BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3620
         (741 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC104709_1737788 Oryza sativa (japonica cultivar-group) chrom...    70   5e-11   
gb:AY074292_1567451 Arabidopsis thaliana putative E2, ubiquitin-...    69   9e-11   
gb:AP003233_1825863 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AP002909_1823836 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
pir|H84545|H84545 probable ubiquitin-conjugating enzyme [importe...    43   0.007   Arabidopsis thaliana [mouse-ear cress]
gb:BC084952_2564187 Xenopus laevis hypothetical LOC495496, mRNA ...    36   0.84    
gb:AE017247_415561 Treponema denticola ATCC 35405, section 2 of ...    35   1.9     
gb:BA000037_722138 Vibrio vulnificus YJ016 DNA, chromosome I, co...    33   5.4     
gb:BC068807_2555307 Xenopus laevis hypothetical protein MGC81397...    33   7.1     


>gb:AC104709_1737788 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1214_E03, complete sequence.
          Length = 993

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 40/91 (43%), Positives = 46/91 (50%)
 Frame = +2

Query: 467 EHLFGGNAYXXXXXXXXXXXKIDDFLSFERLFSQGDIVCLVKDPSGQTGRXXXXXXXXXX 646
           E  + G+A            KID+FLSFER F  GDIVC   DPSGQ GR          
Sbjct: 144 ELTYCGHAQNILSSLDESIGKIDNFLSFERGFLHGDIVCSAADPSGQLGRVVGVDMLVDL 203

Query: 647 XXXCGHKIREVNSKKLQKIRSMSVGDHVVYG 739
               G  I+ VNSKKL ++RS   GD VV G
Sbjct: 204 ETSSGDIIKHVNSKKLSRVRSFVSGDCVVMG 234



>gb:AY074292_1567451 Arabidopsis thaliana putative E2,
           ubiquitin-conjugating enzyme (At2g33770) mRNA, complete
           cds.>gb:AY091326_1574530 Arabidopsis thaliana putative
           ubiquitin-conjugating enzyme E2 (At2g33770) mRNA,
           complete cds.
          Length = 907

 Score = 68.9 bits (167), Expect = 9e-11
 Identities = 37/91 (40%), Positives = 51/91 (56%)
 Frame = +2

Query: 467 EHLFGGNAYXXXXXXXXXXXKIDDFLSFERLFSQGDIVCLVKDPSGQTGRXXXXXXXXXX 646
           E  +GG A            KID+FLSFER F  GDIV    +PSGQ+GR          
Sbjct: 25  EFSYGGRAQNIFSNLEETIGKIDEFLSFERGFMYGDIVRSATEPSGQSGRVINIDMFVNL 84

Query: 647 XXXCGHKIREVNSKKLQKIRSMSVGDHVVYG 739
               G  ++EV++K+LQK+RS+S+ D+V+ G
Sbjct: 85  ESTHGKIMKEVDTKRLQKLRSISLSDYVING 115



>gb:AP003233_1825863 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0037C04.
          Length = 1063

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/70 (38%), Positives = 36/70 (51%)
 Frame = +2

Query: 530 IDDFLSFERLFSQGDIVCLVKDPSGQTGRXXXXXXXXXXXXXCGHKIREVNSKKLQKIRS 709
           ID  +  +R F  GDIV    DP+GQ G               G  I+ V+SK L++IR 
Sbjct: 125 IDSVVVMDRSFLHGDIVASATDPTGQMGLVADVSLVVDLQGPHGEIIKGVSSKDLRRIRE 184

Query: 710 MSVGDHVVYG 739
            +VGD+VV G
Sbjct: 185 FNVGDYVVSG 194



>gb:AP002909_1823836 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0044F08.
          Length = 1067

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/70 (38%), Positives = 36/70 (51%)
 Frame = +2

Query: 530 IDDFLSFERLFSQGDIVCLVKDPSGQTGRXXXXXXXXXXXXXCGHKIREVNSKKLQKIRS 709
           ID  +  +R F  GDIV    DP+GQ G               G  I+ V+SK L++IR 
Sbjct: 125 IDSVVVMDRSFLHGDIVASATDPTGQMGLVADVSLVVDLQGPHGEIIKGVSSKDLRRIRE 184

Query: 710 MSVGDHVVYG 739
            +VGD+VV G
Sbjct: 185 FNVGDYVVSG 194



>pir|H84545|H84545 probable ubiquitin-conjugating enzyme [imported]
           - Arabidopsis thaliana>gb:AC005167_1532227 Arabidopsis
           thaliana chromosome 2 clone F12A24 map mi398, complete
           sequence.
          Length = 1102

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +2

Query: 530 IDDFLSFERLFSQGDIVCLVKDPSGQTGRXXXXXXXXXXXXXCGHKIREVNSKKLQKIRS 709
           I+D    +R F  GD V    +P+GQ G               G   +++++K L+++R 
Sbjct: 135 INDVTVIDRGFLHGDYVASASEPTGQVGVVVDVNISVDLLAPDGSIHKDISTKNLKRVRD 194

Query: 710 MSVGDHVVYG 739
            +VGD+VV+G
Sbjct: 195 FAVGDYVVHG 204



>gb:BC084952_2564187 Xenopus laevis hypothetical LOC495496, mRNA (cDNA
            clone MGC:83326 IMAGE:6864379), complete cds.
          Length = 1135

 Score = 35.8 bits (81), Expect = 0.84
 Identities = 28/105 (26%), Positives = 47/105 (44%)
 Frame = +1

Query: 46   FKLCQEELNLHFIPDSFKLWESSFSILESLSRFHKYKKKKVFWANLLWQFISKIWGRYLD 225
            F +  +     F+     ++  + S LE+L+  HK   KK+F   +L QF+S +    L 
Sbjct: 987  FIVVMQAFGQSFLQPDIHIFRQNLSYLETLNSKHKLYHKKLFQTGMLPQFVSVL----LQ 1042

Query: 226  LCFTRSDRSRKQII*KHIYNILS*PFSKVVTTSLSINLEKLQSKD 360
            +   +S    ++ I   +YN+ S  FS   +T L   L   Q  D
Sbjct: 1043 VLIHKSHDLLQEEIGIAVYNMASVDFSTFFSTFLPEFLTGCQGLD 1087



>gb:AE017247_415561 Treponema denticola ATCC 35405, section 2 of 10
           of the complete genome.>gb:AE017226_1069157 Treponema
           denticola ATCC 35405, complete genome.
          Length = 189

 Score = 34.7 bits (78), Expect = 1.9
 Identities = 14/52 (26%), Positives = 29/52 (55%)
 Frame = +1

Query: 52  LCQEELNLHFIPDSFKLWESSFSILESLSRFHKYKKKKVFWANLLWQFISKI 207
           +C++  N  ++PD+ K W+  F  L   ++F  Y  +   W+ +L++F  K+
Sbjct: 68  ICRDTRNTWYLPDNVKFWDRRFGSLFE-TKFFCYDDEVETWSKILYKFFVKL 118



>gb:BA000037_722138 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 294

 Score = 33.1 bits (74), Expect = 5.4
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 4/37 (10%)
 Frame = +1

Query: 58  QEELNLHF---IPDSFKLWESSFSILESLSR-FHKYK 156
           ++ELN  F   +P SFKLWE +F++   L + FH+YK
Sbjct: 154 KDELNTAFRLAVPVSFKLWEVNFNVSPRLRKNFHEYK 190



>gb:BC068807_2555307 Xenopus laevis hypothetical protein MGC81397,
            mRNA (cDNA clone MGC:81397 IMAGE:6634905), complete cds.
          Length = 1138

 Score = 32.7 bits (73), Expect = 7.1
 Identities = 27/105 (25%), Positives = 46/105 (43%)
 Frame = +1

Query: 46   FKLCQEELNLHFIPDSFKLWESSFSILESLSRFHKYKKKKVFWANLLWQFISKIWGRYLD 225
            F +  +     F+     ++  + S LE+L+  HK   KK+F   +L QF+S +    L 
Sbjct: 990  FIVVMQAFGQSFLQPDIHIFRQNLSYLETLNSKHKLYHKKLFQTVMLPQFVSVL----LQ 1045

Query: 226  LCFTRSDRSRKQII*KHIYNILS*PFSKVVTTSLSINLEKLQSKD 360
            +   +S    ++ I   +YN+ S  FS   +  L   L   Q  D
Sbjct: 1046 VLIHKSHDLLQEEIGIAVYNMASVDFSTFFSAFLPEFLTGCQGLD 1090


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 722,967,382
Number of Sequences: 1806583
Number of extensions: 13968764
Number of successful extensions: 28867
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 28060
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28862
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 45415179000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)