BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3639
         (1062 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|D96563|D96563 probable bZIP protein, 48652-45869 [imported] ...    68   4e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY091053_1574281 Arabidopsis thaliana unknown protein (At5g25...    64   7e-09   
gb:AC132483_1741105 Oryza sativa (japonica cultivar-group) chrom...    61   3e-08   
gb:AP004553_1841483 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:AP003931_1835421 Oryza sativa (japonica cultivar-group) genom...    54   7e-06   
gb:AP003203_1825088 Oryza sativa (japonica cultivar-group) genom...    54   7e-06   
gb:AE016959_1023843 Oryza sativa (japonica cultivar-group) chrom...    52   3e-05   
gb:AY059759_1564614 Arabidopsis thaliana putative bZIP protein (...    50   8e-05   
pir|A86153|A86153 hypothetical protein T7I23.5 - Arabidopsis tha...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AK118990_1816935 Arabidopsis thaliana At2g34670 mRNA for unkn...    45   0.002   
gb:AY125487_1580297 Gossypium hirsutum unknown mRNA.                   45   0.002   
pir|T01368|T01368 hypothetical protein At2g34670 [imported] - Ar...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T00529|T00529 hypothetical protein At2g19090 [imported] - Ar...    44   0.007   Arabidopsis thaliana [mouse-ear cress]
gb:AP006174_1861377 Oryza sativa (japonica cultivar-group) genom...    43   0.009   
pir|T08989|T08989 hypothetical protein F6G3.160 - Arabidopsis th...    43   0.009   Arabidopsis thaliana [mouse-ear cress]
gb:AY735668_1625710 Arabidopsis thaliana hypothetical protein AT...    41   0.047   
pir|T45760|T45760 hypothetical protein F24M12.330 - Arabidopsis ...    40   0.10    Arabidopsis thaliana [mouse-ear cress]
pir|F84668|F84668 hypothetical protein At2g27090 [imported] - Ar...    38   0.39    Arabidopsis thaliana [mouse-ear cress]
pir|D96804|D96804 unknown protein T5M16.9 [imported] - Arabidops...    35   2.0     Arabidopsis thaliana [mouse-ear cress]
gb:AP003813_1833722 Oryza sativa (japonica cultivar-group) genom...    35   2.6     
gb:AC087553_1734122 Oryza sativa (japonica cultivar-group) chrom...    35   2.6     
pir|T05016|T05016 hypothetical protein T19P19.180 - Arabidopsis ...    35   2.6     Arabidopsis thaliana [mouse-ear cress]
pir|T06133|T06133 hypothetical protein F23E12.200 - Arabidopsis ...    35   3.3     Arabidopsis thaliana [mouse-ear cress]
gb:BX897700_829144 Bartonella quintana str. Toulouse, complete g...    34   5.7     
gb:BX897699_827765 Bartonella henselae strain Houston-1, complet...    33   9.7     


>pir|D96563|D96563 probable bZIP protein, 48652-45869 [imported] -
           Arabidopsis thaliana>gb:AE005173_893144 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC037424_1540006 Arabidopsis thaliana
           chromosome 1 BAC F19K6 genomic sequence, complete
           sequence.
          Length = 798

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 32/59 (54%), Positives = 34/59 (57%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC QSKIENEE V RCKERK  MK+                  LKNTGAAL DY+ GE
Sbjct: 1   MGCAQSKIENEEAVTRCKERKQLMKDAVTARNAFAAAHSAYAMALKNTGAALSDYSHGE 59



>gb:AY091053_1574281 Arabidopsis thaliana unknown protein
           (At5g25590) mRNA, complete cds.>gb:AY133786_1581606
           Arabidopsis thaliana clone U19101 unknown protein
           (At5g25590) mRNA, complete cds.
          Length = 775

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 29/60 (48%), Positives = 35/60 (58%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGEA 637
           MGC QS+++NEE VARCKER+  +KE                  LKNTGAAL DY  GE+
Sbjct: 1   MGCAQSRVDNEEAVARCKERRNVIKEAVSASKAFAAGHFAYAIALKNTGAALSDYGHGES 60



>gb:AC132483_1741105 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0014C03, complete sequence.
          Length = 847

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 28/59 (47%), Positives = 35/59 (59%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC QS+IENEE VARCKER+ +MK                   L++TGAAL ++A GE
Sbjct: 1   MGCAQSRIENEEAVARCKERRQWMKSAVQARNAFAAAHSAYAMSLRDTGAALSEFAHGE 59



>gb:AP004553_1841483 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1790_D02.>gb:AP004645_1842560 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1119_B10.
          Length = 247

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 26/58 (44%), Positives = 34/58 (58%)
 Frame = +2

Query: 461 GCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           GC QS+IENEE VA+CKER+ +MK                   L++TGAAL ++A GE
Sbjct: 53  GCAQSRIENEEAVAKCKERRQWMKSVVQARNAFAAVHSAYAMSLRDTGAALFEFAHGE 110



>gb:AP003931_1835421 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1664_D08.>gb:AP005779_1857724 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0042J07.
          Length = 737

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/61 (40%), Positives = 31/61 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGEA 637
           MGC QS  + E  VARC+ERK  +++                  LKN GAAL DYA GE 
Sbjct: 1   MGCAQSNEDGEGPVARCRERKHLLRDAVAARHALAGAHAGHAAALKNVGAALSDYASGEG 60

Query: 638 Q 640
           +
Sbjct: 61  E 61



>gb:AP003203_1825088 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1080D07.
          Length = 752

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 24/59 (40%), Positives = 32/59 (54%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC QSKI+ EE V RC++R+  M +                  LK+TG AL D+A+GE
Sbjct: 1   MGCGQSKIDQEEAVCRCRDRRKLMADAVQARNAFAAAHSAYTVLLKSTGGALSDFAQGE 59



>gb:AE016959_1023843 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AY027588_1559051
           Oryza sativa bZIP protein gene, complete
           cds.>gb:AC079890_1733049 Oryza sativa chromosome 10 BAC
           OSJNBb0089A17 genomic sequence, complete
           sequence.>gb:AE017119_1753662 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 73 of 77 of the
           complete sequence.>gb:AF268596_1782049 Oryza sativa bZIP
           (bZIP) mRNA, complete cds.
          Length = 767

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 31/58 (53%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEG 631
           MGCT SK+E E+TV RCKER+  MKE                  L+ T AAL  +A+G
Sbjct: 1   MGCTASKVEQEDTVRRCKERRRHMKEAVASRQQLASAHADYLRSLRLTAAALSRFAQG 58



>gb:AY059759_1564614 Arabidopsis thaliana putative bZIP protein
           (At3g60320) mRNA, complete cds.
          Length = 796

 Score = 50.1 bits (118), Expect = 8e-05
 Identities = 23/59 (38%), Positives = 31/59 (52%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC  SK++NE+ V RCK+R+  MKE                  L+ TG+AL  +A GE
Sbjct: 1   MGCAASKLDNEDAVRRCKDRRRLMKEAVYARHHLAAAHADYCRSLRITGSALSSFASGE 59



>pir|A86153|A86153 hypothetical protein T7I23.5 - Arabidopsis
           thaliana>gb:AE005172_889258 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:U89959_1726478 Arabidopsis thaliana BAC
           T7I23, complete sequence.
          Length = 655

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 23/59 (38%), Positives = 32/59 (54%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGCT SK+++E+ V RCKER+  MK+                  L+ TG+AL  +A GE
Sbjct: 1   MGCTASKLDSEDAVRRCKERRRLMKDAVYARHHLAAAHSDYCRSLRLTGSALSSFAAGE 59



>gb:AK118990_1816935 Arabidopsis thaliana At2g34670 mRNA for unknown
           protein, complete cds, clone: RAFL21-32-H17.
          Length = 561

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 21/59 (35%), Positives = 28/59 (47%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC  S+I+NEE V  C++RK  MK+                  L+NTG  L  + E E
Sbjct: 1   MGCAASRIDNEEKVLVCRQRKRLMKKLLGFRGEFADAQLAYLRALRNTGVTLRQFTESE 59



>gb:AY125487_1580297 Gossypium hirsutum unknown mRNA.
          Length = 645

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC  S+I+ EE V+RCK RK +MK+                  L+ TG+AL  ++  E
Sbjct: 1   MGCWYSRIDREEIVSRCKARKRYMKQLVKARQTLGASHSMYLRSLRGTGSALLQFSSNE 59



>pir|T01368|T01368 hypothetical protein At2g34670 [imported] -
           Arabidopsis thaliana>gb:AC003096_1531079 Arabidopsis
           thaliana chromosome 2 clone T29F13 map ve016, complete
           sequence.
          Length = 664

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 21/59 (35%), Positives = 28/59 (47%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC  S+I+NEE V  C++RK  MK+                  L+NTG  L  + E E
Sbjct: 1   MGCAASRIDNEEKVLVCRQRKRLMKKLLGFRGEFADAQLAYLRALRNTGVTLRQFTESE 59



>pir|T00529|T00529 hypothetical protein At2g19090 [imported] -
           Arabidopsis thaliana>gb:AC002392_1530655 Arabidopsis
           thaliana chromosome 2 clone T20K24 map CIC06E08,
           complete sequence.
          Length = 844

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDY 622
           MGC+ SK+++EE V  CK+RK F+K+                  L+    ALHD+
Sbjct: 1   MGCSHSKLDDEEAVQICKDRKRFIKQAIEHRTKFASGHIAYIHSLRKVSDALHDF 55



>gb:AP006174_1861377 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0229B10.
          Length = 311

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 21/60 (35%), Positives = 30/60 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGEA 637
           MG  QS++E +E V+RCK R+ + K+                  L+ TGAAL  +A  EA
Sbjct: 1   MGLCQSRLERQEAVSRCKARRRYTKQLVQARRDMAAAHALYLRALRATGAALLQFASAEA 60



>pir|T08989|T08989 hypothetical protein F6G3.160 - Arabidopsis
           thaliana>gb:ATCHRIV72_1546934 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 72.>gb:ATF6G3_1550840
           Arabidopsis thaliana DNA chromosome 4, BAC clone F6G3
           (ESSA project).>gb:AY056278_1563592 Arabidopsis thaliana
           unknown protein (At4g30130) mRNA, complete
           cds.>gb:BT001979_1635582 Arabidopsis thaliana clone
           U11129 unknown protein (At4g30130) mRNA, complete cds.
          Length = 725

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 19/59 (32%), Positives = 29/59 (49%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC+ SK +++E V  CK+RK F+K+                  L+    AL +Y EG+
Sbjct: 1   MGCSHSKFDDDEAVQICKDRKRFIKQAVEHRTGFASGHIAYIQSLRKVSDALREYIEGD 59



>gb:AY735668_1625710 Arabidopsis thaliana hypothetical protein
           AT4G39790 mRNA, complete cds.
          Length = 657

 Score = 40.8 bits (94), Expect = 0.047
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 3/62 (4%)
 Frame = +2

Query: 458 MGCTQSKI---ENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAE 628
           MGC+ SK    +  E +  CKERK F+K+                  L+N GA L  YAE
Sbjct: 9   MGCSNSKASMNKKNEPLHLCKERKRFVKQAMDSRCALAAAHVSYIRSLRNIGACLRQYAE 68

Query: 629 GE 634
            E
Sbjct: 69  AE 70



>pir|T45760|T45760 hypothetical protein F24M12.330 - Arabidopsis
           thaliana>gb:ATF24M12_1549968 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24M12.
          Length = 602

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC QS+I+++E V+RCK RK ++K                   L+  G++L  ++  E
Sbjct: 1   MGCCQSRIDSKEIVSRCKARKRYLKHLVKARQTLSVSHALYLRSLRAVGSSLVHFSSKE 59



>pir|F84668|F84668 hypothetical protein At2g27090 [imported] -
           Arabidopsis thaliana>gb:AC005623_1532857 Arabidopsis
           thaliana chromosome 2 clone T20P8 map B68, complete
           sequence.>gb:BT012583_1641653 Arabidopsis thaliana
           At2g27090 mRNA, complete cds.
          Length = 743

 Score = 37.7 bits (86), Expect = 0.39
 Identities = 17/59 (28%), Positives = 30/59 (50%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MG + S+I+ ++ +  C+ERK F+++                  LK+TG AL  ++E E
Sbjct: 1   MGASTSRIDEDKALQLCRERKKFVQQALDGRCLLAAAHVSYVQSLKSTGTALRKFSETE 59



>pir|D96804|D96804 unknown protein T5M16.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_895273 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC010704_1537019 Arabidopsis thaliana
           chromosome 1 BAC T5M16 genomic sequence, complete
           sequence.>gb:BT002322_1635925 Arabidopsis thaliana clone
           C105014 unknown protein (At1g77500) mRNA, complete cds.
          Length = 879

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 16/59 (27%), Positives = 25/59 (42%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MGC  SK++N+  V  C+ERK  +K                   L + G A+  + + E
Sbjct: 1   MGCGGSKVDNQPIVILCRERKELLKAASYHRSALAVAHLTYFQSLSDVGEAIQRFVDDE 59



>gb:AP003813_1833722 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1150_E04.>gb:AP003818_1833805 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1200_C08.
          Length = 909

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 19/60 (31%), Positives = 27/60 (45%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGEA 637
           MG   SKIE++  +  C+ERK F++E                  L++TG  L    E EA
Sbjct: 218 MGVAPSKIEDDRALVLCQERKRFVREAIDGRCALAAAHCDYIRSLRDTGFLLRKCFEHEA 277



>gb:AC087553_1734122 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 722

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 18/59 (30%), Positives = 23/59 (38%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           MG   SK   E+ +  CKER   +K                   L++ G AL  YAE E
Sbjct: 1   MGSLPSKATGEDALVLCKERMRHIKRAIDSRDALSASHLSYTQSLRSVGTALRRYAESE 59



>pir|T05016|T05016 hypothetical protein T19P19.180 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547963 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATT19P19_1554866 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T19P19 (ESSA project).
          Length = 631

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 17/51 (33%), Positives = 22/51 (43%)
 Frame = +2

Query: 482 ENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGE 634
           +  E +  CKERK F+K+                  L+N GA L  YAE E
Sbjct: 3   KKNEPLHLCKERKRFVKQAMDSRCALAAAHVSYIRSLRNIGACLRQYAEAE 53



>pir|T06133|T06133 hypothetical protein F23E12.200 - Arabidopsis
           thaliana>gb:ATCHRIV83_1547485 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           83.>gb:ATF23E12_1549737 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E12 (ESSA project).
          Length = 828

 Score = 34.7 bits (78), Expect = 3.3
 Identities = 17/62 (27%), Positives = 27/62 (43%)
 Frame = +2

Query: 458 MGCTQSKIENEETVARCKERKMFMKEXXXXXXXXXXXXXXXXXXLKNTGAALHDYAEGEA 637
           MGCT SK+++   VA C+ER  F++                   L+  G +LH +     
Sbjct: 1   MGCTSSKLDDLPAVALCRERCAFLEAAIHQRYALAESHVAYTHSLREIGHSLHLFINHHH 60

Query: 638 QF 643
           +F
Sbjct: 61  RF 62



>gb:BX897700_829144 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 301

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = -3

Query: 478 LRLRTPHRNPDLIHKPLYYIYLHIQTQKTERLRFDQTEICSRIDENR 338
           +RL+ P + PDLI + L+ I++H+   K     + + E  S +DE+R
Sbjct: 146 VRLQKPQQ-PDLIQRKLFTIHMHVYASKNYIANYGKPEKLSELDEHR 191



>gb:BX897699_827765 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 301

 Score = 33.1 bits (74), Expect = 9.7
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = -3

Query: 478 LRLRTPHRNPDLIHKPLYYIYLHIQTQKTERLRFDQTEICSRIDENR 338
           +RL+ P + PDLI K L+ I++H+   K     + + E  S +D +R
Sbjct: 146 VRLQQPQQ-PDLIQKKLFTIHMHVYASKNYIANYGKPEKLSELDNHR 191


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 751,511,450
Number of Sequences: 1806583
Number of extensions: 10271410
Number of successful extensions: 17588
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 17183
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17558
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 81189682800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)