_939103 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014826_1228179 Plasmodium falciparum 3D7
           chromosome 14 section 11 of 13 of the complete sequence.
          Length = 1455

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 34/149 (22%), Positives = 56/149 (37%), Gaps = 5/149 (3%)
 Frame = -2

Query: 626 KNGLGSHNNDDVLWWGNSFQIHNVAGLLKNMGEEVHNEQDTIRDRQNICHDNDEVEQHK- 450
           KN    +N  +   + N +  +N         ++   +Q  I D+QNIC   +  +Q   
Sbjct: 101 KNNSLENNEINKYDYQNEYNKYNFVDQQNECDQQNICDQQNIYDQQNICDQQNICDQQNI 160

Query: 449 -DKEV*KHSSLVEEVDNGSHG---ILELDMHSRRLDCHQTETAKIHKAPLGPLSNEACQF 282
            D+++      + E  N S       E ++   +  C Q E  KIH        +E C  
Sbjct: 161 CDQQIISEEQNISEEQNISEEQNIFEEQNISEEQNICDQKEDIKIHVD--NKNVHEFCDT 218

Query: 281 DRLDNNMGQTSLDSYGMGNMNPSTFSQNS 195
           D L NN      D     N+     S++S
Sbjct: 219 DNLFNNFSTNKPDEQNNENVPMCLISKSS 247



>gb:BT001273_1356046 Drosophila melanogaster AT05468 full insert
           cDNA.
          Length = 561

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +2

Query: 53  LRSDFFPSFFGLVDRFELTTESSGFVEQIGGFCFSSFLHTLISEGQSYYSVKRWMDSYYP 232
           L  DF+ +F G++  +       G +  +  F  +SFL + +SE +   +V +W  S+  
Sbjct: 498 LTDDFYVAFVGVISGW-------GDLRLLKQFALNSFLFSSLSETEKNMAVSKWQCSWNR 550

Query: 233 YHRNQVMSAPY 265
           + RN V S+ Y
Sbjct: 551 WVRNLVNSSGY 561



>gb:AB025255_1194308 Drosophila melanogaster mRNA for male-specific
           IDGF, complete cds.
          Length = 561

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +2

Query: 53  LRSDFFPSFFGLVDRFELTTESSGFVEQIGGFCFSSFLHTLISEGQSYYSVKRWMDSYYP 232
           L  DF+ +F G++  +       G +  +  F  +SFL + +SE +   +V +W  S+  
Sbjct: 498 LTDDFYVAFVGVISGW-------GDLRLLKQFALNSFLFSSLSETEKNMAVSKWQCSWNR 550

Query: 233 YHRNQVMSAPY 265
           + RN V S+ Y
Sbjct: 551 WVRNLVNSSGY 561



>gb:AE014296_1136796 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003523_1213927 Drosophila melanogaster
           chromosome 3L, section 62 of 83 of the complete
           sequence.
          Length = 561

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 20/71 (28%), Positives = 36/71 (50%)
 Frame = +2

Query: 53  LRSDFFPSFFGLVDRFELTTESSGFVEQIGGFCFSSFLHTLISEGQSYYSVKRWMDSYYP 232
           L  DF+ +F G++  +       G +  +  F  +SFL + +SE +   +V +W  S+  
Sbjct: 498 LTDDFYVAFVGVISGW-------GDLRLLKQFALNSFLFSSLSETEKNMAVSKWQCSWNR 550

Query: 233 YHRNQVMSAPY 265
           + RN V S+ Y
Sbjct: 551 WVRNLVNSSGY 561



>gb:BC047257_2549876 Xenopus laevis similar to membrane protein,
           palmitoylated 1, 55kDa, mRNA (cDNA clone MGC:53500
           IMAGE:5572498), complete cds.
          Length = 460

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 2/69 (2%)
 Frame = -2

Query: 605 NNDDVLWWGNSFQIHNVAGLLKNMGEEVHNEQDTIRDRQN--ICHDNDEVEQHKDKEV*K 432
           N DD  WW    Q    AGL+ +   +      +    QN   C    + ++ KDK + K
Sbjct: 194 NKDDSNWWQGRLQGEGSAGLIPSPELQEWRVASSTTSNQNPQSCSPFSKKKKCKDKYLAK 253

Query: 431 HSSLVEEVD 405
           HSS+ +++D
Sbjct: 254 HSSIFDQLD 262



>gb:AE017346_1757572 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 667

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 3/70 (4%)
 Frame = +2

Query: 224 YYPYHRNQVMSAPYYCPSGQIGRPHLKVDPMVPCEFWPFQFGGNQGGG-YAY--PVPEFH 394
           YYPY  N    + YY PSG     H    P  P  + P++   ++ G  Y+Y  P P + 
Sbjct: 381 YYPYPPNYPPPSGYYPPSG-----HPMPPPPPPSAYDPYRSHMSRSGSPYSYHPPYPPYS 435

Query: 395 GCHYQPPQPS 424
              Y PP  S
Sbjct: 436 APGYPPPPSS 445



>gb:CP000009_863718 Gluconobacter oxydans 621H, complete genome.
          Length = 168

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 2/72 (2%)
 Frame = +2

Query: 188 QSYYSVKRWMDSYYPYHRNQVMSAPYYCPSG-QIGRPHLKVDPMVPCEFWPFQFGGNQGG 364
           Q YY+ ++     YP  + Q M   Y CP G    +P  +  P   C++ P   G +Q G
Sbjct: 97  QGYYNGQQ---GAYPQQQGQYMQPQYQCPRGTTCQQPQYQCPPNTNCQY-PANSGYSQQG 152

Query: 365 GY-AYPVPEFHG 397
           GY   P   + G
Sbjct: 153 GYQQQPAQNYQG 164



>gb:BC081365_2562248 Xenopus tropicalis MGC89895 protein, mRNA (cDNA
           clone MGC:89895 IMAGE:7029639), complete cds.
          Length = 460

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 20/69 (28%), Positives = 31/69 (44%), Gaps = 2/69 (2%)
 Frame = -2

Query: 605 NNDDVLWWGNSFQIHNVAGLLKN--MGEEVHNEQDTIRDRQNICHDNDEVEQHKDKEV*K 432
           N DD  WW    Q    AGL+ +  + E       T       C    + ++ KDK + K
Sbjct: 194 NKDDSNWWQGRLQGEGSAGLIPSPELQEWRVASSSTTNQNPQSCSPFSKKKKCKDKYLAK 253

Query: 431 HSSLVEEVD 405
           HSS+ +++D
Sbjct: 254 HSSIFDQLD 262



>gb:CR382398_1374912 Plasmodium falciparum chromosome 6, complete
           sequence; segment 1/5.
          Length = 1948

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -2

Query: 623 NGLGSHNNDDVLWWGNSFQIHNVAGLLKNMGEEVHNEQDTIRDRQNICHDND 468
           N + + N +D LW   +  I N     K + E+++   D I    NIC++N+
Sbjct: 322 NNIDNKNKEDKLWDDKNIVIKNTKKDSKTIKEKINTYNDNIEINNNICNNNN 373



>gb:AE014188_967922 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014845_1229314 Plasmodium
           falciparum 3D7 chromosome 12, section 2 of 9 of the
           complete sequence.
          Length = 1024

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 20/70 (28%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -2

Query: 470 DEVEQHKDKEV*KHSSLVEEVDNGSH-GILELDMHSRRLDCHQTETAKIHKAPLGPLSNE 294
           ++  +H DK+  K++ L ++  +GSH  IL  + ++ +++C + E   IHK      +NE
Sbjct: 395 EDDNEHADKKK-KNTYLFKDKQDGSHHNILNSNKNNNKINCEENEKGTIHKKNCNQQTNE 453

Query: 293 ACQFDRLDNN 264
                +L+NN
Sbjct: 454 -----QLNNN 458



>gb:BC045260_2549109 Xenopus laevis heterogeneous ribonuclear
           particle protein, mRNA (cDNA clone MGC:52620
           IMAGE:4681284), complete cds.
          Length = 399

 Score = 22.3 bits (46), Expect(4) = 4.2
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = +2

Query: 344 FGGNQGGGY 370
           +GG+QGGGY
Sbjct: 257 YGGSQGGGY 265



 Score = 22.3 bits (46), Expect(4) = 4.2
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = +2

Query: 344 FGGNQGGGY 370
           FGGN+GGG+
Sbjct: 220 FGGNRGGGF 228



 Score = 21.9 bits (45), Expect(4) = 4.2
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 344 FGGNQGGGY 370
           +GG QGGGY
Sbjct: 308 YGGGQGGGY 316



 Score = 21.9 bits (45), Expect(4) = 4.2
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +2

Query: 344 FGGNQGGGY 370
           +GG QGGGY
Sbjct: 300 YGGGQGGGY 308



>gb:PFMAL1P2_1394293 Plasmodium falciparum DNA from MAL1P2.
          Length = 1817

 Score = 33.1 bits (74), Expect = 4.7
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 13/98 (13%)
 Frame = -2

Query: 626 KNGLGSHNNDDVLWWGNSFQIHNVAGLL-----------KNMGEEVHNEQ--DTIRDRQN 486
           KN L   N D VL +     IH     +           K++ +  HN++  D   D+ N
Sbjct: 96  KNNLLLLNQDAVLDYDICNNIHKACVTIELFLKIIILCFKHINDNKHNDKHNDKHNDKHN 155

Query: 485 ICHDNDEVEQHKDKEV*KHSSLVEEVDNGSHGILELDM 372
             H++   + H DK   KH+ +  ++ N  H  +  D+
Sbjct: 156 DIHNDKHNDIHNDKHNDKHNDIHNDIHNDIHNDIHKDV 193



>gb:CR382125_1658271 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 663

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 21/118 (17%), Positives = 48/118 (40%), Gaps = 1/118 (0%)
 Frame = -2

Query: 584 WGNSFQIHNVAGLLKNMGEEVHNEQDTIRDRQNICHDNDEVE-QHKDKEV*KHSSLVEEV 408
           W +  ++  +   +K   E    E++ +   + +  + D ++ + KDKE        +E+
Sbjct: 112 WRSKLKMKFIKSNVKQDQERALKEKEQV---EKLKQERDRIQREEKDKEARLLKKKEQEI 168

Query: 407 DNGSHGILELDMHSRRLDCHQTETAKIHKAPLGPLSNEACQFDRLDNNMGQTSLDSYG 234
           +      ++ ++   +L    T    +H+  + P      Q  R     G+ SLD +G
Sbjct: 169 EKQVRKDVQEELRKTKLKSTDTAERNVHETMMPPTRRSMDQLTRKAETFGRRSLDGFG 226



>gb:CEY11D7A_1369438 Caenorhabditis elegans YAC Y11D7A, complete
            sequence.
          Length = 1464

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 25/90 (27%), Positives = 45/90 (50%)
 Frame = -2

Query: 527  EVHNEQDTIRDRQNICHDNDEVEQHKDKEV*KHSSLVEEVDNGSHGILELDMHSRRLDCH 348
            ++ NE   +R+ QN     D    + +KEV + SSL++E+ N    + + + + +RL   
Sbjct: 948  DLENENQKLRETQN---RQDSHYSNLEKEVMEKSSLIDELQNQIQKLSD-ENNEQRLTIA 1003

Query: 347  QTETAKIHKAPLGPLSNEACQFDRLDNNMG 258
            + ETA         L +E  +F R +N +G
Sbjct: 1004 KLETA---------LEDEKARFARQNNTIG 1024



>pir|T26467|T26467 hypothetical protein Y11D7A.14 - Caenorhabditis
            elegans
          Length = 1413

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 25/90 (27%), Positives = 45/90 (50%)
 Frame = -2

Query: 527  EVHNEQDTIRDRQNICHDNDEVEQHKDKEV*KHSSLVEEVDNGSHGILELDMHSRRLDCH 348
            ++ NE   +R+ QN     D    + +KEV + SSL++E+ N    + + + + +RL   
Sbjct: 897  DLENENQKLRETQN---RQDSHYSNLEKEVMEKSSLIDELQNQIQKLSD-ENNEQRLTIA 952

Query: 347  QTETAKIHKAPLGPLSNEACQFDRLDNNMG 258
            + ETA         L +E  +F R +N +G
Sbjct: 953  KLETA---------LEDEKARFARQNNTIG 973



>gb:BC089300_2566178 Xenopus laevis cDNA clone IMAGE:6867868,
           partial cds.
          Length = 821

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 34/158 (21%), Positives = 60/158 (37%), Gaps = 4/158 (2%)
 Frame = -2

Query: 518 NEQDTIRDRQNICHDNDEVEQHKDKEV*K-HSSLVEEVDNGSHGILELDMHSRRLDCHQ- 345
           N   + R +++  + +  +  HKD      HSS  +  D  SH       H+++ +  + 
Sbjct: 450 NSSKSSRSQKDYQNSSKSIPLHKDPHKSSAHSSFTQ--DFSSH-------HNQKFNSQEL 500

Query: 344 --TETAKIHKAPLGPLSNEACQFDRLDNNMGQTSLDSYGMGNMNPSTFSQNSMIVLQKSK 171
             T++AK HK P       + + D  D+    +            +T  QNS   L   +
Sbjct: 501 SSTQSAKDHKKPNSSSHRSSARHD-YDSESSHSKKRDKTQKRRKEATQQQNSDSDLSPPR 559

Query: 170 CVXXXXXXNHQSVPRIQMTQLSAQIDPPTQKKKEKNRS 57
                   +  S PR       + + PP Q KK+ + S
Sbjct: 560 HTKSRGSDSDLSPPRRTQKDSDSDLSPPRQSKKKGSES 597


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 717,065,765
Number of Sequences: 1806583
Number of extensions: 15136913
Number of successful extensions: 41891
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 39993
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41795
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39068697605
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)