BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3593
         (927 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY196151_1588912 Solanum tuberosum nematode resistance protei...   176   8e-43   
gb:AY196159_1588915 Solanum tuberosum nematode resistance-like p...   174   2e-42   
gb:AY196153_1588914 Solanum tuberosum nematode resistance-like p...   174   2e-42   
gb:AY196152_1588913 Solanum tuberosum nematode resistance-like p...   169   5e-41   
gb:AF316412_1785536 Helianthus annuus resistance gene analog NBS...   169   7e-41   
gb:PDE416708_1699579 Populus deltoides MER locus, genomic DNA, c...   168   2e-40   
gb:POP490333_1700986 Populus tremula mRNA for NLS-TIR-NBS diseas...   167   3e-40   
gb:PDE416708_1699583 Populus deltoides MER locus, genomic DNA, c...   167   3e-40   
gb:AY535010_1612309 Nicotiana tabacum N-like protein (NH) gene, ...   165   1e-39   
gb:POP490334_1700987 Populus balsamifera subsp. trichocarpa mRNA...   164   2e-39   
gb:AF316405_1785529 Helianthus annuus resistance gene analog PU3...   164   2e-39   
gb:AF093641_1767689 Linum usitatissimum flax rust resistance pro...   164   2e-39   
gb:AB120514_1527964 Nicotiana tabacum N mRNA for truncated N pro...   164   2e-39   
gb:AB120513_1527963 Nicotiana tabacum N mRNA for N protein, part...   164   2e-39   
pir|T18547|T18547 flax rust resistance protein L6, truncated for...   164   2e-39   Linum usitatissimum
pir|T18546|T18546 flax rust resistance protein L6 - flax>gb:LUU2...   164   2e-39   Linum usitatissimum
sp|Q40392|VIRN_NICGU|VIRN_NICGU TMV resistance protein N.>pir|A54810|A54810...   164   2e-39   Nicotiana glutinosa
gb:AF211528_1777388 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...   163   4e-39   
gb:STU300266_1723033 Solanum tuberosum subsp. andigena ry-1 gene...   163   5e-39   
gb:AF093642_1767690 Linum usitatissimum flax rust resistance pro...   162   9e-39   
gb:AF093638_1767686 Linum usitatissimum flax rust resistance pro...   162   9e-39   
gb:STU9720_1723165 Solanum tuberosum mRNA for NL27 protein.           162   9e-39   
gb:AF316414_1785538 Helianthus annuus resistance gene analog NBS...   161   1e-38   
gb:AY154299_1585288 Helianthus annuus cultivar SMF3 NBS-LRR resi...   161   1e-38   
gb:AF093649_1767697 Linum usitatissimum flax rust resistance pro...   161   2e-38   
gb:AF093647_1767695 Linum usitatissimum flax rust resistance pro...   161   2e-38   
gb:AF093645_1767693 Linum usitatissimum flax rust resistance pro...   161   2e-38   
gb:AF093639_1767687 Linum usitatissimum flax rust resistance pro...   161   2e-38   
gb:AC154033_1745252 Solanum demissum chromosome 5 clone PGEC132D...   161   2e-38   
gb:AF316406_1785530 Helianthus annuus resistance gene analog NBS...   160   3e-38   
gb:AF316409_1785533 Helianthus annuus resistance gene analog NBS...   160   4e-38   
gb:STU9719_1723164 Solanum tuberosum mRNA for NL25 protein.           159   6e-38   
gb:AF093648_1767696 Linum usitatissimum flax rust resistance pro...   159   7e-38   
gb:AF093644_1767692 Linum usitatissimum flax rust resistance pro...   159   1e-37   
gb:AF093640_1767688 Linum usitatissimum flax rust resistance pro...   159   1e-37   
gb:PDE416708_1699586 Populus deltoides MER locus, genomic DNA, c...   158   1e-37   
gb:AY438027_1606223 Lycopersicon esculentum bacterial spot disea...   158   1e-37   
gb:AF093646_1767694 Linum usitatissimum flax rust resistance pro...   158   2e-37   
pir|T18548|T18548 flax rust resistance protein M - flax>gb:LUU73...   158   2e-37   Linum usitatissimum
gb:AF316410_1785534 Helianthus annuus resistance gene analog NBS...   157   4e-37   
gb:AF316411_1785535 Helianthus annuus resistance gene analog NBS...   155   8e-37   
gb:AF316413_1785537 Helianthus annuus resistance gene analog NBS...   153   4e-36   
pir|E96682|E96682 hypothetical protein F12P19.1 [imported] - Ara...   153   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF541963_1809969 Glycine max cv Williams 82 BAC clone Gm_ISb0...   152   1e-35   
gb:AF316407_1785531 Helianthus annuus resistance gene analog NBS...   150   3e-35   
gb:LCU516091_1684090 Lens culinaris partial rga gene for putativ...   149   6e-35   
gb:AB016877_1512989 Arabidopsis thaliana genomic DNA, chromosome...   149   8e-35   
gb:AF175394_1774508 Glycine max resistance protein LM12 mRNA, pa...   146   5e-34   
gb:AF541963_1809974 Glycine max cv Williams 82 BAC clone Gm_ISb0...   146   6e-34   
gb:AY363618_1602756 Malus baccata putative TIR-NBS type R protei...   145   8e-34   
gb:AY363616_1602754 Malus baccata putative TIR-NBS type R protei...   145   8e-34   
gb:AF541963_1809958 Glycine max cv Williams 82 BAC clone Gm_ISb0...   145   1e-33   
gb:LUS310150_1685453 Linum usitatissimum variety Bombay Ngc-D, N...   145   1e-33   
gb:LUS310158_1685465 Linum usitatissimum N2-C gene.                   145   1e-33   
gb:LUS310159_1685466 Linum usitatissimum N2-D gene.                   144   2e-33   
gb:LUS310155_1685462 Linum usitatissimum N1-D gene.                   144   2e-33   
gb:LUS310163_1685470 Linum usitatissimum Nbi-D gene.                  143   4e-33   
gb:LUS310156_1685463 Linum usitatissimum N2-A gene.                   142   7e-33   
gb:LUS310150_1685455 Linum usitatissimum variety Bombay Ngc-D, N...   142   7e-33   
gb:LUS310154_1685461 Linum usitatissimum N1-C gene.                   142   9e-33   
pir|A96607|A96607 protein disease resistance protein F25P12.101 ...   142   9e-33   Arabidopsis thaliana [mouse-ear cress]
gb:LUS310164_1685471 Linum usitatissimum Nho-C gene.                  142   1e-32   
gb:LUS310162_1685469 Linum usitatissimum Nbi-C gene.                  142   1e-32   
gb:LUS310151_1685458 Linum usitatissimum Ngc-C gene.                  142   1e-32   
gb:AF541963_1809968 Glycine max cv Williams 82 BAC clone Gm_ISb0...   141   2e-32   
gb:AF098964_1767942 Arabidopsis thaliana disease resistance prot...   141   2e-32   
gb:AY364465_1602834 Malus x domestica putative TIR-NBS type R pr...   141   2e-32   
gb:AB019223_1514024 Arabidopsis thaliana genomic DNA, chromosome...   141   2e-32   
pir|T52348|T52348 disease resistance protein RPP1-WsC [imported]...   141   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AF541963_1809963 Glycine max cv Williams 82 BAC clone Gm_ISb0...   140   3e-32   
pir|T47438|T47438 disease resistance protein homolog - Arabidops...   140   5e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AF403250_1796427 Glycine max disease resistance-like protein ...   139   6e-32   
gb:AF327903_1786903 Glycine max functional candidate resistance ...   139   6e-32   
gb:LUS310153_1685460 Linum usitatissimum N1-B gene.                   139   6e-32   
gb:LUS310152_1685459 Linum usitatissimum N1-A gene.                   139   6e-32   
pir|E96662|E96662 hypothetical protein F24D7.7 [imported] - Arab...   139   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AF541963_1809973 Glycine max cv Williams 82 BAC clone Gm_ISb0...   139   8e-32   
gb:LUS310157_1685464 Linum usitatissimum N2-B gene.                   139   8e-32   
gb:LUS310150_1685457 Linum usitatissimum variety Bombay Ngc-D, N...   139   8e-32   
gb:AF541963_1809970 Glycine max cv Williams 82 BAC clone Gm_ISb0...   139   1e-31   
gb:AF217489_1778133 Glycine max clone A 75-10 unknown gene, part...   139   1e-31   
gb:AY193892_1588838 Glycine max candidate disease-resistance pro...   139   1e-31   
pir|A85096|A85096 hypothetical protein AT4g09430 [imported] - Ar...   138   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AB006706_1510012 Arabidopsis thaliana genomic DNA, chromosome...   138   2e-31   
gb:AB005233_1509310 Arabidopsis thaliana genomic DNA, chromosome...   138   2e-31   
gb:AB024029_1515748 Arabidopsis thaliana genomic DNA, chromosome...   137   2e-31   
gb:AB006699_1509886 Arabidopsis thaliana genomic DNA, chromosome...   137   2e-31   
pir|T48928|T48928 disease resistance protein-like - Arabidopsis ...   137   2e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T52346|T52346 disease resistance protein RPP1-WsA [imported]...   137   3e-31   Arabidopsis thaliana [mouse-ear cress]
pir|E96685|E96685 probable disease resistance protein F15E12.17 ...   137   3e-31   Arabidopsis thaliana [mouse-ear cress]
pir|D96662|D96662 hypothetical protein F24D7.8 [imported] - Arab...   137   3e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T14515|T14515 hypothetical protein C18G5.30 - Arabidopsis th...   137   4e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T47430|T47430 disease resistence-like protein - Arabidopsis ...   136   5e-31   Arabidopsis thaliana [mouse-ear cress]
gb:AF098963_1767941 Arabidopsis thaliana disease resistance prot...   135   9e-31   
pir|T52347|T52347 disease resistance protein RPP1-WsB [imported]...   135   9e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T47442|T47442 disease resistance protein homlog - Arabidopsi...   135   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY363617_1602755 Malus baccata TIR-NBS-LRR type R protein 7 (...   135   1e-30   
gb:AY088733_1573747 Arabidopsis thaliana clone 93530 mRNA, compl...   135   1e-30   
gb:AF541963_1809972 Glycine max cv Williams 82 BAC clone Gm_ISb0...   134   2e-30   
pir|T08196|T08196 hypothetical protein T22B4.150 - Arabidopsis t...   134   2e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T01916|T01916 hypothetical protein F2P3.8 - Arabidopsis thal...   134   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AF322632_1786134 Glycine max putative resistance protein (L20...   134   3e-30   
gb:AF175395_1774509 Glycine max resistance protein MG23 mRNA, pa...   134   3e-30   
pir|B96754|B96754 Similar to part of disease resistance protein ...   134   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AF499727_1806151 Cucumis melo BAC clone PIT92-60K17, complete...   133   4e-30   
gb:AB018109_1513751 Arabidopsis thaliana genomic DNA, chromosome...   133   4e-30   
gb:AF499727_1806152 Cucumis melo BAC clone PIT92-60K17, complete...   133   6e-30   
pir|F96753|F96753 Similar to downy mildew resistance protein RPP...   132   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF175388_1774502 Glycine max resistance protein LM6 precursor...   131   2e-29   
pir|A96754|A96754 Similar to part of disease resistance protein ...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF083734_1766964 Arabidopsis thaliana clone sps388 unknown mRNA.   131   2e-29   
pir|C96754|C96754 Similar to part of disease resistance protein ...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF188334_1775225 Arabidopsis thaliana Toll/interleukin-1 rece...   130   3e-29   
gb:AB017065_1513377 Arabidopsis thaliana genomic DNA, chromosome...   130   3e-29   
gb:AE005173_894066 Arabidopsis thaliana chromosome 1, bottom arm...   130   3e-29   
gb:AF502079_1806600 Glycine max resistance protein KR3 mRNA, com...   130   5e-29   
gb:AY099648_1576673 Arabidopsis thaliana disease resistance prot...   130   5e-29   
pir|D96754|D96754 Similar to part of disease resistance protein ...   130   5e-29   Arabidopsis thaliana [mouse-ear cress]
pir|C84545|C84545 probable disease resistance protein [imported]...   129   6e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AB019223_1514026 Arabidopsis thaliana genomic DNA, chromosome...   129   8e-29   
pir|F71436|F71436 hypothetical protein - Arabidopsis thaliana         129   8e-29   Arabidopsis thaliana [mouse-ear cress]
pir|E96754|E96754 Similar to downy mildew resistance protein RPP...   129   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AK175233_1817221 Arabidopsis thaliana mRNA for disease resist...   129   1e-28   
gb:BT005928_1638850 Arabidopsis thaliana At4g16990 gene, complet...   129   1e-28   
gb:BT002524_1636127 Arabidopsis thaliana Unknown protein mRNA, c...   129   1e-28   
gb:ATH299417_1552413 Arabidopsis thaliana mRNA for hypothetical ...   129   1e-28   
gb:AB019223_1514027 Arabidopsis thaliana genomic DNA, chromosome...   129   1e-28   
pir|F85189|F85189 disease resistance RPP5 like protein (partial)...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
pir|F96754|F96754 Similar to NL27 [imported] - Arabidopsis thali...   129   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AC022492_1539059 Genomic sequence for Arabidopsis thaliana BA...   128   1e-28   
gb:AF175399_1774513 Glycine max resistance protein MG13 mRNA, pa...   128   2e-28   
gb:AF139523_1771437 Tagetes erecta disease-resistance protein NR...   128   2e-28   
gb:ATAC016829_1543647 Arabidopsis thaliana chromosome III BAC T6...   127   3e-28   
gb:AB009048_1510578 Arabidopsis thaliana genomic DNA, chromosome...   127   3e-28   
gb:AB005233_1509309 Arabidopsis thaliana genomic DNA, chromosome...   127   3e-28   
gb:AF440696_1800093 Arabidopsis thaliana disease resistance prot...   127   4e-28   
gb:AY120755_1579637 Arabidopsis thaliana disease resistance RPP5...   127   4e-28   
gb:AC006528_1534363 Arabidopsis thaliana chromosome 2 clone F9B2...   127   4e-28   
pir|C71436|C71436 probable resistance gene - Arabidopsis thalian...   127   4e-28   Arabidopsis thaliana [mouse-ear cress]
pir|H84513|H84513 probable disease resistance protein [imported]...   127   4e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY099773_1576798 Arabidopsis thaliana disease resistance gene...   126   5e-28   
gb:AC074360_1541422 Arabidopsis thaliana chromosome 1 BAC F27M3 ...   126   5e-28   
gb:AC027135_1539890 Arabidopsis thaliana chromosome 1 BAC T8E3 g...   126   5e-28   
gb:STU300266_1723034 Solanum tuberosum subsp. andigena ry-1 gene...   126   7e-28   
gb:AY179750_1587463 Arabidopsis thaliana TIR-NBS-LRR (SSI4) gene...   126   7e-28   
gb:AB011481_1511464 Arabidopsis thaliana genomic DNA, chromosome...   126   7e-28   
gb:AB025639_1516695 Arabidopsis thaliana genomic DNA, chromosome...   125   9e-28   
gb:AB025635_1516627 Arabidopsis thaliana genomic DNA, chromosome...   125   2e-27   
pir|G71437|G71437 probable resistance gene - Arabidopsis thaliana     124   2e-27   Arabidopsis thaliana [mouse-ear cress]
pir|C85189|C85189 disease resistance RPP5 like protein [imported...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
pir|A85189|A85189 disease resistance RPP5 like protein [imported...   124   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AK119099_1817041 Arabidopsis thaliana At4g16860 mRNA for puta...   124   3e-27   
gb:AF541963_1809966 Glycine max cv Williams 82 BAC clone Gm_ISb0...   124   3e-27   
gb:AF541963_1809960 Glycine max cv Williams 82 BAC clone Gm_ISb0...   124   3e-27   
gb:AK119065_1817010 Arabidopsis thaliana At1g63880 mRNA for puta...   123   4e-27   
gb:AY522496_1611363 Arabidopsis thaliana TIR-NBS-LRR (RAC1) gene...   123   4e-27   
gb:AE005172_891596 Arabidopsis thaliana chromosome 1, top arm co...   123   4e-27   
pir|H96663|H96663 hypothetical protein T12P18.10 [imported] - Ar...   123   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AC058785_1540226 Arabidopsis thaliana chromosome 1 BAC F13N6 ...   123   6e-27   
gb:AB022222_1515163 Arabidopsis thaliana genomic DNA, chromosome...   123   6e-27   
pir|H96606|H96606 hypothetical protein F25P12.102 [imported] - A...   123   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AB022222_1515160 Arabidopsis thaliana genomic DNA, chromosome...   122   8e-27   
gb:AB011477_1511421 Arabidopsis thaliana genomic DNA, chromosome...   122   8e-27   
gb:ATF2I11_1550473 Arabidopsis thaliana DNA chromosome 5, BAC cl...   122   1e-26   
pir|G96754|G96754 hypothetical protein F3N23.15 [imported] - Ara...   122   1e-26   Arabidopsis thaliana [mouse-ear cress]
pir|B85189|B85189 disease resistance RPP5 like protein [imported...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
pir|F96662|F96662 hypothetical protein F24D7.6 [imported] - Arab...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
pir|B86398|B86398 protein T7N9.24 [imported] - Arabidopsis thali...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AY093215_1575169 Arabidopsis thaliana disease resistance prot...   120   3e-26   
gb:AY054221_1563042 Arabidopsis thaliana At1g63870/T12P18_11 mRN...   120   3e-26   
gb:AB012242_1511715 Arabidopsis thaliana genomic DNA, chromosome...   120   3e-26   
gb:ATCHRIV45_1545493 Arabidopsis thaliana DNA chromosome 4, cont...   120   4e-26   
pir|A71437|A71437 probable resistance gene - Arabidopsis thalian...   120   4e-26   Arabidopsis thaliana [mouse-ear cress]
pir|G85188|G85188 disease resistance RPP5 like protein [imported...   120   4e-26   Arabidopsis thaliana [mouse-ear cress]
pir|G96606|G96606 disease resistance protein [imported] - Arabid...   120   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb:ATRPP5LE2_1554110 Arabidopsis thaliana RPP5 disease resistanc...   120   5e-26   
gb:AB011481_1511465 Arabidopsis thaliana genomic DNA, chromosome...   120   5e-26   
gb:AK175839_1817827 Arabidopsis thaliana mRNA for putative disea...   119   8e-26   
gb:AB010698_1511218 Arabidopsis thaliana genomic DNA, chromosome...   119   8e-26   
pir|T06608|T06608 disease resistance protein homolog F16J13.80 -...   119   8e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AY039923_1560436 Arabidopsis thaliana putative disease resist...   119   1e-25   
gb:AC073178_1541009 Arabidopsis thaliana chromosome 1 BAC F10D13...   119   1e-25   
gb:AY143973_1583430 Arabidopsis thaliana At3g04210/T6K12_17 mRNA...   118   1e-25   
gb:AY057522_1563940 Arabidopsis thaliana AT3g04210/T6K12_17 mRNA...   118   1e-25   
gb:ATAC016829_1543648 Arabidopsis thaliana chromosome III BAC T6...   118   1e-25   
gb:AC022492_1539060 Genomic sequence for Arabidopsis thaliana BA...   118   1e-25   
gb:AB019223_1514031 Arabidopsis thaliana genomic DNA, chromosome...   118   1e-25   
pir|T06143|T06143 disease resistence protein homolog F24J7.60 - ...   118   1e-25   Arabidopsis thaliana [mouse-ear cress]
pir|E71437|E71437 probable resistance gene - Arabidopsis thaliana     118   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AB019223_1514030 Arabidopsis thaliana genomic DNA, chromosome...   117   2e-25   
gb:AB010698_1511217 Arabidopsis thaliana genomic DNA, chromosome...   117   2e-25   
pir|D96753|D96753 Similar to disease resistance proteins [import...   117   2e-25   Arabidopsis thaliana [mouse-ear cress]
pir|H71436|H71436 hypothetical protein - Arabidopsis thaliana         117   3e-25   Arabidopsis thaliana [mouse-ear cress]
pir|D85188|D85188 disease resistance RPP5 like protein [imported...   117   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AY830391_1629352 Brassica rapa disease resistance-like protei...   116   7e-25   
gb:AY510018_1610308 Arabidopsis thaliana SNC1-like protein (SNW)...   115   9e-25   
gb:AY057653_1564066 Arabidopsis thaliana AT5g46490/K11I1_8 mRNA,...   115   1e-24   
gb:AB019223_1514028 Arabidopsis thaliana genomic DNA, chromosome...   115   1e-24   
gb:AB015473_1512540 Arabidopsis thaliana genomic DNA, chromosome...   114   3e-24   
pir|G96663|G96663 hypothetical protein T12P18.11 [imported] - Ar...   114   4e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY820142_1628814 Brassica rapa disease resistance-like protei...   113   5e-24   
gb:AY091566_1574671 Pinus taeda putative TIR/NBS/LRR disease res...   113   5e-24   
pir|B71437|B71437 probable resistance gene - Arabidopsis thaliana     113   5e-24   Arabidopsis thaliana [mouse-ear cress]
pir|D71437|D71437 probable resistance gene - Arabidopsis thaliana     112   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AF541963_1809959 Glycine max cv Williams 82 BAC clone Gm_ISb0...   111   2e-23   
pir|D84729|D84729 probable disease resistance protein [imported]...   111   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AF322633_1786135 Glycine max putative resistance protein (L33...   110   5e-23   
pir|T01463|T01463 hypothetical protein T24H24.18 - Arabidopsis t...   110   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AB019224_1514034 Arabidopsis thaliana genomic DNA, chromosome...   109   7e-23   
pir|E96610|E96610 probable disease resistance protein RPP1-WsB [...   109   9e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AC006081_1533426 Arabidopsis thaliana chromosome 2 clone T2G1...   108   1e-22   
gb:AY099745_1576770 Arabidopsis thaliana putative disease resist...   108   1e-22   
pir|F71405|F71405 probable TMV resistance protein - Arabidopsis ...   108   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AF316418_1785542 Helianthus annuus resistance gene analog NBS...   106   6e-22   
gb:AF316416_1785540 Helianthus annuus resistance gene analog NBS...   104   2e-21   
gb:AY187301_1588155 Manihot esculenta RCa11 gene, partial cds.        104   2e-21   
gb:AB011480_1511453 Arabidopsis thaliana genomic DNA, chromosome...   103   4e-21   
gb:AX765792_1474585 Sequence 1 from Patent WO03008440.>gb:AB0122...   103   6e-21   
pir|T06145|T06145 disease resistance protein homolog F24J7.80 - ...   103   6e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AF528682_1808707 Arabidopsis lyrata T8F5.18 gene, partial cds.     102   1e-20   
pir|T06144|T06144 disease resistance protein homolog F24J7.70 - ...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AB019224_1514033 Arabidopsis thaliana genomic DNA, chromosome...   100   4e-20   
gb:AF528690_1808715 Arabidopsis thaliana ecotype Cvi-0 T8F5.18 g...   100   5e-20   
gb:AF528689_1808714 Arabidopsis thaliana ecotype Kas-1 T8F5.18 g...   100   5e-20   
gb:AF083726_1766956 Arabidopsis thaliana clone sps358 unknown mRNA.   100   5e-20   
pir|T06146|T06146 disease resistance protein homolog F24J7.90 - ...   100   5e-20   Arabidopsis thaliana [mouse-ear cress]
gb:BT010754_1640700 Arabidopsis thaliana At5g44900 gene, complet...    99   9e-20   
gb:AB010693_1511127 Arabidopsis thaliana genomic DNA, chromosome...    99   9e-20   
gb:AY091563_1574668 Pinus taeda TIR/P-loop/LRR mRNA, complete cds.     99   1e-19   
gb:AB010693_1511138 Arabidopsis thaliana genomic DNA, chromosome...    99   2e-19   
pir|A71438|A71438 probable resistance protein - Arabidopsis thal...    98   2e-19   Arabidopsis thaliana [mouse-ear cress]
pir|F96612|F96612 probable disease resistance protein RPS4 F12K2...    98   3e-19   Arabidopsis thaliana [mouse-ear cress]
pir|T04584|T04584 TMV resistance protein N homolog F23E13.40 - A...    97   3e-19   Arabidopsis thaliana [mouse-ear cress]
gb:ATH249264_1552132 Arabidopsis thaliana RPS4-Ler gene for dise...    97   4e-19   
pir|T51141|T51141 disease resistance protein rps4 [imported] - A...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
pir|T51140|T51140 disease resistance protein RPS4 [imported] - A...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
pir|T02283|T02283 probable disease resistance protein T13D8.20 -...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AB010693_1511129 Arabidopsis thaliana genomic DNA, chromosome...    97   6e-19   
gb:AY271889_1594225 Manihot esculenta RCa12.2 TIR type resistanc...    96   8e-19   
gb:AY187302_1588156 Manihot esculenta RCa12 gene, partial cds.         96   1e-18   
pir|T04583|T04583 TMV resistance protein N homolog F23E13.30 - A...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
pir|T45788|T45788 probable disease resistance protein F26O13.210...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AB012240_1511687 Arabidopsis thaliana genomic DNA, chromosome...    95   2e-18   
gb:AF369886_1791987 Pisum sativum TIR-similar-domain-containing ...    94   3e-18   
gb:AF528686_1808711 Arabidopsis thaliana ecotype Bla-1 T8F5.18 g...    93   6e-18   
gb:AF325110_1786564 Arabidopsis thaliana hypothetical protein (T...    93   6e-18   
gb:AF316415_1785539 Helianthus annuus resistance gene analog NBS...    93   6e-18   
pir|T02363|T02363 hypothetical protein T8F5.18 - Arabidopsis tha...    93   6e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AF316417_1785541 Helianthus annuus resistance gene analog NBS...    93   8e-18   
pir|T05389|T05389 hypothetical protein F16G20.210 - Arabidopsis ...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
pir|G96612|G96612 probable disease resistance protein RPS4 F12K2...    92   1e-17   Arabidopsis thaliana [mouse-ear cress]
pir|E84443|E84443 probable disease resistance protein [imported]...    91   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AF316408_1785532 Helianthus annuus resistance gene analog NBS...    91   3e-17   
gb:AC151803_1745117 Solanum demissum chromosome 5 BAC PGEC979H09...    91   4e-17   
gb:AB012240_1511688 Arabidopsis thaliana genomic DNA, chromosome...    90   5e-17   
pir|E96550|E96550 hypothetical protein F11M15.13 [imported] - Ar...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
pir|T02696|T02696 probable disease resistance protein [imported]...    90   5e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AF175396S1_1774510 Glycine max resistance protein MG55 mRNA, ...    89   9e-17   
gb:AF541963_1809957 Glycine max cv Williams 82 BAC clone Gm_ISb0...    89   1e-16   
pir|A96611|A96611 probable disease resistance protein RPS4 [impo...    89   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AY271888_1594224 Manihot esculenta RCa12.1 TIR type resistanc...    88   3e-16   
gb:AY271890_1594226 Manihot esculenta RCa12.3 TIR type resistanc...    87   4e-16   
gb:AB010693_1511123 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
pir|D96514|D96514 hypothetical protein T3F24.3 [imported] - Arab...    86   8e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AF310966_1785058 Linum usitatissimum cv. 'Koto' resistance-li...    86   1e-15   
gb:AF310960_1785053 Linum usitatissimum cv. 'Abyssinian' resista...    86   1e-15   
gb:AF310964_1785057 Linum usitatissimum cv. 'CI 1911 Punjab' res...    85   2e-15   
gb:AF310968_1785059 Linum usitatissimum cv. 'Hoshangabad' resist...    84   3e-15   
pir|T04876|T04876 hypothetical protein F18F4.20 - Arabidopsis th...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF310962_1785056 Linum usitatissimum cv. 'Leona' resistance-l...    84   5e-15   
gb:AF310961_1785055 Linum usitatissimum cv. 'Leona' resistance-l...    84   5e-15   
gb:AF310960_1785052 Linum usitatissimum cv. 'Abyssinian' resista...    84   5e-15   
gb:AF310959_1785051 Linum usitatissimum cv. 'Akmolinsk' resistan...    84   5e-15   
gb:AF310958_1785050 Linum usitatissimum cv. 'Akmolinsk' resistan...    84   5e-15   
pir|T13025|T13025 hypothetical protein F8L21.130 - Arabidopsis t...    84   5e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AK176273_1818261 Arabidopsis thaliana mRNA, complete cds, clo...    83   9e-15   
pir|G96753|G96753 Similar to disease resistance protein NL25 [im...    83   9e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AB010693_1511128 Arabidopsis thaliana genomic DNA, chromosome...    81   3e-14   
gb:AY091559_1574664 Pinus taeda TIR/X mRNA, partial cds.               81   3e-14   
gb:AB012240_1511685 Arabidopsis thaliana genomic DNA, chromosome...    81   3e-14   
pir|C96570|C96570 hypothetical protein F14G24.17 [imported] - Ar...    81   3e-14   
gb:AB019224_1514035 Arabidopsis thaliana genomic DNA, chromosome...    80   7e-14   
pir|E96753|E96753 hypothetical protein F3N23.5 [imported] - Arab...    78   3e-13   
gb:AF478179_1803266 Phaseolus vulgaris TIR-like putative resista...    77   4e-13   
gb:AP003866_1834538 Oryza sativa (japonica cultivar-group) genom...    77   6e-13   
gb:AF478182_1803269 Phaseolus vulgaris TIR-like putative resista...    76   1e-12   
pir|H85095|H85095 hypothetical protein AT4g09420 [imported] - Ar...    76   1e-12   
gb:AF478178_1803265 Phaseolus vulgaris TIR-like putative resista...    74   5e-12   
gb:AF478177_1803264 Phaseolus vulgaris TIR-like putative resista...    73   9e-12   
gb:AF478181_1803268 Phaseolus vulgaris TIR-like putative resista...    69   1e-10   
gb:AF175389_1774503 Glycine max resistance protein LM17 precurso...    66   8e-10   
gb:AB012240_1511686 Arabidopsis thaliana genomic DNA, chromosome...    66   1e-09   
gb:AF499727_1806150 Cucumis melo BAC clone PIT92-60K17, complete...    64   5e-09   
pir|G96636|G96636 hypothetical protein F11P17.17 [imported] - Ar...    62   1e-08   
pir|T45787|T45787 disease resistance-like protein - Arabidopsis ...    60   6e-08   
gb:AY705376_1623726 Gossypium hirsutum clone Ghi_RGA-A9 NBS resi...    60   8e-08   
gb:AF541963_1809962 Glycine max cv Williams 82 BAC clone Gm_ISb0...    57   4e-07   
pir|E84547|E84547 probable disease resistance protein [imported]...    57   7e-07   
gb:AY091556S1_1574661 Pinus taeda putative TIR/NBS/LRR disease r...    55   1e-06   
gb:AF258292_1781414 Brassica oleracea cultivar Rapid Cycling dis...    53   7e-06   
gb:AE016762_326402 Escherichia coli CFT073 section 8 of 18 of th...    53   1e-05   
gb:AF478183_1803270 Phaseolus vulgaris TIR-like putative resista...    52   2e-05   
gb:AF469073_1802492 Gossypium hirsutum clone GhRGA_A NBS resista...    52   2e-05   
gb:AF258291_1781413 Brassica rapa cultivar R500 disease resistan...    49   1e-04   
gb:AF258290_1781412 Brassica napus cultivar Darmor disease resis...    49   1e-04   
gb:BX571857_782254 Staphylococcus aureus strain MSSA476, complet...    49   2e-04   
gb:AY091562_1574667 Pinus taeda TIR/NBS mRNA, partial cds.             48   3e-04   
pir|AD3461|AD3461 hypothetical protein BMEI1674 [imported] - Bru...    47   5e-04   
gb:AF258289_1781411 Brassica napus cultivar Darmor disease resis...    46   0.001   
sp|Q9SZ67|WR19_ARATH|WR19_ARATH Probable WRKY transcription factor 19 (WRKY...    45   0.003   
pir|C71437|C71437 probable resistance gene - Arabidopsis thalian...    44   0.004   
sp|Q9FL92|WR16_ARATH|WR16_ARATH Probable WRKY transcription factor 16 (WRKY...    44   0.004   
gb:AK118695_1816658 Arabidopsis thaliana At5g46480 mRNA for puta...    43   0.010   
gb:AF152547_2056764 Rattus norvegicus Sam68-like protein SLM-2 (...    42   0.022   
gb:BC068536_1987677 Homo sapiens KH domain containing, RNA bindi...    41   0.038   
gb:AB025635_1516626 Arabidopsis thaliana genomic DNA, chromosome...    41   0.038   
gb:AK117156_1815203 Arabidopsis thaliana At5g45260 mRNA for puta...    40   0.049   
gb:AF478180_1803267 Phaseolus vulgaris TIR-like putative resista...    40   0.049   
gb:AB022222_1515162 Arabidopsis thaliana genomic DNA, chromosome...    40   0.049   
gb:AB020744_1514582 Arabidopsis thaliana genomic DNA, chromosome...    40   0.049   
sp|Q9FH83|WR52_ARATH|WR52_ARATH Probable WRKY transcription factor 52 (WRKY...    40   0.049   
gb:AF099092_2054440 Mus musculus SLM-2 (Slm2) mRNA, complete cds...    40   0.064   
gb:AF079763_2053713 Mus musculus ETOILE (etoile) mRNA, complete ...    40   0.064   
gb:AF051322_1879169 Homo sapiens Sam68-like phosphotyrosine prot...    40   0.064   
gb:AF051321_1879168 Homo sapiens Sam68-like phosphotyrosine prot...    40   0.064   
gb:AF140019_1244283 Drosophila melanogaster Toll like protein (T...    40   0.064   
gb:BA000037_722752 Vibrio vulnificus YJ016 DNA, chromosome I, co...    40   0.064   
gb:AF247767_1255261 Drosophila melanogaster Toll-5 mRNA, complet...    40   0.084   
gb:AE014134_1129052 Drosophila melanogaster chromosome 2L, compl...    40   0.084   
gb:BA000039_727244 Thermosynechococcus elongatus BP-1 DNA, compl...    38   0.24    
pir|F84547|F84547 probable disease resistance protein [imported]...    38   0.24    
gb:AE010582_264619 Fusobacterium nucleatum subsp. nucleatum ATCC...    38   0.32    
gb:AY510706_2085802 Mus musculus toll-like receptor 13 (Tlr13) m...    37   0.42    
gb:AC104710_1737802 Oryza sativa (japonica cultivar-group) chrom...    37   0.71    
gb:AF487534_1276125 Anopheles gambiae cytochrome P450 CYP6P3 (cy...    37   0.71    
pir|T35718|T35718 hypothetical protein SC7H1.23 SC7H1.23 - Strep...    37   0.71    
gb:AY349892_1322007 Drosophila simulans strain Sim7 tehao gene, ...    36   0.93    
gb:AY349890_1322005 Drosophila simulans strain Sim5 tehao gene, ...    36   0.93    
gb:AY349886_1322001 Drosophila simulans strain Sim1 tehao gene, ...    36   0.93    
gb:AGA535207_1281952 Anopheles gambiae mRNA for SMC5 protein.          36   0.93    
gb:CEC46E1_1361279 Caenorhabditis elegans cosmid C46E1, complete...    36   1.2     
gb:AY652945_1344236 Caenorhabditis elegans guanylate cyclase-lik...    36   1.2     
pir|T19968|T19968 hypothetical protein C46E1.2 - Caenorhabditis ...    36   1.2     
gb:BX294153_771258 Pirellula sp. strain 1 complete genome; segme...    35   1.6     
gb:AC007229_1875234 Homo sapiens chromosome 19, cosmid R34187, c...    35   2.1     
gb:CR860172_1184259 Pongo pygmaeus mRNA; cDNA DKFZp469D011 (from...    35   2.1     
gb:AE014188_968193 Plasmodium falciparum 3D7 chromosome 12, comp...    35   2.7     
gb:AY128947_1302149 Anopheles minimus cytochrome P450 (CYP6P6) g...    34   3.5     
gb:MMU17961_2118648 Mus musculus p62 mRNA, complete cds.               34   4.6     
gb:AF305618_2062275 Rattus norvegicus nuclear RNA binding protei...    33   6.0     
gb:AF098796_2054420 Mus musculus SLM-1 (Slm1) mRNA, complete cds.      33   6.0     
gb:BC034043_1981185 Homo sapiens KH domain containing, RNA bindi...    33   6.0     
gb:AL138882_1920053 Human DNA sequence from clone RP1-195K21 on ...    33   6.0     
gb:AF176669_1774584 Citrus limon NADP-isocitrate dehydrogenase m...    33   6.0     
gb:AF190041_1249449 Molops piceus NADH dehydrogenase subunit 5 (...    33   6.0     
pir|D96519|D96519 mysoin-like protein, 11013-7318 [imported] - A...    33   6.0     
sp|Q9ZB73|Y33B_MYCGE|Y33B_MYCGE Hypothetical protein MG335.2.>gb:U39714_205...    33   6.0     
gb:AF204951_2214205 Ectocarpus siliculosus virus, complete genome.     33   7.9     
gb:D50347_1376173 Cychrus morawitzi mitochondrial DNA for NADH d...    33   7.9     
gb:AY089639_1297295 Drosophila melanogaster RE56519 full insert ...    33   7.9     
gb:AB185387_1202702 Calosoma sycophanta sycophanta ND5 gene for ...    33   7.9     
gb:AE014297_1139766 Drosophila melanogaster chromosome 3R, compl...    33   7.9     
pir|T13925|T13925 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) ...    33   7.9     


>gb:AY196151_1588912 Solanum tuberosum nematode resistance protein
           (Gro1-4) gene, Gro1-4-P40 allele, complete cds.
          Length = 1136

 Score =  176 bits (445), Expect = 8e-43
 Identities = 92/181 (50%), Positives = 126/181 (69%), Gaps = 3/181 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG DVRKTF+D L+ +LE++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct: 16  WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIA 75

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S WCL+EL  +MEC + +K QIVVP+FY V+P+ VR QK  F  +F + H
Sbjct: 76  LIIFSKNYANSTWCLDELTKIMEC-KNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H 133

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL---NHASLG 757
           E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS  
Sbjct: 134 EARFQED-KVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNA 192

Query: 758 R 760
           R
Sbjct: 193 R 193



>gb:AY196159_1588915 Solanum tuberosum nematode resistance-like
           protein (Gro1-1) gene, Gro1-1-P41 allele, complete cds.
          Length = 1136

 Score =  174 bits (442), Expect = 2e-42
 Identities = 91/181 (50%), Positives = 126/181 (69%), Gaps = 3/181 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG DVRKTF+D L+ +L+++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct: 16  WSYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELVSSIEESRIA 75

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S WCL+EL  +MEC + +K QIVVP+FY V+P+ VR QK  F  +F + H
Sbjct: 76  LIIFSKNYANSTWCLDELTKIMEC-KNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H 133

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL---NHASLG 757
           E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS  
Sbjct: 134 EARFQED-KVQKWRAALEEAANISGWDLPNTSNGHEARVMEKIAEDIMARLGSQRHASNA 192

Query: 758 R 760
           R
Sbjct: 193 R 193



>gb:AY196153_1588914 Solanum tuberosum nematode resistance-like
           protein (Gro1-2) gene, Gro1-2-P40 allele, complete cds.
          Length = 1136

 Score =  174 bits (442), Expect = 2e-42
 Identities = 91/181 (50%), Positives = 126/181 (69%), Gaps = 3/181 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG DVRKTF+D L+ +L+++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct: 16  WSYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELMSSIEESRIA 75

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S WCL+EL  +MEC + +K QIVVP+FY V+P+ VR QK  F  +F + H
Sbjct: 76  LIIFSKNYANSTWCLDELTKIMEC-KNVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H 133

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL---NHASLG 757
           E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS  
Sbjct: 134 EARFQED-KVQKWRAALEEAANISGWDLPNTSNGHEARVMEKIAEDIMARLGSQRHASNA 192

Query: 758 R 760
           R
Sbjct: 193 R 193



>gb:AY196152_1588913 Solanum tuberosum nematode resistance-like
           protein (Gro1-5) gene, Gro1-5-P40 allele, complete cds.
          Length = 1121

 Score =  169 bits (429), Expect = 5e-41
 Identities = 85/181 (46%), Positives = 123/181 (67%), Gaps = 3/181 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG +VRKTF+D L+ +LE++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct: 16  WSYDVFLSFRGENVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELMSSIEESRIA 75

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S WCL+EL  ++EC + +K QIVVP+FY V+P+ VR QK  F  +F +  
Sbjct: 76  LIIFSKNYANSTWCLDELTKIIEC-KNVKGQIVVPVFYDVDPSTVRRQKNIFGEAFSKHE 134

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL---NHASLG 757
            +   +++KV++W+ AL +A  + G+ L N  N +EA   E +  DI  RL    HAS  
Sbjct: 135 ARF--EEDKVKKWRAALEEAANISGWDLPNTSNGHEARVIEKITEDIMVRLGSQRHASNA 192

Query: 758 R 760
           R
Sbjct: 193 R 193



>gb:AF316412_1785536 Helianthus annuus resistance gene analog NBS7
           (NBS7) gene, partial cds.
          Length = 259

 Score =  169 bits (428), Expect = 7e-41
 Identities = 86/179 (48%), Positives = 121/179 (67%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W YDVFLSFRG D RK+F+D L+ +LE+RGI+T+KDD+ L +G+ I  +L  AI+ES+
Sbjct: 18  QSWNYDVFLSFRGDDTRKSFVDHLYTALEQRGIYTYKDDETLPRGESIGPALLKAIQESR 77

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YA S WCL+ELA +MEC +  + QIV+PIFYHV+P+DVR QKG +  +F +
Sbjct: 78  VAVIVFSKNYADSSWCLDELAHIMECMD-TRGQIVMPIFYHVDPSDVRKQKGKYGEAFTK 136

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLG 757
            HE+  K   KV  W++AL KAG+L G+ + +  N  +    E    D+ ++L   S G
Sbjct: 137 -HERENK--LKVESWRKALEKAGKLSGWVINDIENSKDLIGIETRLQDLISKLEIGSGG 192



>gb:PDE416708_1699579 Populus deltoides MER locus, genomic DNA,
           cultivar S9-2.
          Length = 216

 Score =  168 bits (425), Expect = 2e-40
 Identities = 81/166 (48%), Positives = 115/166 (69%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           TYDVFLSFRG D R TF D L+ +L + GIHTF+DDD L +G+ IS  L  AI+ESK  I
Sbjct: 50  TYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISI 109

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GSF  +F +  E
Sbjct: 110 VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE 169

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
           +   +++ V+ W++AL +AG L G++L +  N +EA   + +  ++
Sbjct: 170 RF--EEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIQGIIKNV 213



>gb:POP490333_1700986 Populus tremula mRNA for NLS-TIR-NBS disease
           resistance protein.
          Length = 516

 Score =  167 bits (422), Expect = 3e-40
 Identities = 85/170 (50%), Positives = 117/170 (68%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I 
Sbjct: 1   YDVFFSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLKAIRESKICIV 60

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+ VR Q GSF  +F + HE+
Sbjct: 61  VFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSYVRKQTGSFAEAFVK-HEE 119

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             K  EKV+ W+EAL +AG L G++LK    ++EA   + +  D+  +L+
Sbjct: 120 RSK--EKVKEWREALEEAGNLSGWNLK----DHEAKFIQEIIKDVLTKLD 163



>gb:PDE416708_1699583 Populus deltoides MER locus, genomic DNA,
           cultivar S9-2.
          Length = 1147

 Score =  167 bits (422), Expect = 3e-40
 Identities = 80/155 (51%), Positives = 112/155 (72%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS     AI+ESK  IA
Sbjct: 39  YDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISIA 98

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSKGYASS+WCL EL  +++C+++   QIV+PIFY ++P+DVR Q GSF  +F +  E+
Sbjct: 99  VFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEER 158

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEA 697
              +++ V+ W++AL +AG L G++L +  N +EA
Sbjct: 159 F--EEKLVKEWRKALEEAGNLSGWNLNDMANGHEA 191



>gb:AY535010_1612309 Nicotiana tabacum N-like protein (NH) gene,
           complete cds.
          Length = 941

 Score =  165 bits (418), Expect = 1e-39
 Identities = 86/183 (46%), Positives = 117/183 (63%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D RKTF   L+E L+ RGI TF+D+ RLE G  I + L  AI ES+F 
Sbjct: 10  WSYDVFLSFRGEDTRKTFTSHLYEVLKDRGIKTFQDEKRLEYGATIPEELCKAIEESQFA 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I VFS+ YA+S+WCL EL  +MEC+ + + Q ++PIFY V+P+ VRNQK SF  +F+E  
Sbjct: 70  IVVFSENYATSRWCLNELVKIMECKTQFR-QTIIPIFYDVDPSHVRNQKESFAKAFEEHE 128

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            K   D E ++RW+ ALN A  LKG     D  + +A C   +   I ++L+  SL  + 
Sbjct: 129 TKYKDDVEGIQRWRTALNAAANLKGSCDNRD--KTDADCIRQIVDQISSKLSKISLSYLQ 186

Query: 767 VIL 775
            I+
Sbjct: 187 NIV 189



>gb:POP490334_1700987 Populus balsamifera subsp. trichocarpa mRNA
           for TIR-NBS disease resistance protein.
          Length = 567

 Score =  164 bits (416), Expect = 2e-39
 Identities = 82/174 (47%), Positives = 118/174 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  A++ESK  I 
Sbjct: 15  YDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISIV 74

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+ VR Q GSF  +F + HE+
Sbjct: 75  VFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVK-HEE 133

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              +++ V+ W++AL +AG L G++L +  N +EA   + +  D+  +L    L
Sbjct: 134 C-FEEKLVKEWRKALEEAGNLSGWNLNDMANGHEAKFIKGIIKDVLNKLRRECL 186



>gb:AF316405_1785529 Helianthus annuus resistance gene analog PU3
           (PU3) gene, partial cds.
          Length = 770

 Score =  164 bits (415), Expect = 2e-39
 Identities = 81/173 (46%), Positives = 118/173 (68%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W +DVFLSFRG D R +F+D L+ +L ++GI T+KDD  L +G+ I  +L  AI+ES+
Sbjct: 79  QSWNHDVFLSFRGEDTRNSFVDHLYAALVQQGIQTYKDDQTLPRGERIGPALLKAIQESR 138

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFS+ YA S WCL+ELA +MEC +  + QIV+PIFY V+P+DVR QKG +  +F++
Sbjct: 139 IAVVVFSQNYADSSWCLDELAHIMECMD-TRGQIVIPIFYFVDPSDVRKQKGKYGKAFRK 197

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            H++  K  +KV  W++AL KAG L G+ +    N +EA C + + A I +RL
Sbjct: 198 -HKRENK--QKVESWRKALEKAGNLSGWVINE--NSHEAKCIKEIVATISSRL 245



>gb:AF093641_1767689 Linum usitatissimum flax rust resistance
           protein (L) gene, L11 allele, complete cds.
          Length = 1294

 Score =  164 bits (415), Expect = 2e-39
 Identities = 80/174 (45%), Positives = 118/174 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++SL R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V+ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADKVSADIWSHISKENL 230



>gb:AB120514_1527964 Nicotiana tabacum N mRNA for truncated N
           protein, partial cds.
          Length = 638

 Score =  164 bits (415), Expect = 2e-39
 Identities = 88/183 (48%), Positives = 115/183 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct: 2   WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA 61

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK SF  +F+E  
Sbjct: 62  IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE 120

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            K   D E ++RW+ ALN+A  LKG     D  + +A C   +   I ++L   SL  + 
Sbjct: 121 TKYKDDVEGIQRWRIALNEAANLKGSCDNRD--KTDADCIRQIVDQISSKLCKISLSYLQ 178

Query: 767 VIL 775
            I+
Sbjct: 179 NIV 181



>gb:AB120513_1527963 Nicotiana tabacum N mRNA for N protein, partial
           cds.
          Length = 1128

 Score =  164 bits (415), Expect = 2e-39
 Identities = 88/183 (48%), Positives = 115/183 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct: 2   WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA 61

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK SF  +F+E  
Sbjct: 62  IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE 120

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            K   D E ++RW+ ALN+A  LKG     D  + +A C   +   I ++L   SL  + 
Sbjct: 121 TKYKDDVEGIQRWRIALNEAANLKGSCDNRD--KTDADCIRQIVDQISSKLCKISLSYLQ 178

Query: 767 VIL 775
            I+
Sbjct: 179 NIV 181



>pir|T18547|T18547 flax rust resistance protein L6, truncated form -
           flax>gb:LUU27081_1685495 Linum usitatissimum
           alternatively spliced rust resistance (L6) gene,
           complete cds.
          Length = 705

 Score =  164 bits (415), Expect = 2e-39
 Identities = 80/174 (45%), Positives = 118/174 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++SL R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V+ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADKVSADIWSHISKENL 230



>pir|T18546|T18546 flax rust resistance protein L6 -
           flax>gb:LUU27081_1685494 Linum usitatissimum
           alternatively spliced rust resistance (L6) gene,
           complete cds.
          Length = 1294

 Score =  164 bits (415), Expect = 2e-39
 Identities = 80/174 (45%), Positives = 118/174 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++SL R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V+ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADKVSADIWSHISKENL 230



>sp|Q40392|VIRN_NICGU TMV resistance protein N.>pir|A54810|A54810
           TMV resistance protein N - tobacco (Nicotiana
           glutinosa)>gb:NGU15605_1690948 Nicotiana glutinosa virus
           resistance (N) gene, complete cds.
          Length = 1144

 Score =  164 bits (415), Expect = 2e-39
 Identities = 88/183 (48%), Positives = 115/183 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct: 10  WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK SF  +F+E  
Sbjct: 70  IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE 128

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            K   D E ++RW+ ALN+A  LKG     D  + +A C   +   I ++L   SL  + 
Sbjct: 129 TKYKDDVEGIQRWRIALNEAANLKGSCDNRD--KTDADCIRQIVDQISSKLCKISLSYLQ 186

Query: 767 VIL 775
            I+
Sbjct: 187 NIV 189



>gb:AF211528_1777388 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 4 (ACRE4) mRNA, complete cds.
          Length = 536

 Score =  163 bits (413), Expect = 4e-39
 Identities = 87/183 (47%), Positives = 115/183 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D RKTF   L+E L  RGI TF+DD RLE G  IS+ L  AI ES+F 
Sbjct: 9   WSYDVFLSFRGEDTRKTFTSHLYEVLNDRGIKTFQDDKRLEYGATISEELCKAIEESQFS 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I +FSK Y +S+WC+ EL  +MEC+ +   QIV+PIFY V+P+ VRNQK SF  +F+E  
Sbjct: 69  IVIFSKNYTTSRWCMNELVKIMECKTQF-GQIVIPIFYDVDPSHVRNQKESFAKAFEEHV 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            K   D E ++RW+ AL  A  LKG     D  + +A C  ++   I ++L   SL  + 
Sbjct: 128 TKYKDDVEGIQRWRIALTAAANLKGSCDNRD--KTDAECIRHIVGQISSKLCKISLSYLQ 185

Query: 767 VIL 775
            I+
Sbjct: 186 NIV 188



>gb:STU300266_1723033 Solanum tuberosum subsp. andigena ry-1 gene
           for resistance gene-like, exons 1-6, splice variants C38
           and C19.
          Length = 1126

 Score =  163 bits (412), Expect = 5e-39
 Identities = 86/187 (45%), Positives = 121/187 (64%), Gaps = 5/187 (2%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + YDVFLSFRG D R+ F   L+E L+ RGI TF DD RLE GD +S+ L  AI+ES+  
Sbjct: 21  YKYDVFLSFRGKDTRRNFTSHLYERLDNRGIFTFLDDKRLENGDSLSKELVKAIKESQVA 80

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S+WCL E+  +MEC+E+   Q+V+P+FY V+P+DVR Q  SF  +F E H
Sbjct: 81  VIIFSKNYATSRWCLNEVVKIMECKEE-NGQLVIPVFYDVDPSDVRKQTKSFAEAFAE-H 138

Query: 587 EKIGKDD----EKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
           E   KDD    +KV+RW+ AL++A  LKGY ++      E+ C   +  +I  +L   SL
Sbjct: 139 ESRYKDDVEGMQKVQRWRTALSEAADLKGYDIR---ERIESECIGELVNEISPKLCETSL 195

Query: 755 GRI-DVI 772
             + DV+
Sbjct: 196 SYLTDVV 202



>gb:AF093642_1767690 Linum usitatissimum flax rust resistance
           protein (L) gene, L2 allele, complete cds.
          Length = 1581

 Score =  162 bits (410), Expect = 9e-39
 Identities = 79/174 (45%), Positives = 116/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++ L R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQFLRRYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADEVLADIWSHISKENL 230



>gb:AF093638_1767686 Linum usitatissimum flax rust resistance
           protein (L) gene, L allele, complete cds.
          Length = 1303

 Score =  162 bits (410), Expect = 9e-39
 Identities = 81/174 (46%), Positives = 115/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRGPD RK F DFL+  L    IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D E ++ WK+AL K G LKG+H+  D  + +   A+ V+ADI + ++  +L
Sbjct: 181 F--DGETIQNWKDALKKVGDLKGWHIGKD--DKQGAIADEVSADIWSHISKENL 230



>gb:STU9720_1723165 Solanum tuberosum mRNA for NL27 protein.
          Length = 821

 Score =  162 bits (410), Expect = 9e-39
 Identities = 81/153 (52%), Positives = 103/153 (67%), Gaps = 3/153 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG D R+TF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct: 18  WKYDVFLSFRGVDTRRTFTSHLYEGLKNRGIFTFQDDKRLENGDSIPEELLKAIEESQVA 77

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S+WCL EL  +MEC+E+ K QIV+PIFY V+P++VR Q  SF  +F E  
Sbjct: 78  LIIFSKNYATSRWCLNELVKIMECKEE-KGQIVIPIFYDVDPSEVRKQTKSFAEAFTEHE 136

Query: 587 EKIGKDDE---KVRRWKEALNKAGQLKGYHLKN 676
            K   D E   KV+ W+ AL+ A  LKGY + N
Sbjct: 137 SKYANDIEGMQKVKGWRTALSDAADLKGYDISN 169



>gb:AF316414_1785538 Helianthus annuus resistance gene analog NBS9
           (NBS9) gene, partial cds.
          Length = 304

 Score =  161 bits (408), Expect = 1e-38
 Identities = 81/170 (47%), Positives = 116/170 (68%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG D RK F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES F + 
Sbjct: 46  HEVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESHFAVV 105

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S WCL+ELA +MEC +  + QIV+PIFYHV+P+DVR Q G +  +F + HE+
Sbjct: 106 VFSENYADSSWCLDELAHIMECVD-TRGQIVIPIFYHVDPSDVRKQNGKYGKAFTK-HER 163

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             K+ +KV  W+ AL KAG L G+ +  D N +EA C  ++   I  RL+
Sbjct: 164 --KNKQKVESWRNALEKAGNLSGWVI--DENSHEAQCISDIVGTISDRLS 209



>gb:AY154299_1585288 Helianthus annuus cultivar SMF3 NBS-LRR
           resistance protein RAS5-1 mRNA, partial cds.
          Length = 448

 Score =  161 bits (408), Expect = 1e-38
 Identities = 78/173 (45%), Positives = 117/173 (67%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W +DVFLSFRG D R +F+D L+ +L ++GI  +KDD+ L +G+ I  +L  AI+ES+
Sbjct: 80  QSWNHDVFLSFRGEDTRNSFVDHLYAALAQQGIQAYKDDETLPRGERIGPALLKAIQESR 139

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFS+ YA S WCL+ELA +MEC +  + QIV+PIFY V+P+DVR QKG +  +F+ 
Sbjct: 140 IAVVVFSQNYADSSWCLDELAHIMECMD-TRGQIVIPIFYFVDPSDVRKQKGKYGKAFR- 197

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  ++ +KV  W++AL KAG L G+ +    N +EA C + + A I +RL
Sbjct: 198 --KRKRENRQKVESWRKALEKAGNLSGWVINE--NSHEAKCIKEIVATISSRL 246



>gb:AF093649_1767697 Linum usitatissimum flax rust resistance
           protein (L) gene, LH allele, complete cds.
          Length = 1294

 Score =  161 bits (407), Expect = 2e-38
 Identities = 79/174 (45%), Positives = 116/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL+  L R  IHTF+DDD L KG+ I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYHFLCRYKIHTFRDDDELRKGEEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADEVLADIWSHISKENL 230



>gb:AF093647_1767695 Linum usitatissimum flax rust resistance
           protein (L) gene, L8 allele, complete cds.
          Length = 816

 Score =  161 bits (407), Expect = 2e-38
 Identities = 78/174 (44%), Positives = 116/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++ L R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQFLRRYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              + E ++ WK+AL K G LKG+H+    N+ +   A+ V+ DI + ++  +L
Sbjct: 181 F--EGETIQNWKDALKKVGDLKGWHI--GQNDKQGAIADEVSTDIWSHISKENL 230



>gb:AF093645_1767693 Linum usitatissimum flax rust resistance
           protein (L) gene, L5 allele, complete cds.
          Length = 1304

 Score =  161 bits (407), Expect = 2e-38
 Identities = 79/174 (45%), Positives = 116/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL+  L R  IHTF+DDD L KG+ I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYHFLCRYKIHTFRDDDELRKGEEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+    N+ +   A+ V ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGK--NDKQGAIADEVLADIWSHISKENL 230



>gb:AF093639_1767687 Linum usitatissimum flax rust resistance
           protein (L) gene, L1 allele, complete cds.
          Length = 982

 Score =  161 bits (407), Expect = 2e-38
 Identities = 78/174 (44%), Positives = 116/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL++ L R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYQFLRRYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              + E ++ WK+AL K G LKG+H+    N+ +   A+ V+ DI + ++  +L
Sbjct: 181 F--EGETIQNWKDALKKVGDLKGWHI--GQNDKQGAIADEVSTDIWSHISKENL 230



>gb:AC154033_1745252 Solanum demissum chromosome 5 clone PGEC132D05
           map MAP_LOC, complete sequence.
          Length = 654

 Score =  161 bits (407), Expect = 2e-38
 Identities = 83/154 (53%), Positives = 104/154 (67%), Gaps = 4/154 (2%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VFLSFRG D RKTF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct: 17  WKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVA 76

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFSK YA+SKWCL EL  +MEC+++   Q V+PIFY V+P+ VRNQ  SF  +F E H
Sbjct: 77  LIVFSKNYATSKWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAE-H 135

Query: 587 EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN 676
           E   KDD    +KV+RW+ AL  A  LKGY +++
Sbjct: 136 ELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRD 169



>gb:AF316406_1785530 Helianthus annuus resistance gene analog NBS1
           (NBS1) gene, partial cds.
          Length = 339

 Score =  160 bits (405), Expect = 3e-38
 Identities = 80/169 (47%), Positives = 118/169 (69%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG DVRK F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES+  + 
Sbjct: 81  HEVFLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV 140

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S WCL+ELA +MEC +  + QIV+PIFY V+P+DVR QKG +  +F++ H++
Sbjct: 141 VFSENYADSSWCLDELAHIMECMD-TRGQIVIPIFYFVDPSDVRKQKGKYGKAFRK-HKR 198

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K  +KV  W++AL KAG L G+ +    N +EA C + + A I +RL
Sbjct: 199 ENK--QKVESWRKALEKAGNLSGWVINE--NSHEAKCIKEIVATISSRL 243



>gb:AF316409_1785533 Helianthus annuus resistance gene analog NBS4
           (NBS4) gene, partial cds.
          Length = 279

 Score =  160 bits (404), Expect = 4e-38
 Identities = 81/173 (46%), Positives = 117/173 (67%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W +DVFLSFRG D R +F+D L+ +L ++GI T+KDD+ L +G+ I  +L  AI+ES+
Sbjct: 18  QSWNHDVFLSFRGEDTRNSFVDHLYVALAQQGILTYKDDETLPRGERIGPTLLKAIQESR 77

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFS+ YA S WCL+ELA +MEC +  + QIV PIFY V+P+DVR QKG +  +F++
Sbjct: 78  IALVVFSENYADSSWCLDELAHIMECVD-TRGQIVEPIFYFVDPSDVRKQKGKYGKAFRK 136

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            H++  K   KV  W++AL KAG L G+ +    N +EA C + + A I +RL
Sbjct: 137 -HKRENK--HKVESWRKALEKAGNLSGWVINE--NSHEARCIKEIVATISSRL 184



>gb:STU9719_1723164 Solanum tuberosum mRNA for NL25 protein.
          Length = 533

 Score =  159 bits (403), Expect = 6e-38
 Identities = 84/175 (48%), Positives = 113/175 (64%), Gaps = 4/175 (2%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VFLSFRG D RKTF   LFE L+ RGI TF+DD RLEKGD I + L  AI ES+  
Sbjct: 19  WKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVA 78

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S+WCL EL  +MEC+E +K+QIV+P+FY V+P+DVR+Q GSF  +F + H
Sbjct: 79  LVIFSKNYATSRWCLNELVKIMECKE-VKKQIVMPVFYDVDPSDVRHQTGSFAEAFSK-H 136

Query: 587 EKIGKDD----EKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           +   KDD    + V+ W+ AL+ A  L G    N     E+ C   +   + ++L
Sbjct: 137 KSRYKDDVDGMQMVQGWRTALSAAADLSG---TNVPGRIESECIRELVDAVSSKL 188



>gb:AF093648_1767696 Linum usitatissimum flax rust resistance
           protein (L) gene, L9 allele, complete cds.
          Length = 1291

 Score =  159 bits (402), Expect = 7e-38
 Identities = 79/174 (45%), Positives = 115/174 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPD R+ F DFL+  L R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YEVFLSFRGPDTREQFTDFLYHFLCRYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              + E ++ WK+AL K G LKG+H+  D  + +   A+ V ADI + ++  +L
Sbjct: 181 F--NGETIQNWKDALKKVGDLKGWHIGKD--DKQGAIADEVLADIWSHISKENL 230



>gb:AF093644_1767692 Linum usitatissimum flax rust resistance
           protein (L) gene, L4 allele, complete cds.
          Length = 1301

 Score =  159 bits (401), Expect = 1e-37
 Identities = 79/174 (45%), Positives = 113/174 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRGPD RK F DFL+  L    IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+  D  + +    + V ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGKD--DEQGAITDEVLADIWSHISKENL 230



>gb:AF093640_1767688 Linum usitatissimum flax rust resistance
           protein (L) gene, L10 allele, complete
           cds.>gb:AF093643_1767691 Linum usitatissimum flax rust
           resistance protein (L) gene, L3 allele, complete cds.
          Length = 1301

 Score =  159 bits (401), Expect = 1e-37
 Identities = 79/174 (45%), Positives = 113/174 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRGPD RK F DFL+  L    IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K G LKG+H+  D  + +    + V ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVGDLKGWHIGKD--DEQGAITDEVLADIWSHISKENL 230



>gb:PDE416708_1699586 Populus deltoides MER locus, genomic DNA,
           cultivar S9-2.
          Length = 226

 Score =  158 bits (400), Expect = 1e-37
 Identities = 79/170 (46%), Positives = 115/170 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D RKTF D L+ +L + GI+TF+DDD L +G+ IS  L  AI+ESK  I 
Sbjct: 15  YDVFLSFRGEDTRKTFTDHLYTALVQAGIYTFRDDDELPRGEEISYHLLRAIQESKISIV 74

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSKGYASS+WCL EL  +++C+     QIV+PIFY ++P+ VR Q GSF  +F +  E+
Sbjct: 75  VFSKGYASSRWCLNELVEILKCKNGKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVKHEER 134

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              ++  V+ W++AL +AG L G++L +  N +EA   + +  ++  +L+
Sbjct: 135 F--EETLVKEWRKALAEAGNLSGWNLNDMANGHEAKFIQVIIKEVLNKLD 182



>gb:AY438027_1606223 Lycopersicon esculentum bacterial spot disease
           resistance protein 4 (Bs4) gene, Bs4-MM allele, complete
           cds.
          Length = 1146

 Score =  158 bits (400), Expect = 1e-37
 Identities = 80/154 (51%), Positives = 104/154 (67%), Gaps = 4/154 (2%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VFLSFRG D RKTF   L+E L  RGI+TF+DD RLE GD I + L  AI +S+  
Sbjct: 18  WKYVVFLSFRGEDTRKTFTGHLYEGLRNRGINTFQDDKRLEHGDSIPKELLRAIEDSQVA 77

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FSK YA+S+WCL EL  +MEC+E+   Q V+PIFY+V+P+ VR Q  SF  +F + H
Sbjct: 78  LIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYNVDPSHVRYQTESFGAAFAK-H 136

Query: 587 EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN 676
           E   KDD    +KV+RW+ AL  A  LKGY ++N
Sbjct: 137 ESKYKDDVEGMQKVQRWRTALTAAANLKGYDIRN 170



>gb:AF093646_1767694 Linum usitatissimum flax rust resistance
           protein (L) gene, L7 allele, complete cds.
          Length = 1294

 Score =  158 bits (399), Expect = 2e-37
 Identities = 79/174 (45%), Positives = 114/174 (65%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRGPD RK F DFL+  L    IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct: 61  YDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP 120

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G ++ +F++   K
Sbjct: 121 IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK 180

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              D + ++ WK+AL K   LKG+H+  D  + +   A+ V+ADI + ++  +L
Sbjct: 181 F--DGQTIQNWKDALKKVEDLKGWHIGKD--DEQGAIADKVSADIWSHISKENL 230



>pir|T18548|T18548 flax rust resistance protein M -
           flax>gb:LUU73916_1685497 Linum usitatissimum rust
           resistance protein M gene, complete cds.
          Length = 1305

 Score =  158 bits (399), Expect = 2e-37
 Identities = 79/170 (46%), Positives = 112/170 (65%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRGPD R    D L+  L R  IHTFKDDD L KG+ I  +L  AI +SK ++ 
Sbjct: 76  YDVFLSFRGPDTRYQITDILYRFLCRSKIHTFKDDDELHKGEEIKVNLLRAIDQSKIYVP 135

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S+GYA SKWCL ELA ++  Q+    QI++PIFY V+P DVR+Q G +  +F++   +
Sbjct: 136 IISRGYADSKWCLMELAKIVRHQKLDTRQIIIPIFYMVDPKDVRHQTGPYRKAFQKHSTR 195

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              D+  +R WK ALN+ G LKG+H+KN  N+ +   A+ V+A+I + ++
Sbjct: 196 Y--DEMTIRSWKNALNEVGALKGWHVKN--NDEQGAIADEVSANIWSHIS 241



>gb:AF316410_1785534 Helianthus annuus resistance gene analog NBS5
           (NBS5) gene, partial cds.
          Length = 285

 Score =  157 bits (396), Expect = 4e-37
 Identities = 77/169 (45%), Positives = 114/169 (67%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG D RK F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES+  + 
Sbjct: 47  HEVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLRRGESIRPALLKAIQESRIAVI 106

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S WCL+EL  ++EC +    QIV+PIFYHV+P+DVR Q G +  +F++ H+K
Sbjct: 107 VFSENYADSSWCLDELQQIIECMD-TNGQIVIPIFYHVDPSDVRKQNGKYGKAFRK-HKK 164

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K  +KV  W++AL KAG L G+ +    N +EA C + +   I +RL
Sbjct: 165 ENK--QKVESWRKALEKAGNLSGWVINE--NSHEAKCIKEIVGTISSRL 209



>gb:AF316411_1785535 Helianthus annuus resistance gene analog NBS6
           (NBS6) gene, partial cds.
          Length = 303

 Score =  155 bits (393), Expect = 8e-37
 Identities = 79/169 (46%), Positives = 117/169 (69%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG DVRK F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES+  + 
Sbjct: 45  HEVFLSFRGEDVRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV 104

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S WCL+ELA +MEC +  + QIV+PIFY V+P+DVR QKG +  +F++ H++
Sbjct: 105 VFSENYADSSWCLDELAHIMECMD-TRGQIVIPIFYFVDPSDVRKQKGKYGKAFRK-HKR 162

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K  +KV  W++AL KAG L G+ +    N +EA   + + A I +RL
Sbjct: 163 ENK--QKVESWRKALEKAGNLSGWVINE--NSHEAKRIKEIVATISSRL 207



>gb:AF316413_1785537 Helianthus annuus resistance gene analog NBS8
           (NBS8) gene, partial cds.
          Length = 251

 Score =  153 bits (387), Expect = 4e-36
 Identities = 77/169 (45%), Positives = 113/169 (66%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG D RK F+D L+E L ++GI T+KDD+ L +G+ I  +L  AI+ES+  + 
Sbjct: 44  HEVFLSFRGEDARKNFVDHLYEDLVQQGIQTYKDDETLPRGERIGPALLKAIQESRIALV 103

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S  CL+ELA +MEC +  + QIV+P+FY V+P+DVR Q G +  +F + HE+
Sbjct: 104 VFSQNYADSSSCLDELAHIMECVD-TRGQIVMPVFYFVDPSDVRKQNGKYGKAFSK-HER 161

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K+ +KV  W++AL KA  L G+ + +  N YEA C + +   I  RL
Sbjct: 162 --KNKQKVESWRKALEKADNLSGWVISDTQNSYEAKCIKEIVDTISNRL 208



>pir|E96682|E96682 hypothetical protein F12P19.1 [imported] -
           Arabidopsis thaliana>gb:AE005173_894233 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F12P19_1677365 Sequence of BAC F12P19 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 1036

 Score =  153 bits (386), Expect = 5e-36
 Identities = 79/178 (44%), Positives = 118/178 (66%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           WT+ VF SFRG DVR+ F+  + +  +R+GI  F D++ +++G+ I   + +AIRESK  
Sbjct: 31  WTHQVFPSFRGEDVRRGFLSHIHKEFQRKGITPFIDNE-IKRGESIGLEIIHAIRESKIA 89

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + S+ YASS WCL+EL  +M+C+E+   QIV+PIFY V+P+DV+   G+F N FK  +
Sbjct: 90  IVLLSRNYASSSWCLDELVEIMKCKEEF-SQIVIPIFYRVDPSDVKKLTGNFGNVFK--N 146

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGR 760
             +GK +E +R+W++AL K G   GY  +N  N  EAT  EN+A DI   LN+++  R
Sbjct: 147 NCVGKTNEVIRKWRQALAKMGTTTGYDSRNWDN--EATMIENIATDISNMLNYSTPSR 202



>gb:AF541963_1809969 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 641

 Score =  152 bits (383), Expect = 1e-35
 Identities = 77/174 (44%), Positives = 111/174 (63%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+++L  RGI+TF DD  L +GD I+ +L NAI ES+  I 
Sbjct: 12  YDVFLSFRGLDTRNGFTGNLYKALGDRGIYTFIDDQELPRGDKITPALSNAINESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA S +CL+EL T++ C  K +  +V+P+FY V+P+DVR+QKGS+  +  +  ++
Sbjct: 72  VLSENYAFSSFCLDELVTILHC--KSEGLLVIPVFYKVDPSDVRHQKGSYGETMTKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK+R W+ AL +   L GYH K D + YE     N+  ++  ++NHASL
Sbjct: 130 FESKMEKLREWRMALQQVADLSGYHFK-DGDSYEYKFIGNIVEEVSRKINHASL 182



>gb:AF316407_1785531 Helianthus annuus resistance gene analog NBS2
           (NBS2) gene, partial cds.
          Length = 226

 Score =  150 bits (380), Expect = 3e-35
 Identities = 72/144 (50%), Positives = 102/144 (70%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           ++VFLSFRG D R+ F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES   + 
Sbjct: 37  HEVFLSFRGEDTRRNFVDHLYKDLAQQGIQTYKDDETLPRGERIGPALLKAIQESHIAVV 96

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA S WCL+ELA +MEC +   EQIV+P+FYHV P+DVRNQKG +  +  + HE+
Sbjct: 97  VFSQNYADSSWCLDELAHIMECMDP-SEQIVMPVFYHVNPSDVRNQKGKYGKALSK-HER 154

Query: 593 IGKDDEKVRRWKEALNKAGQLKGY 664
             K+ +KV  W+ AL KAG L G+
Sbjct: 155 --KNKQKVESWRNALEKAGNLSGW 176



>gb:LCU516091_1684090 Lens culinaris partial rga gene for putative
           resistance gene analogue protein, exons 1-2, cultivar
           ILL5588, isolate 3c1.
          Length = 810

 Score =  149 bits (377), Expect = 6e-35
 Identities = 74/149 (49%), Positives = 98/149 (65%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           WT  VF+SFR  D R+ F D LF SLERRGI TFKDD  L++G+ IS  L  AI+ES F 
Sbjct: 23  WTNHVFVSFRSEDTRQGFTDHLFASLERRGIKTFKDDHDLKRGEVISVELNKAIQESMFA 82

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + S  YASS WCL+EL  ++EC  K   Q   PIF+ V+P+DVR+Q+GSF  +F++  
Sbjct: 83  IIILSPNYASSTWCLDELQKIVEC-SKSSGQTFFPIFHGVDPSDVRHQRGSFAKAFRKHE 141

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLK 673
           EK+ KD  K+ RW++AL +     G+  K
Sbjct: 142 EKLRKDRNKIERWRDALREVASYSGWDSK 170



>gb:AB016877_1512989 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MLF18.
          Length = 1130

 Score =  149 bits (376), Expect = 8e-35
 Identities = 77/173 (44%), Positives = 107/173 (61%), Gaps = 2/173 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           WTYDVF+SFRG DVRK F+  L++SL R GI TF DD  L++G+ IS  L NAI  SK  
Sbjct: 12  WTYDVFVSFRGADVRKNFLSHLYDSLRRCGISTFMDDVELQRGEYISPELLNAIETSKIL 71

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V +K YASS WCL+EL  +M+  +     +V PIF +V+P+D+R Q+GS+  SF +  
Sbjct: 72  IVVLTKDYASSAWCLDELVHIMKSHKNNPSHMVFPIFLYVDPSDIRWQQGSYAKSFSK-- 129

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY--NEYEATCAENVAADIHARL 739
            K      K++ W+EAL K   + G+ +KN    +  EA C  ++  +I  RL
Sbjct: 130 HKNSHPLNKLKDWREALTKVANISGWDIKNRIYDSRNEAECIADITREILKRL 182



>gb:AF175394_1774508 Glycine max resistance protein LM12 mRNA,
           partial cds.
          Length = 438

 Score =  146 bits (369), Expect = 5e-34
 Identities = 74/187 (39%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + ++YDVFLSFRG D R  F  +L+  L  RGIHTF DDD  ++GD I+ +L  AI +SK
Sbjct: 4   RSFSYDVFLSFRGEDTRYGFTGYLYNVLRERGIHTFIDDDEPQEGDEITTALEAAIEKSK 63

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
            FI V S+ YASS +CL  L  ++   ++  + +V+P+FY V P+DVR+ +GSF  +   
Sbjct: 64  IFIIVLSENYASSSFCLNSLTHILNFTKENNDVLVLPVFYRVNPSDVRHHRGSFGEALAN 123

Query: 581 LHEKIGKDD--EKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
            HEK    +  EK+  WK AL++   + G+H ++D N+YE    + +   +  + NH  L
Sbjct: 124 -HEKKSNSNNMEKLETWKMALHQVSNISGHHFQHDGNKYEYKFIKEIVESVSNKFNHDHL 182

Query: 755 GRIDVIL 775
              DV++
Sbjct: 183 HVSDVLV 189



>gb:AF541963_1809974 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 892

 Score =  146 bits (368), Expect = 6e-34
 Identities = 73/176 (41%), Positives = 114/176 (64%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + YDVFLSF G D R+ F  +L+++L  RGI+TF DD  L +GD I  +L NAI+ES+  
Sbjct: 10  YNYDVFLSFTGQDTRQGFTGYLYKALCDRGIYTFIDDQELRRGDEIKPALSNAIQESRIA 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V S+ YASS +CL+EL T++ C  K +  +V+P+FY V+P+ VR+QKGS+  +  +  
Sbjct: 70  ITVLSQNYASSSFCLDELVTILHC--KSQGLLVIPVFYKVDPSHVRHQKGSYGEAMAKHQ 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
           ++   + EK+++W+ AL++   L GYH K D + YE     ++  +I  + + ASL
Sbjct: 128 KRFKANKEKLQKWRMALHQVADLSGYHFK-DGDSYEYEFIGSIVEEISRKFSRASL 182



>gb:AY363618_1602756 Malus baccata putative TIR-NBS type R protein 4
           (R4) gene, complete cds.
          Length = 726

 Score =  145 bits (367), Expect = 8e-34
 Identities = 76/175 (43%), Positives = 108/175 (61%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           +G  Y+VF+SFRG D RK F   L E+L + GI+ F DD+ L +G+ I+  L  AI+ S+
Sbjct: 121 KGSLYEVFISFRGEDTRKNFTGHLHEALTKAGINAFIDDEELRRGEDITTELVQAIQGSR 180

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I VFS+ YA S WCLEEL  +MEC+  L  Q+V+PIFY V+P++VR   GSF  SF +
Sbjct: 181 ISIIVFSRRYADSSWCLEELVKIMECRRTL-GQLVLPIFYDVDPSNVRKLTGSFAQSFLK 239

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
                  D++KV RW+ AL +A  L G+ LKN  + +EA     +   +  +LN+
Sbjct: 240 -----HTDEKKVERWRAALTEASNLSGWDLKNTLDRHEAKFIRMITNQVTVKLNN 289



>gb:AY363616_1602754 Malus baccata putative TIR-NBS type R protein 4
           (R4) mRNA, complete cds.
          Length = 726

 Score =  145 bits (367), Expect = 8e-34
 Identities = 76/175 (43%), Positives = 108/175 (61%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           +G  Y+VF+SFRG D RK F   L E+L + GI+ F DD+ L +G+ I+  L  AI+ S+
Sbjct: 121 KGSLYEVFISFRGEDTRKNFTGHLHEALTKAGINAFIDDEELRRGEDITTELVQAIQGSR 180

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I VFS+ YA S WCLEEL  +MEC+  L  Q+V+PIFY V+P++VR   GSF  SF +
Sbjct: 181 ISIIVFSRRYADSSWCLEELVKIMECRRTL-GQLVLPIFYDVDPSNVRKLTGSFAQSFLK 239

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
                  D++KV RW+ AL +A  L G+ LKN  + +EA     +   +  +LN+
Sbjct: 240 -----HTDEKKVERWRAALTEASNLSGWDLKNTLDRHEAKFIRMITNQVTVKLNN 289



>gb:AF541963_1809958 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 897

 Score =  145 bits (366), Expect = 1e-33
 Identities = 74/174 (42%), Positives = 111/174 (63%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+++L+ RGI+TF DD  L +GD I+ +L  AI+ES+  I 
Sbjct: 12  YDVFLSFRGLDTRHGFTGNLYKALDDRGIYTFIDDQELPRGDEITPALSKAIQESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YASS +CL+EL TV+ C  K K  +V+P+FY+V+P+DVR QKGS+  +  +  ++
Sbjct: 72  VLSQNYASSSFCLDELVTVLLC--KRKGLLVIPVFYNVDPSDVRQQKGSYGEAMAKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK+++W+ AL++   L GYH K D + YE    +++   +   +N   L
Sbjct: 130 FKAKKEKLQKWRMALHQVADLSGYHFK-DGDAYEYKFIQSIVEQVSREINRTPL 182



>gb:LUS310150_1685453 Linum usitatissimum variety Bombay Ngc-D,
           Ngc-A and Ngc-B genes.
          Length = 1108

 Score =  145 bits (366), Expect = 1e-33
 Identities = 74/151 (49%), Positives = 102/151 (67%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVRKTF D L+ SL R    TF+D++ LEKG  I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRKTFADHLYTSLVRSKFRTFRDEEELEKGGTIGPSLIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++ C +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVGCWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           E  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 EHSQK--HDPETVLEWKEALQEVGEMKGYHV 179



>gb:LUS310158_1685465 Linum usitatissimum N2-C gene.
          Length = 1119

 Score =  145 bits (365), Expect = 1e-33
 Identities = 75/176 (42%), Positives = 108/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVRKTF D L+ SL R    TF+D++ L KG  I  S+  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRKTFADHLYTSLVRSKFRTFRDEEELRKGGTIGPSIIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +  +K   D E V  WKEAL + G++KGYH+                 ++H R N+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGRMKGYHVTESDGHGSIIDKILTEVELHLRANY 204



>gb:LUS310159_1685466 Linum usitatissimum N2-D gene.
          Length = 1108

 Score =  144 bits (364), Expect = 2e-33
 Identities = 72/151 (47%), Positives = 102/151 (67%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRGPDVRKTF D L+ SL R    TF+D++ L KG  I  S+  AI ESK +I 
Sbjct: 31  YEIFLSFRGPDVRKTFADHLYTSLVRSKFRTFRDEEELRKGGTIGPSIIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           E  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 EHSQK--HDPETVLEWKEALQEVGKMKGYHV 179



>gb:LUS310155_1685462 Linum usitatissimum N1-D gene.
          Length = 1108

 Score =  144 bits (364), Expect = 2e-33
 Identities = 73/151 (48%), Positives = 104/151 (68%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRG DVRKTF D L+ SL R    TF+D++ LEKG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGLDVRKTFADHLYTSLVRSKFRTFRDEEELEKGETIGPSLIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTQNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           +  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGRMKGYHV 179



>gb:LUS310163_1685470 Linum usitatissimum Nbi-D gene.
          Length = 1108

 Score =  143 bits (361), Expect = 4e-33
 Identities = 71/151 (47%), Positives = 102/151 (67%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRGPDVRKTF D L+ SL R    TF+D++ L KG  I  S+  AI ESK +I 
Sbjct: 31  YEIFLSFRGPDVRKTFADHLYTSLVRSKFRTFRDEEELRKGGTIGPSIIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           +  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGKMKGYHV 179



>gb:LUS310156_1685463 Linum usitatissimum N2-A gene.
          Length = 1075

 Score =  142 bits (359), Expect = 7e-33
 Identities = 72/176 (40%), Positives = 109/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+ SL R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRQTFADHLYTSLVRSKIRTFRDEEGLQKGETIGPSLIQAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMEC----QEKLKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA ++ C     E   + I++P+FY ++P DVR+   G ++ SF+
Sbjct: 91  ILTQNYASSKWCLQELAKMVNCWKNGGEAKGQHIIIPVFYFMDPRDVRHPDSGPYKESFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +    +  D E +  WK AL + G++KG+H+     +           ++H R N+
Sbjct: 151 Q--HNLKHDPETILEWKGALQEVGKMKGWHISELTGQGAVVDKIFTEVELHLRANY 204



>gb:LUS310150_1685455 Linum usitatissimum variety Bombay Ngc-D,
           Ngc-A and Ngc-B genes.
          Length = 1075

 Score =  142 bits (359), Expect = 7e-33
 Identities = 72/176 (40%), Positives = 109/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+ SL R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRQTFADHLYTSLVRSKIRTFRDEEGLQKGETIGPSLIQAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMEC----QEKLKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA ++ C     E   + I++P+FY ++P DVR+   G ++ SF+
Sbjct: 91  ILTQNYASSKWCLQELAKMVNCWKNGGEAKGQHIIIPVFYFMDPRDVRHPDSGPYKESFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +    +  D E +  WK AL + G++KG+H+     +           ++H R N+
Sbjct: 151 Q--HNLKHDPETILEWKGALQEVGKMKGWHISELTGQGAVVDKIFTEVELHLRANY 204



>gb:LUS310154_1685461 Linum usitatissimum N1-C gene.
          Length = 1120

 Score =  142 bits (358), Expect = 9e-33
 Identities = 71/151 (47%), Positives = 102/151 (67%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRG DVRKTF D L+ SL R    TF+D++ LEKG  I  S+  AI ESK +I 
Sbjct: 31  YEIFLSFRGLDVRKTFADHLYTSLVRSKFRTFRDEEELEKGGAIGPSIIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           +  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 QHRQK--HDPETVLEWKEALQEVGKMKGYHV 179



>pir|A96607|A96607 protein disease resistance protein F25P12.101
           [imported] - Arabidopsis thaliana>gb:AE005173_893530
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009323_1536730 Arabidopsis thaliana
           chromosome I BAC F25P12 genomic sequence, complete
           sequence.
          Length = 1096

 Score =  142 bits (358), Expect = 9e-33
 Identities = 76/172 (44%), Positives = 107/172 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y+VF SF GPDVRKTF+  L +     GI  F DD R+E+   I+ +L  AIRES+  
Sbjct: 13  WRYNVFTSFHGPDVRKTFLSHLRKQFNYNGITMF-DDQRIERSQIIAPALTEAIRESRIA 71

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+EL  +++C+E+L  QIV+ +FY V P+DVR Q G F  +F E  
Sbjct: 72  IVLLSKNYASSSWCLDELLEILDCKEQL-GQIVMTVFYGVHPSDVRKQTGDFGIAFNETC 130

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  K +E+ ++W +AL   G + G H +N  N  EA   E +A+D+  +LN
Sbjct: 131 AR--KTEEQRQKWSQALTYVGNIAGEHFQNWDN--EAKMIEKIASDVSDKLN 178



>gb:LUS310164_1685471 Linum usitatissimum Nho-C gene.
          Length = 1120

 Score =  142 bits (357), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRG DVRKTF D L+ SL R    TF+D++ LEKG  I  SL  AI ESK +I 
Sbjct: 31  YEIFLSFRGLDVRKTFADHLYTSLVRSKFRTFRDEEELEKGGTIGPSLIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA +++C +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  IMTQNYASSKWCLQELAKMVDCWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           +  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGRMKGYHV 179



>gb:LUS310162_1685469 Linum usitatissimum Nbi-C gene.
          Length = 1107

 Score =  142 bits (357), Expect = 1e-32
 Identities = 73/176 (41%), Positives = 107/176 (60%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRG DVRKTF D L+ SL R    TF+D++ L KG  I  S+  AI ESK +I 
Sbjct: 31  YEIFLSFRGSDVRKTFADHLYTSLVRSKFRTFRDEEELRKGGAIGPSIIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + +  YASSKWCL+ELA ++EC +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  ILTPNYASSKWCLQELAKMVECWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +  +K   D E V  WKEAL + G++KGYH+                 ++H R N+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGRMKGYHVTESDGHGSIIDKILTEVELHLRANY 204



>gb:LUS310151_1685458 Linum usitatissimum Ngc-C gene.
          Length = 1120

 Score =  142 bits (357), Expect = 1e-32
 Identities = 71/151 (47%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y++FLSFRG DVRKTF D L+ SL R    TF+D++ LEKG  I  SL  AI ESK +I 
Sbjct: 31  YEIFLSFRGLDVRKTFADHLYTSLVRSKFRTFRDEEELEKGGTIGPSLIRAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA +++C +       + I++P+F  V+P DVR+ + GS++ +F+
Sbjct: 91  IMTQNYASSKWCLQELAKMVDCWKSGGGAKGQHIILPVFLFVDPRDVRHTESGSYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL 670
           +  +K   D E V  WKEAL + G++KGYH+
Sbjct: 151 QHSQK--HDPETVLEWKEALQEVGRMKGYHV 179



>gb:AF541963_1809968 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 641

 Score =  141 bits (355), Expect = 2e-32
 Identities = 71/178 (39%), Positives = 114/178 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+ +L  +GIHTF D+++L  GD I+ +L  AI+ES+  I 
Sbjct: 12  YDVFLSFRGEDTRYGFTGNLYRALCEKGIHTFFDEEKLHGGDEITPALSKAIQESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA S +CL+EL T++ C  K +  +V+P+FY+V+P+D+R+QKGS+  +  +  ++
Sbjct: 72  VLSQNYAFSSFCLDELVTILHC--KSEGLLVIPVFYNVDPSDLRHQKGSYGEAMIKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
                EK+++W+ AL +   L G+H K D + YE     ++  ++  ++N ASL  +D
Sbjct: 130 FESKMEKLQKWRMALKQVADLSGHHFK-DGDAYEYKFIGSIVEEVSRKINRASLHVLD 186



>gb:AF098964_1767942 Arabidopsis thaliana disease resistance protein
           RPP1-WsC gene, partial cds.
          Length = 1217

 Score =  141 bits (355), Expect = 2e-32
 Identities = 77/180 (42%), Positives = 106/180 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W +DVF SF G DVR+TF+  + ES  R+GI TF D++ +E+   I   L  AI+ SK
Sbjct: 77  RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNN-IERSKSIGPELKKAIKGSK 135

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ YASS WCL+ELA +M+C+E L  QIV+ IFY VEPTD++ Q G F  +F +
Sbjct: 136 IAIVLLSRKYASSSWCLDELAEIMKCREVL-GQIVMTIFYEVEPTDIKKQTGEFGKAFTK 194

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGR 760
                GK  E + RW++AL     + GYH     N  EA   E +A D+   LN  +  R
Sbjct: 195 TCR--GKTKEHIERWRKALEDVATIAGYHSHKWRN--EADMIEKIATDVSNMLNSCTPSR 250



>gb:AY364465_1602834 Malus x domestica putative TIR-NBS type R
           protein 11 (R11) mRNA, complete cds.
          Length = 634

 Score =  141 bits (355), Expect = 2e-32
 Identities = 76/175 (43%), Positives = 108/175 (61%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           +G  Y+VF+SFRG D RK F   L E+L + GI+ F DD+ L +G+ I+  L  AI+ S+
Sbjct: 104 KGLLYEVFISFRGEDTRKNFTGHLHEALTKAGINAFIDDE-LRRGEDITTELVQAIQGSR 162

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I VFS+ Y+ S WCLEEL  VMEC+  L  Q+V+PIFY V+P+ VR Q G F  SF +
Sbjct: 163 ISIIVFSRRYSDSSWCLEELVKVMECRRTL-GQLVLPIFYDVDPSHVRKQTGRFAQSFLK 221

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
                  D++KV RW+ AL +A  L G+ L+N  + +EA     +  D+  +LN+
Sbjct: 222 -----HTDEKKVERWRAALTEASNLSGWDLRNTLDGHEAKFIRMITNDVTTKLNN 271



>gb:AB019223_1514024 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 1123

 Score =  141 bits (355), Expect = 2e-32
 Identities = 72/174 (41%), Positives = 109/174 (62%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W+YDVF SF G DVRKTF+      LER+ I TFKD++ +E+   I+  L  AI++S+
Sbjct: 9   RNWSYDVFPSFSGEDVRKTFLSHFLRELERKSIITFKDNE-MERSQSIAPELVEAIKDSR 67

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  +M C + L +Q V+P+FY+++P+ +R Q G F  +FK+
Sbjct: 68  IAVIVFSKNYASSSWCLNELLEIMRCNKYLGQQ-VIPVFYYLDPSHLRKQSGEFGEAFKK 126

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             +   + +E   +WK+AL     + GYH KN  +  EAT  E +++ I  +L+
Sbjct: 127 TCQ--NQTEEVKNQWKQALTDVSNILGYHSKNCNS--EATMIEEISSHILGKLS 176



>pir|T52348|T52348 disease resistance protein RPP1-WsC [imported] -
           Arabidopsis thaliana (fragment)
          Length = 1217

 Score =  141 bits (355), Expect = 2e-32
 Identities = 77/180 (42%), Positives = 106/180 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W +DVF SF G DVR+TF+  + ES  R+GI TF D++ +E+   I   L  AI+ SK
Sbjct: 77  RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNN-IERSKSIGPELKKAIKGSK 135

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ YASS WCL+ELA +M+C+E L  QIV+ IFY VEPTD++ Q G F  +F +
Sbjct: 136 IAIVLLSRKYASSSWCLDELAEIMKCREVL-GQIVMTIFYEVEPTDIKKQTGEFGKAFTK 194

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGR 760
                GK  E + RW++AL     + GYH     N  EA   E +A D+   LN  +  R
Sbjct: 195 TCR--GKTKEHIERWRKALEDVATIAGYHSHKWRN--EADMIEKIATDVSNMLNSCTPSR 250



>gb:AF541963_1809963 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 895

 Score =  140 bits (354), Expect = 3e-32
 Identities = 71/174 (40%), Positives = 112/174 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+++L+ RGI+T  DD  L +GD I+ +L  AI+ES+  I 
Sbjct: 12  YDVFLSFRGLDTRHGFTGNLYKALDDRGIYTSIDDQELPRGDEITPALSKAIQESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YASS +CL+EL T++ C  K +  +V+P+FY V+P+DVR+QKGS+  +  +  ++
Sbjct: 72  VLSQNYASSSFCLDELVTILHC--KSEGLLVIPVFYKVDPSDVRHQKGSYGEAMAKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK+++W+ AL +   L GYH + D + YE     ++  ++  +++ ASL
Sbjct: 130 FKAKKEKLQKWRMALKQVADLSGYHFE-DGDAYEYKFIGSIVEEVSRKISRASL 182



>pir|T47438|T47438 disease resistance protein homolog - Arabidopsis
           thaliana>gb:ATT18B22_1554758 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T18B22.>gb:BT005790_1638712
           Arabidopsis thaliana clone C104929 putative disease
           resistance protein homolog (At3g44630) mRNA, complete
           cds.
          Length = 1214

 Score =  140 bits (352), Expect = 5e-32
 Identities = 75/174 (43%), Positives = 106/174 (60%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W +DVF SF G DVR+TF+  + ES  R+GI TF D++ +E+   I   L  AI+ SK
Sbjct: 90  RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNN-IERSKSIGPELKEAIKGSK 148

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ YASS WCL+ELA +M+C++ +  QIV+ IFY VEPTD++ Q G F  +F +
Sbjct: 149 IAIVLLSRKYASSSWCLDELAEIMKCRQ-MVGQIVMTIFYEVEPTDIKKQTGEFGKAFTK 207

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                GK  E+V RW++AL     + GYH  +  N  EA   E +A D+   LN
Sbjct: 208 TCR--GKPKEQVERWRKALEDVATIAGYHSHSWRN--EADMIEKIATDVSNMLN 257



>gb:AF403250_1796427 Glycine max disease resistance-like protein
           GS0-1 gene, partial cds.>gb:AF403251_1796428 Glycine max
           disease resistance-like protein GS0-2 gene, partial cds.
          Length = 158

 Score =  139 bits (351), Expect = 6e-32
 Identities = 66/150 (44%), Positives = 102/150 (68%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + YDVFLSF G D R+ F  +L+++L  RGI+TF DD  L +GD I  +L NAI+ES+  
Sbjct: 10  YNYDVFLSFTGQDTRQGFTGYLYKALCDRGIYTFIDDQELRRGDEIKPALSNAIQESRIA 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V S+ YASS +CL+EL T++ C  K +  +V+P+FY V+P+ VR+QKGS+  +  +  
Sbjct: 70  ITVLSQNYASSSFCLDELVTILHC--KSQGLLVIPVFYKVDPSHVRHQKGSYGEAMAKHQ 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKN 676
           ++   + EK+++W+ AL++   L GYH K+
Sbjct: 128 KRFKANKEKLQKWRMALHQVADLSGYHFKD 157



>gb:AF327903_1786903 Glycine max functional candidate resistance
           protein KR1 (KR1) mRNA, complete cds.
          Length = 1124

 Score =  139 bits (351), Expect = 6e-32
 Identities = 78/176 (44%), Positives = 105/176 (59%), Gaps = 3/176 (1%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           DVFLSFRG D R+ F   L+++L  RGIHTF DD ++ +GD I+  L  AI ES+ FI V
Sbjct: 17  DVFLSFRGEDTRRGFTGNLYKALSDRGIHTFMDDKKIPRGDQITSGLEKAIEESRIFIIV 76

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKI 595
            S+ YASS +CL EL  +++   K K  +++P+FY V+P+DVRN  GSF  +    HEK 
Sbjct: 77  LSENYASSSFCLNELDYILKF-IKGKGILILPVFYKVDPSDVRNHTGSFGKALTN-HEKK 134

Query: 596 GK---DDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
            K   D EK+  WK ALNK   L GYH      EYE    + +   +  ++N A L
Sbjct: 135 FKSTNDMEKLETWKMALNKVANLSGYHHFKHGEEYEYEFIQRIVELVSKKINRAPL 190



>gb:LUS310153_1685460 Linum usitatissimum N1-B gene.
          Length = 1108

 Score =  139 bits (351), Expect = 6e-32
 Identities = 71/176 (40%), Positives = 109/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+  L R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRQTFADHLYAWLVRSKIRTFRDEEGLQKGETIGSSLIQAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA +++C +       + I++P+FY ++P DVR+   G ++ +F+
Sbjct: 91  ILTQNYASSKWCLQELAKMVDCWKNGGGGKGQHIILPVFYFMDPRDVRHPDSGPYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           + + K   D E +  WKEAL   G++KG+H+     +           + H R N+
Sbjct: 151 QHNMK--HDPETILEWKEALQDVGKMKGWHINELTGQGAVVDKIFTTIEFHLRANY 204



>gb:LUS310152_1685459 Linum usitatissimum N1-A gene.
          Length = 1008

 Score =  139 bits (351), Expect = 6e-32
 Identities = 71/176 (40%), Positives = 108/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+ SL R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 30  YEVFLSFRGPDVRQTFADHLYTSLVRSKIRTFRDEEGLQKGETIGPSLIQAITESKIYIP 89

Query: 413 VFSKGYASSKWCLEELATVMEC----QEKLKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA ++ C     E   + I++P+FY ++P DVR+   G ++ SF+
Sbjct: 90  ILTQNYASSKWCLQELAKMVNCWKNGGEAKGQHIIIPVFYFMDPRDVRHPDSGPYKESFE 149

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +    +  D E +  WK A  + G++KG+H+     +           ++H R N+
Sbjct: 150 Q--HNLKHDPETILEWKGAPQEVGKMKGWHISELTGQGAVVDKIFTDVELHLRANY 203



>pir|E96662|E96662 hypothetical protein F24D7.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_894038 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537265 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.
          Length = 1063

 Score =  139 bits (351), Expect = 6e-32
 Identities = 78/172 (45%), Positives = 101/172 (58%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VF SF GPDVRKTF+  L +     G   F DD  +E+G  IS  L   IRES+  
Sbjct: 40  WRYRVFTSFHGPDVRKTFLSHLRKQFICNGTTMF-DDQAIERGQTISPELTRGIRESRIS 98

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V SK YASS WCL+EL  +++C+E +  QIV+ +FY V+P+DVR Q G     FK+  
Sbjct: 99  IVVLSKNYASSSWCLDELLEILKCKEDI-GQIVMTVFYGVDPSDVRKQTGDILKVFKKTC 157

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              GK +EK RRW +ALN  G + G H  N  N  E+   E +A DI  ++N
Sbjct: 158 S--GKTEEKRRRWSQALNDVGNIAGEHFLNWDN--ESKMMEKIARDISNKVN 205



>gb:AF541963_1809973 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 902

 Score =  139 bits (350), Expect = 8e-32
 Identities = 70/174 (40%), Positives = 112/174 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFL+FRG D R  F   L+++L  +GIHTF D+D+L  GD I+ +L  AI+ES+  I 
Sbjct: 12  YDVFLNFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGDDITPALSKAIQESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YASS +CL+EL T++ C  K +  +V+P+F++V+P+ VR+ KGS+  +  +  ++
Sbjct: 72  VLSQNYASSSFCLDELVTILHC--KREGLLVIPVFHNVDPSAVRHLKGSYGEAMAKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK+++W+ AL++   L GYH K D + YE     N+  ++  ++N A L
Sbjct: 130 FKAKKEKLQKWRMALHQVADLSGYHFK-DGDAYEYKFIGNIVEEVSRKINCAPL 182



>gb:LUS310157_1685464 Linum usitatissimum N2-B gene.
          Length = 1108

 Score =  139 bits (350), Expect = 8e-32
 Identities = 70/176 (39%), Positives = 108/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+  L R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRQTFADHLYAWLVRSKIRTFRDEEGLQKGETIGSSLIQAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA +++C +       + I++P+FY ++P DVR+   G ++ +F+
Sbjct: 91  ILTQNYASSKWCLQELAKMVDCWKNGGGGKGQHIILPVFYFMDPRDVRHPDSGPYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +    +  D E +  WKEAL   G++KG+H+     +           + H R N+
Sbjct: 151 Q--HNLKHDPETILEWKEALQDVGKMKGWHINELTGQGAVVDKIFTTIEFHLRANY 204



>gb:LUS310150_1685457 Linum usitatissimum variety Bombay Ngc-D,
           Ngc-A and Ngc-B genes.>gb:LUS310161_1685468 Linum
           usitatissimum Nbi-B gene.
          Length = 1108

 Score =  139 bits (350), Expect = 8e-32
 Identities = 70/176 (39%), Positives = 108/176 (61%), Gaps = 5/176 (2%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y+VFLSFRGPDVR+TF D L+  L R  I TF+D++ L+KG+ I  SL  AI ESK +I 
Sbjct: 31  YEVFLSFRGPDVRQTFADHLYAWLVRSKIRTFRDEEGLQKGETIGSSLIQAITESKIYIP 90

Query: 413 VFSKGYASSKWCLEELATVMECQEK----LKEQIVVPIFYHVEPTDVRN-QKGSFENSFK 577
           + ++ YASSKWCL+ELA +++C +       + I++P+FY ++P DVR+   G ++ +F+
Sbjct: 91  ILTQNYASSKWCLQELAKMVDCWKNGGGGKGQHIILPVFYFMDPRDVRHPDSGPYKEAFE 150

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           +    +  D E +  WKEAL   G++KG+H+     +           + H R N+
Sbjct: 151 Q--HNLKHDPETILEWKEALQDVGKMKGWHINELTGQGAVVDKIFTTIEFHLRANY 204



>gb:AF541963_1809970 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 901

 Score =  139 bits (349), Expect = 1e-31
 Identities = 71/174 (40%), Positives = 110/174 (63%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFL+FRG D R  F   L+ +L  +GIHTF D+ +L +G+ I+ +L  AI+ES+  I 
Sbjct: 12  YDVFLNFRGGDTRYGFTGNLYRALCDKGIHTFFDEKKLHRGEEITPALLKAIQESRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V SK YASS +CL+EL T++ C  K +  +V+P+FY+V+P+DVR+QKGS+     +  ++
Sbjct: 72  VLSKNYASSSFCLDELVTILHC--KSEGLLVIPVFYNVDPSDVRHQKGSYGVEMAKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK+++W+ AL +   L GYH K D + YE    +++   +   +N A L
Sbjct: 130 FKAKKEKLQKWRIALKQVADLCGYHFK-DGDAYEYKFIQSIVEQVSREINRAPL 182



>gb:AF217489_1778133 Glycine max clone A 75-10 unknown gene, partial
           cds.
          Length = 148

 Score =  139 bits (349), Expect = 1e-31
 Identities = 64/135 (47%), Positives = 96/135 (71%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+ +L+ +GIHTF DD++L++G+ I+ +L  AI +S+  I 
Sbjct: 14  YDVFLSFRGEDTRSAFTGHLYNTLQSKGIHTFIDDEKLQRGEQITPALMKAIEDSRVAIT 73

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YASS +CL+ELAT++ C ++ K  +V+P+FY V+P+DVR+QKGS+  +  +L  +
Sbjct: 74  VLSEHYASSSFCLDELATILHCDQR-KRLLVIPVFYKVDPSDVRHQKGSYGEALAKLERR 132

Query: 593 IGKDDEKVRRWKEAL 637
              D EK++ WK AL
Sbjct: 133 FQHDPEKLQNWKMAL 147



>gb:AY193892_1588838 Glycine max candidate disease-resistance
           protein SR1 (SR1) mRNA, complete cds.
          Length = 1137

 Score =  139 bits (349), Expect = 1e-31
 Identities = 69/174 (39%), Positives = 109/174 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSF G D R  F  +L+++L+ RGI+TF DD  L +GD I  +L +AI+ S+  I 
Sbjct: 12  YDVFLSFTGQDTRHGFTGYLYKALDDRGIYTFIDDQELPRGDEIKPALSDAIQGSRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA S +CL+EL T++ C  K +  +V+P+FY V+P+ VR+QKGS+  +  +  ++
Sbjct: 72  VLSQNYAFSTFCLDELVTILHC--KSEGLLVIPVFYKVDPSHVRHQKGSYGEAMAKHQKR 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
              + EK+++W+ AL +   L GYH K D + YE    +++   +   +N A L
Sbjct: 130 FKANKEKLQKWRMALQQVADLSGYHFK-DGDAYEYKFIQSIVEQVSREINRAPL 182



>pir|A85096|A85096 hypothetical protein AT4g09430 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV26_1544657 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 26.
          Length = 1039

 Score =  138 bits (348), Expect = 1e-31
 Identities = 78/169 (46%), Positives = 102/169 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R   + +L ++L   GI TFKDD  LE+GD IS+ L NAI+ S F + 
Sbjct: 15  YDVFLSFRGADTRNNIVSYLHKALVDVGIRTFKDDKELEEGDIISEKLVNAIQTSWFAVV 74

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ Y +S WCLEEL  +ME   +  + IVVPIFY VEP+DVR QK SFE   +     
Sbjct: 75  VLSEKYVTSSWCLEELRHIMELSIQ-DDIIVVPIFYKVEPSDVRYQKNSFEVKLQHY--- 130

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             +D EK+ +WK AL + G + G H +   +  EAT    + + I  RL
Sbjct: 131 --RDPEKILKWKGALTQVGNMSGKHFQTCSD--EATNIAEIVSKISNRL 175



>gb:AB006706_1510012 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MVA3.
          Length = 1295

 Score =  138 bits (347), Expect = 2e-31
 Identities = 73/150 (48%), Positives = 94/150 (62%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W  DVF+SFRG DVRKTF+  LF   +R GI  F+DD  L++G  IS  L +AI+ S+F 
Sbjct: 16  WKTDVFVSFRGEDVRKTFVSHLFCEFDRMGIKAFRDDLDLQRGKSISPELIDAIKGSRFA 75

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V S+ YA+S WCL+EL  +MEC     +  +VPIFY V+P+DVR Q+GSF     E H
Sbjct: 76  IVVVSRNYAASSWCLDELLKIMEC----NKDTIVPIFYEVDPSDVRRQRGSFGEDV-ESH 130

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKN 676
                D EKV +WKEAL K   + G   +N
Sbjct: 131 ----SDKEKVGKWKEALKKLAAISGEDSRN 156



>gb:AB005233_1509310 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK23.
          Length = 1085

 Score =  138 bits (347), Expect = 2e-31
 Identities = 77/170 (45%), Positives = 105/170 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF SF GPDVRK F+  L      +GI TFKD + +EKG+ I   L NAIRES+  I 
Sbjct: 13  YHVFPSFHGPDVRKGFLSHLHYHFASKGITTFKDQE-IEKGNTIGPELVNAIRESRVSIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK YASS WCL+EL  +++C+E  + QIV+ IFY V+P+ VR QKG F ++F +  E 
Sbjct: 72  LLSKKYASSSWCLDELVEILKCKED-QGQIVMTIFYDVDPSSVRKQKGDFGSTFMKTCE- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            GK +E  +RW +AL     +KG H  N  N  EA   + +A D+  +L+
Sbjct: 130 -GKSEEVKQRWTKALTHVANIKGEHSLNWAN--EADMIQKIATDVSTKLS 176



>gb:AB024029_1515748 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21L19.
          Length = 1046

 Score =  137 bits (346), Expect = 2e-31
 Identities = 74/172 (43%), Positives = 104/172 (60%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VF +F GPDVRKTF+  L +     GI  F D   +E+   I  +L  AI+ES+  
Sbjct: 13  WRYRVFTNFHGPDVRKTFLSHLRKQFSYNGISMFNDQS-IERSQTIVPALTGAIKESRIS 71

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V SK YASS+WCL+EL  +++C+E +  QIV+ +FY V+P+DVR Q G F  +F +  
Sbjct: 72  IVVLSKNYASSRWCLDELLEILKCREDI-GQIVMTVFYGVDPSDVRKQTGEFGIAFNKTC 130

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           E  GK +E+ ++W +ALN  G + G H  N  N  EA   E +A D+  +LN
Sbjct: 131 E--GKTNEETQKWSKALNDVGNIAGEHFFNWDN--EAKMIEKIARDVSNKLN 178



>gb:AB006699_1509886 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDJ22.
          Length = 1008

 Score =  137 bits (346), Expect = 2e-31
 Identities = 71/174 (40%), Positives = 108/174 (62%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVF SF G DVR TF+    + L+R+ I  FKD+D +++   +   L  AIR+S+
Sbjct: 6   RNWLYDVFPSFSGEDVRVTFLSHFLKELDRKLISVFKDND-IQRSQSLDPELKLAIRDSR 64

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I VFSK YA+S WCL+EL  +++C+E+   QIV+P+FY ++P  VR Q G F   F+ 
Sbjct: 65  IAIVVFSKNYAASSWCLDELLEIVKCKEEF-GQIVIPVFYGLDPCHVRKQSGEFGIVFEN 123

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             +   K D+++++W+ AL     + G+H  N  N  EAT  E++A D+ A+LN
Sbjct: 124 TCQT--KTDDEIQKWRRALTDVANILGFHSSNWDN--EATMVEDIANDVLAKLN 173



>pir|T48928|T48928 disease resistance protein-like - Arabidopsis
           thaliana>gb:ATF14L2_1548579 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14L2.
          Length = 1220

 Score =  137 bits (346), Expect = 2e-31
 Identities = 73/174 (41%), Positives = 106/174 (60%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W +DVF SF G DVR+TF+  + ES  R+GI TF D++ +E+   I   L  AI+ SK
Sbjct: 94  RNWKHDVFPSFHGADVRRTFLSHIMESFRRKGIDTFIDNN-IERSKSIGPELKEAIKGSK 152

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ YASS WCL+ELA +M+C++ +  QIV+ IFY V+PTD++ Q G F  +F +
Sbjct: 153 IAIVLLSRKYASSSWCLDELAEIMKCRQ-MVGQIVMTIFYEVDPTDIKKQTGEFGKAFTK 211

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                GK  E+V RW++AL     + GYH  +  N  EA   E ++ D+   LN
Sbjct: 212 TCR--GKPKEQVERWRKALEDVATIAGYHSHSWRN--EADMIEKISTDVSNMLN 261



>pir|T52346|T52346 disease resistance protein RPP1-WsA [imported] -
           Arabidopsis thaliana>gb:AF098962_1767940 Arabidopsis
           thaliana disease resistance protein RPP1-WsA gene,
           complete cds.
          Length = 1189

 Score =  137 bits (345), Expect = 3e-31
 Identities = 74/174 (42%), Positives = 104/174 (59%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W +DVF SF G DVR+TF+  + ES  R+GI TF D++ +E+   I   L  AI+ SK
Sbjct: 48  RNWKHDVFPSFHGADVRRTFLSHILESFRRKGIDTFIDNN-IERSKSIGPELKEAIKGSK 106

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ YASS WCL+ELA +M+C+E L  QIV+ IFY VEPTD++ Q G F  +F +
Sbjct: 107 IAIVLLSRKYASSSWCLDELAEIMKCREVL-GQIVMTIFYEVEPTDIKKQTGEFGKAFTK 165

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                GK  E + RW++AL     + GYH     N  EA   E ++ D+   L+
Sbjct: 166 TCR--GKTKEHIERWRKALEDVATIAGYHSHKWSN--EAEMIEKISTDVSNMLD 215



>pir|E96685|E96685 probable disease resistance protein F15E12.17
           [imported] - Arabidopsis thaliana>gb:AE005173_894257
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539642 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.>gb:AY113882_1578293 Arabidopsis thaliana
           putative disease resistance protein (At1g66090) mRNA,
           complete cds.>gb:AF360148_1791104 Arabidopsis thaliana
           putative disease resistance protein (At1g66090) mRNA,
           complete cds.
          Length = 429

 Score =  137 bits (345), Expect = 3e-31
 Identities = 73/172 (42%), Positives = 102/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y  F SF GPDVR TF+  L +     GI  F DD R+E+   ++ +L  AIRESK +
Sbjct: 24  WRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMF-DDQRMERSQTLAPTLTQAIRESKIY 82

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+EL  ++ C+EK + Q V+ IFY V P+DVR Q G F  +F E  
Sbjct: 83  IVLLSKNYASSSWCLDELLEILNCKEK-RGQRVMTIFYGVNPSDVRKQTGEFGIAFNETC 141

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  K +E+ R+W  AL   G + G H+++   + EA   E +A D+  +LN
Sbjct: 142 AR--KTEEERRKWSHALTCVGNITGVHVQD--RDDEANMIEKIATDVSEKLN 189



>pir|D96662|D96662 hypothetical protein F24D7.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894037 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537266 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.
          Length = 966

 Score =  137 bits (345), Expect = 3e-31
 Identities = 75/172 (43%), Positives = 102/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VF SF GPDVRKT +  L +     GI  F DD R+E+G  IS  L   IRES+  
Sbjct: 11  WRYRVFTSFHGPDVRKTVLSHLRKQFICNGITMF-DDQRIERGQTISPELTRGIRESRIS 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V SK YASS WCL+EL  +++C+E +  QIV+ +FY V+P+DVR Q G F   F E  
Sbjct: 70  IVVLSKNYASSSWCLDELLEILKCKEDI-GQIVMTVFYGVDPSDVRKQTGEFGIRFSETW 128

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  K +E+ ++W +ALN  G + G H  N   + E+   E +A D+  +LN
Sbjct: 129 AR--KTEEEKQKWSQALNDVGNIAGEHFLN--WDKESKMVETIARDVSNKLN 176



>pir|T14515|T14515 hypothetical protein C18G5.30 - Arabidopsis
           thaliana>gb:ATC18G5_1544141 Arabidopsis thaliana DNA
           chromosome 4, BAC clone C18G5, partial sequence (ESSA
           project).>gb:ATCHRIV23_1544561 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 23.
          Length = 1234

 Score =  137 bits (344), Expect = 4e-31
 Identities = 69/171 (40%), Positives = 104/171 (60%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVF SF G D+R TF+    + L+R+ I  FKD++ +E+G+ I   L  AI++S+  
Sbjct: 9   WVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNE-IERGNSIGTELIQAIKDSRIA 67

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFSK Y+SS WCL EL  ++ C+E     IV+P+FY ++P+DVR Q+G F  SFKE  
Sbjct: 68  VVVFSKKYSSSSWCLNELVEIVNCKE-----IVIPVFYDLDPSDVRKQEGEFGESFKETC 122

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           +   + D +++RW +AL     + GYH +   N  EA   E +  D+  +L
Sbjct: 123 K--NRTDYEIQRWGQALTNVANIAGYHTRKPNN--EAKLIEEITNDVLDKL 169



>pir|T47430|T47430 disease resistence-like protein - Arabidopsis
           thaliana>gb:ATT22K7_1555297 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22K7.
          Length = 1007

 Score =  136 bits (343), Expect = 5e-31
 Identities = 74/195 (37%), Positives = 108/195 (55%)
 Frame = +2

Query: 143 IEFRPYQYMXXXXXXXXXXXXXXXXXQGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIH 322
           I FR +++                  + W +DVF SF G DVR+TF+  + ES  R+GI 
Sbjct: 18  ILFRKFRFQESNSSSLSLPSPATSVSRNWKHDVFPSFHGADVRRTFLSHIKESFRRKGID 77

Query: 323 TFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQI 502
           TF D++ +E+   I   L  AI+ SK  I + S+ YASS WCL+ELA +M+C+E +  QI
Sbjct: 78  TFIDNN-IERSKSIGPELKEAIKGSKIAIVLLSRKYASSSWCLDELAEIMKCRE-MVGQI 135

Query: 503 VVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY 682
           V+ IFY VEPTD++ Q G F  +F +     GK  E + RW++AL     + GYH     
Sbjct: 136 VMTIFYEVEPTDIKKQTGEFGKAFTKTCR--GKTKEHIERWRKALEDVATIAGYHSHKWC 193

Query: 683 NEYEATCAENVAADI 727
           +  EA   E ++ D+
Sbjct: 194 D--EAEMIEKISTDV 206



>gb:AF098963_1767941 Arabidopsis thaliana disease resistance protein
           RPP1-WsB gene, partial cds.
          Length = 1221

 Score =  135 bits (341), Expect = 9e-31
 Identities = 75/172 (43%), Positives = 101/172 (58%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W + VF SF G DVRKT +  + ES  R+GI  F D++ +E+   I   L  AI+ SK  
Sbjct: 83  WKHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNN-IERSKSIGHELKEAIKGSKIA 141

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+ELA +M+C+E L  QIV+ IFY V+PTD++ Q G F  +F +  
Sbjct: 142 IVLLSKNYASSSWCLDELAEIMKCRE-LLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTC 200

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           +  GK  E V RW++AL     + GYH     N  EA   E +A D+   LN
Sbjct: 201 K--GKTKEYVERWRKALEDVATIAGYHSHKWRN--EADMIEKIATDVSNMLN 248



>pir|T52347|T52347 disease resistance protein RPP1-WsB [imported] -
           Arabidopsis thaliana (fragment)
          Length = 1221

 Score =  135 bits (341), Expect = 9e-31
 Identities = 75/172 (43%), Positives = 101/172 (58%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W + VF SF G DVRKT +  + ES  R+GI  F D++ +E+   I   L  AI+ SK  
Sbjct: 83  WKHQVFPSFHGADVRKTILSHILESFRRKGIDPFIDNN-IERSKSIGHELKEAIKGSKIA 141

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+ELA +M+C+E L  QIV+ IFY V+PTD++ Q G F  +F +  
Sbjct: 142 IVLLSKNYASSSWCLDELAEIMKCRE-LLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTC 200

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           +  GK  E V RW++AL     + GYH     N  EA   E +A D+   LN
Sbjct: 201 K--GKTKEYVERWRKALEDVATIAGYHSHKWRN--EADMIEKIATDVSNMLN 248



>pir|T47442|T47442 disease resistance protein homlog - Arabidopsis
           thaliana>gb:ATT18B22_1554762 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T18B22.
          Length = 1199

 Score =  135 bits (340), Expect = 1e-30
 Identities = 75/172 (43%), Positives = 102/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W + VF SF G DVRKT +  + ES  R+GI  F D++ +E+   I   L  AI+ SK  
Sbjct: 92  WKHHVFPSFHGADVRKTILSHILESFRRKGIDPFIDNN-IERSKSIGHELKEAIKGSKIA 150

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+ELA +M+C+E L  QIV+ IFY V+PTD++ Q G F  +F +  
Sbjct: 151 IVLLSKNYASSSWCLDELAEIMKCRE-LLGQIVMTIFYEVDPTDIKKQTGEFGKAFTKTC 209

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           +  GK  E V RW++AL     + G H +N  N  EA   E +A D+   LN
Sbjct: 210 K--GKTKEYVERWRKALEDVATIAGEHSRNWRN--EADMIEKIATDVSNMLN 257



>gb:AY363617_1602755 Malus baccata TIR-NBS-LRR type R protein 7 (R7)
           mRNA, complete cds.
          Length = 1095

 Score =  135 bits (339), Expect = 1e-30
 Identities = 74/177 (41%), Positives = 100/177 (56%), Gaps = 10/177 (5%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YD+FLSFRG D R  F   L  +L+ RG   + D D L +G+ I + L  AI  S+  
Sbjct: 21  WNYDLFLSFRGEDTRNGFTGHLHAALKDRGYQAYMDQDDLNRGEEIKEELFRAIEGSRIS 80

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I VFSK YA S WCL+EL  +MEC+ KL    V+PIFYHV+P+ VR Q G    +F +  
Sbjct: 81  IIVFSKRYADSSWCLDELVKIMECRSKLGRH-VLPIFYHVDPSHVRKQDGDLAEAFLKHE 139

Query: 587 EKIGK---------DDEKVRRWKEALNKAGQLKGYHLKNDYNEYEAT-CAENVAADI 727
           E IG+           E+V++WK+AL +A  L G+ L+   N  EA  C   +  +I
Sbjct: 140 EGIGEGTDGKKREAKQERVKQWKKALTEAANLSGHDLRITDNGREANLCPREIVDNI 196



>gb:AY088733_1573747 Arabidopsis thaliana clone 93530 mRNA, complete
           sequence.
          Length = 430

 Score =  135 bits (339), Expect = 1e-30
 Identities = 72/172 (41%), Positives = 101/172 (58%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y  F SF GPDVR TF+  L +     GI  F DD R+E+   ++ +L  AIRESK +
Sbjct: 25  WRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMF-DDQRMERSQTLAPTLTQAIRESKIY 83

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+EL  ++ C+EK + Q V+ IFY V P+DVR Q G F  +F E  
Sbjct: 84  IVLLSKNYASSSWCLDELLEILNCKEK-RGQRVMTIFYGVNPSDVRKQTGEFGIAFNETC 142

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  K +E+ R+W  AL     + G H+++   + EA   E +A D+  +LN
Sbjct: 143 AR--KTEEERRKWSHALTCVSNITGVHVQD--RDDEANMIEKIATDVSEKLN 190



>gb:AF541963_1809972 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 907

 Score =  134 bits (338), Expect = 2e-30
 Identities = 73/179 (40%), Positives = 114/179 (63%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+++L  +GIHTF D+D+L  G+ I+ +L  AI++S+  I 
Sbjct: 12  YDVFLSFRGEDTRYGFTGNLYKALCDKGIHTFFDEDKLHSGEEITPALLKAIQDSRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ +ASS +CL+ELAT++ C +     +V+P+FY V P DVR+QKG++  +  + H+K
Sbjct: 72  VLSEDFASSSFCLDELATILFCAQ-YNGMMVIPVFYKVYPCDVRHQKGTYGEALAK-HKK 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDV 769
             +  +K+++W+ AL +   L G H K D +EYE      + A +  ++N ASL   D+
Sbjct: 130 --RFPDKLQKWERALRQVANLSGLHFK-DRDEYEYKFIGRIVASVSEKINPASLHVADL 185



>pir|T08196|T08196 hypothetical protein T22B4.150 - Arabidopsis
           thaliana>gb:ATCHRIV31_1544882 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 31.>gb:ATT22B4_1555213
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22B4
           (ESSA project).
          Length = 1174

 Score =  134 bits (338), Expect = 2e-30
 Identities = 74/173 (42%), Positives = 105/173 (60%), Gaps = 1/173 (0%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVF SFRG DVR  F+  L +  E +GI TF+DD  +++   I   L  AIRESK  
Sbjct: 9   WRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDD-HIKRSHTIGHELRAAIRESKIS 67

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FS+ YASS WCL+EL  +M+C+E+ +   V+P+FY V+P+D+R Q G F  SF  L 
Sbjct: 68  VVLFSENYASSSWCLDELIEIMKCKEE-QGLKVMPVFYKVDPSDIRKQTGKFGMSF--LE 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNE-YEATCAENVAADIHARLN 742
              GK +E+   W+ AL  A  + G H +N  NE Y+ T    ++ D+  +LN
Sbjct: 125 TCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKIT---TISKDVLEKLN 174



>pir|T01916|T01916 hypothetical protein F2P3.8 - Arabidopsis
           thaliana>gb:F2P3_1678205 Arabidopsis thaliana BAC F2P3.
          Length = 1095

 Score =  134 bits (338), Expect = 2e-30
 Identities = 74/173 (42%), Positives = 105/173 (60%), Gaps = 1/173 (0%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVF SFRG DVR  F+  L +  E +GI TF+DD  +++   I   L  AIRESK  
Sbjct: 9   WRYDVFPSFRGEDVRNNFLSHLLKEFESKGIVTFRDD-HIKRSHTIGHELRAAIRESKIS 67

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + +FS+ YASS WCL+EL  +M+C+E+ +   V+P+FY V+P+D+R Q G F  SF  L 
Sbjct: 68  VVLFSENYASSSWCLDELIEIMKCKEE-QGLKVMPVFYKVDPSDIRKQTGKFGMSF--LE 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNE-YEATCAENVAADIHARLN 742
              GK +E+   W+ AL  A  + G H +N  NE Y+ T    ++ D+  +LN
Sbjct: 125 TCCGKTEERQHNWRRALTDAANILGDHPQNWDNEAYKIT---TISKDVLEKLN 174



>gb:AF322632_1786134 Glycine max putative resistance protein (L20a)
           gene, complete cds.
          Length = 1093

 Score =  134 bits (337), Expect = 3e-30
 Identities = 69/169 (40%), Positives = 100/169 (59%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R++F   L+  LE+RGIHTF  D   E G+ I  SL  AI  S+ F+ 
Sbjct: 14  YDVFLSFRGEDTRRSFTGNLYNCLEKRGIHTFIGDYDFESGEEIKASLSEAIEHSRVFVI 73

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YASS WCL+ L  +++  E    + V+P+F+ VEP+ VR+QKG +  +      +
Sbjct: 74  VFSENYASSSWCLDGLVRILDFTED-NHRPVIPVFFDVEPSHVRHQKGIYGEALAMHERR 132

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           +  +  KV +W+ AL +A  L GY  K+  + YE    E +  DI  ++
Sbjct: 133 LNPESYKVMKWRNALRQAANLSGYAFKHG-DGYEYKLIEKIVEDISNKI 180



>gb:AF175395_1774509 Glycine max resistance protein MG23 mRNA,
           partial cds.
          Length = 435

 Score =  134 bits (337), Expect = 3e-30
 Identities = 72/184 (39%), Positives = 109/184 (59%), Gaps = 2/184 (1%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVFLSFRG D R  F   L+  L  RGI TF DD+ L+KG  I+++L  AI +SK FI
Sbjct: 7   SYDVFLSFRGEDTRHGFTGNLYNVLRERGIDTFIDDEELQKGHEITKALEEAIEKSKIFI 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            V S+ YASS +CL EL  ++   +   ++ ++P+FY V+P+DVR  +GSF  +    HE
Sbjct: 67  IVLSENYASSSFCLNELTHILNFTKGKSDRSILPVFYKVDPSDVRYHRGSFGEALAN-HE 125

Query: 590 KIGKDD--EKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRI 763
           K  K +  EK++ WK AL +     G+H + D ++YE    + +   + ++ N   L   
Sbjct: 126 KKLKSNYMEKLQIWKMALQQVSNFSGHHFQPDGDKYEYDFIKEIVESVPSKFNRNLLYVS 185

Query: 764 DVIL 775
           DV++
Sbjct: 186 DVLV 189



>pir|B96754|B96754 Similar to part of disease resistance protein
           [imported] - Arabidopsis thaliana>gb:AE005173_894836
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536434 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AY136432_1581933 Arabidopsis thaliana virus
           resistance protein, putative (At1g72900) mRNA, complete
           cds.>gb:BT000215_1634493 Arabidopsis thaliana virus
           resistance protein, putative (At1g72900) mRNA, complete
           cds.
          Length = 363

 Score =  134 bits (337), Expect = 3e-30
 Identities = 71/167 (42%), Positives = 97/167 (58%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + YDVFLSFRGPD R+ FI FL++ L  R I TFKDD  LE G  IS  L  AI +S+F 
Sbjct: 8   YNYDVFLSFRGPDTRRKFISFLYKELVGRDIRTFKDDKELENGQMISPELILAIEDSRFA 67

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + V S  YA+S WCL+EL  +M+ Q+      V+PIFY V P  +R Q G     FK+ H
Sbjct: 68  VVVVSVNYAASSWCLDELVKIMDIQKNKGSITVMPIFYGVNPCHLRRQIGDVAEQFKK-H 126

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
           E   KD EKV +W++AL     + G     D ++     A+ ++ ++
Sbjct: 127 EAREKDLEKVLKWRQALAALADISGDCSGEDDSKLVDVIADKISKEL 173



>gb:AF499727_1806151 Cucumis melo BAC clone PIT92-60K17, complete
           sequence.
          Length = 1092

 Score =  133 bits (335), Expect = 4e-30
 Identities = 75/173 (43%), Positives = 105/173 (60%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W+YDVFLSFRG D R  F   L+  L ++G++ F DD  LE+G+ IS++L   I+ S   
Sbjct: 19  WSYDVFLSFRGEDTRSNFTGHLYMFLRQKGVNVFIDDG-LERGEQISETLFKTIQNSLIS 77

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I +FS+ YASS WCL+EL  +MEC +K K Q V+PIFY V+P+DVR Q G F     + H
Sbjct: 78  IVIFSENYASSTWCLDELVEIMEC-KKSKGQKVLPIFYKVDPSDVRKQNGWFREGLAK-H 135

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNH 745
           E      EK+  W++AL  A  L G+HL       EA   +++  ++ + LNH
Sbjct: 136 E--ANFMEKIPIWRDALTTAANLSGWHLG---ARKEAHLIQDIVKEVLSILNH 183



>gb:AB018109_1513751 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17N15.
          Length = 1239

 Score =  133 bits (335), Expect = 4e-30
 Identities = 75/173 (43%), Positives = 106/173 (61%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + WTYDVF SF G DVRK+F+  L + L R+ I+TF D++ +E+   I+  L +AI  S 
Sbjct: 7   RSWTYDVFPSFSGEDVRKSFLSHLLKKLHRKSINTFIDNN-IERSHAIAPDLLSAINNSM 65

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I VFSK YASS WCL EL  + +C ++L  QIV+PIFY V+P+DVR Q   F   FK 
Sbjct: 66  ISIVVFSKKYASSTWCLNELVEIHKCYKEL-TQIVIPIFYEVDPSDVRKQTREFGEFFKV 124

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
               +GK ++  ++W EAL +   + G+  KN  N  EA   E++A D+  +L
Sbjct: 125 --TCVGKTEDVKQQWIEALEEVASIAGHDSKNWPN--EANMIEHIAKDVLNKL 173



>gb:AF499727_1806152 Cucumis melo BAC clone PIT92-60K17, complete
           sequence.
          Length = 943

 Score =  133 bits (334), Expect = 6e-30
 Identities = 75/181 (41%), Positives = 108/181 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W++DVFLSFRG D R  F   L  +L +RGI+ F D  +L +G+ IS SL  AI ESK  
Sbjct: 15  WSFDVFLSFRGEDTRSNFTSHLNMTLRQRGINVFIDK-KLSRGEEISSSLLEAIEESKVS 73

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V S+ YASS WCL EL  ++ C  KL+ Q+V+PIFY V+P++V NQ G F   F +L 
Sbjct: 74  IIVISESYASSSWCLNELVKIIMC-NKLRGQVVLPIFYKVDPSEVGNQSGRFGEEFAKLE 132

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRID 766
            +   D  K+  WKEAL     + G+ +     + EA   +N+  ++   L+ A++ ++D
Sbjct: 133 VRFSSD--KMEAWKEALITVSHMSGWPVLQ--RDDEANLIQNIVQEVWKELDRATM-QLD 187

Query: 767 V 769
           V
Sbjct: 188 V 188



>pir|F96753|F96753 Similar to downy mildew resistance protein RPP5
           [imported] - Arabidopsis thaliana>gb:AE005173_894832
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536430 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 1258

 Score =  132 bits (331), Expect = 1e-29
 Identities = 75/171 (43%), Positives = 102/171 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG D RK  +  L + L  +G+ TFKDD +LE GD IS+ +  AI+ S + 
Sbjct: 10  WKYDVFLSFRGEDTRKNIVSHLHKQLVDKGVVTFKDDKKLELGDSISEEISRAIQNSTYA 69

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + + S+ YASS WCL+EL  VM+   K K + VVPIFY V+P+ VR+Q GSF  +F +  
Sbjct: 70  LVILSENYASSSWCLDELRMVMDLHLKNKIK-VVPIFYGVDPSHVRHQTGSF--TFDKYQ 126

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           +   K   KV  W+EAL +   L G   +    E EA+  E +  DI  +L
Sbjct: 127 D--SKMPNKVTTWREALTQIASLAGKDFET--CEDEASMIEEIVKDISKKL 173



>gb:AF175388_1774502 Glycine max resistance protein LM6 precursor
           RNA, partial cds.
          Length = 863

 Score =  131 bits (330), Expect = 2e-29
 Identities = 66/166 (39%), Positives = 106/166 (63%)
 Frame = +2

Query: 257 GPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYAS 436
           G D R+ F  +L+++L  RGI+TF DD  L +GD I  +L NAI+ES+  I V S+ YAS
Sbjct: 3   GQDTRQGFTGYLYKALCDRGIYTFIDDQELRRGDEIKPALSNAIQESRIAITVLSQNYAS 62

Query: 437 SKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKV 616
           S +CL+EL T++ C  K +  +V+P+FY V+P+ VR+QKGS+  +  +  ++   + EK+
Sbjct: 63  SSFCLDELVTILHC--KSQGLLVIPVFYKVDPSHVRHQKGSYGEAMAKHQKRFKANKEKL 120

Query: 617 RRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
           ++W+ AL++   L GYH K D + YE     ++  +I  + + ASL
Sbjct: 121 QKWRMALHQVADLSGYHFK-DGDSYEYEFIGSIVEEISRKFSRASL 165



>pir|A96754|A96754 Similar to part of disease resistance protein
           [imported] - Arabidopsis thaliana>gb:AE005173_894835
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536433 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 414

 Score =  131 bits (330), Expect = 2e-29
 Identities = 70/148 (47%), Positives = 93/148 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVFLSFRG D RK F+ FL+++L  +GI TFKDD+ LE+G  I   L  AI+ S+  + 
Sbjct: 39  FDVFLSFRGKDTRKNFVSFLYKALVSKGIRTFKDDEELERGRPIPPELRQAIKGSRIAVV 98

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S  Y +S WCLEEL  +++  EKL    V+PIFY + P+DVR Q G     FK+ HEK
Sbjct: 99  VVSVTYPASSWCLEELREILKL-EKLGLLTVIPIFYEINPSDVRRQSGVVSKQFKK-HEK 156

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKN 676
             +  E+V+ W+EAL K   L G   KN
Sbjct: 157 -RQSRERVKSWREALTKLASLSGECSKN 183



>gb:AF083734_1766964 Arabidopsis thaliana clone sps388 unknown mRNA.
          Length = 380

 Score =  131 bits (329), Expect = 2e-29
 Identities = 71/143 (49%), Positives = 88/143 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+ FI FL++ L RR I TFKDD  LE G  IS  L   I  S+F + 
Sbjct: 9   YDVFLSFRGHDTRQNFISFLYKELVRRSIRTFKDDKELENGQRISSELKRTIEVSRFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S WCL+EL T+M+  EK     V+PIFY VEP  VR Q G     FK+   +
Sbjct: 69  VVSETYAASSWCLDELVTIMDF-EKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHGSR 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV +W++AL    QL G
Sbjct: 128 --EDHEKVLKWRQALTNFAQLSG 148



>pir|C96754|C96754 Similar to part of disease resistance protein
           [imported] - Arabidopsis thaliana>gb:AE005173_894837
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536435 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 380

 Score =  131 bits (329), Expect = 2e-29
 Identities = 71/143 (49%), Positives = 88/143 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+ FI FL++ L RR I TFKDD  LE G  IS  L   I  S+F + 
Sbjct: 9   YDVFLSFRGHDTRQNFISFLYKELVRRSIRTFKDDKELENGQRISSELKRTIEVSRFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S WCL+EL T+M+  EK     V+PIFY VEP  VR Q G     FK+   +
Sbjct: 69  VVSETYAASSWCLDELVTIMDF-EKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHGSR 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV +W++AL    QL G
Sbjct: 128 --EDHEKVLKWRQALTNFAQLSG 148



>gb:AF188334_1775225 Arabidopsis thaliana Toll/interleukin-1
           receptor-like protein (TIR) mRNA, complete cds.
          Length = 176

 Score =  130 bits (328), Expect = 3e-29
 Identities = 71/143 (49%), Positives = 89/143 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  FI FL++ L RR I TFKDD  LE G   S  L + I  S+F + 
Sbjct: 9   YDVFLSFRGHDTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S WCL+EL T+M+  EK     V+PIFY VEP  VR Q G     FK+ H +
Sbjct: 69  VVSENYAASSWCLDELVTIMDF-EKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKK-HAR 126

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
           + +D EKV +W++AL    QL G
Sbjct: 127 V-EDPEKVLKWRQALTNFAQLSG 148



>gb:AB017065_1513377 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFC16.
          Length = 1187

 Score =  130 bits (328), Expect = 3e-29
 Identities = 69/156 (44%), Positives = 98/156 (62%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W + VFLSFRG DVRK  +  + +  +R GI  F D++ +++G  I   L  AIR SK
Sbjct: 36  QNWLHPVFLSFRGEDVRKGLLSHIQKEFQRNGITPFIDNE-MKRGGSIGPELLQAIRGSK 94

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + S+ Y SSKWCL+EL  +M+C+E+L  Q V+ +FY V+P+DVR QKG F   FK+
Sbjct: 95  IAIILLSRNYGSSKWCLDELVEIMKCREEL-GQTVMTVFYDVDPSDVRKQKGDFGKVFKK 153

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNE 688
               +G+ +E V+RWK+AL  A  + G   +N  NE
Sbjct: 154 --TCVGRPEEMVQRWKQALTSAANILGEDSRNWENE 187



>gb:AE005173_894066 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007764_1536179 Genomic sequence
           for Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.
          Length = 1195

 Score =  130 bits (328), Expect = 3e-29
 Identities = 72/172 (41%), Positives = 103/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VF SF G DVR +F+    +     GI  F DD R+ +G+ IS +L  AIRES+  
Sbjct: 210 WRYRVFTSFHGSDVRTSFLSHFRKQFNNNGITMF-DDQRILRGETISPALTQAIRESRIS 268

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+EL  +++C++ +  QIV+ +FY V+P+DVR Q G F  +F E  
Sbjct: 269 IVLLSKNYASSGWCLDELLEILKCKDDM-GQIVMTVFYGVDPSDVRKQTGEFGIAFNE-- 325

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
               + +E+ ++W +ALN  G + G HL N  N  EA   E +A D+  +LN
Sbjct: 326 TCACRTEEERQKWSQALNYVGNIAGEHLLNWDN--EAKMIEKIARDVSEKLN 375



>gb:AF502079_1806600 Glycine max resistance protein KR3 mRNA,
           complete cds.
          Length = 636

 Score =  130 bits (326), Expect = 5e-29
 Identities = 69/172 (40%), Positives = 103/172 (59%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF++FRG D R  F   L ++L  +GI  F D++ +++GD I  +L  AI+ S+  I 
Sbjct: 35  YDVFINFRGEDTRFAFTGHLHKALCNKGIRAFMDENDIKRGDEIRATLEEAIKGSRIAIT 94

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSK YASS +CL+ELAT++ C  + K  +V+P+FY V+P+DVR  +GS+      L E+
Sbjct: 95  VFSKDYASSSFCLDELATILGCYRE-KTLLVIPVFYKVDPSDVRRLQGSYAEGLARLEER 153

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHA 748
              + E    WK+AL K  +L G+H K D   YE      +  D+  ++N A
Sbjct: 154 FHPNME---NWKKALQKVAELAGHHFK-DGAGYEFKFIRKIVDDVFDKINKA 201



>gb:AY099648_1576673 Arabidopsis thaliana disease resistance
           protein, putative (At1g72910) mRNA, complete
           cds.>gb:BT000244_1634522 Arabidopsis thaliana disease
           resistance protein, putative (At1g72910) mRNA, complete
           cds.
          Length = 380

 Score =  130 bits (326), Expect = 5e-29
 Identities = 71/143 (49%), Positives = 88/143 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+ FI FL++ L RR I TFKDD  LE G  IS  L   I  S+F + 
Sbjct: 9   YDVFLSFRGHDTRQNFISFLYKELVRRSIRTFKDDKELENGQRISSELKRTIEVSRFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S WCL+EL T+M+  EK     V+PIFY VEP  VR Q G     FK+   +
Sbjct: 69  VVSETYAASSWCLDELVTIMDF-EKKGFITVMPIFYGVEPNHVRWQTGVLAEQFKKHGSR 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV +W++AL    QL G
Sbjct: 128 --EDHEKVLKWRQALTNFAQLSG 148



>pir|D96754|D96754 Similar to part of disease resistance protein
           [imported] - Arabidopsis thaliana>gb:AE005173_894838
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536436 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 275

 Score =  130 bits (326), Expect = 5e-29
 Identities = 70/143 (48%), Positives = 86/143 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+ FI FL++ L RR I TFKDD  LE G  IS  L  AI ESKF + 
Sbjct: 9   YDVFLSFRGLDTRRNFISFLYKELVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S  YA+S WCL+EL  +M+ + K     V+PIFY V+P  +R Q G     FK+ HE 
Sbjct: 69  VVSVNYAASPWCLDELVKIMDFENK-GSITVMPIFYGVDPCHLRRQIGDVAEQFKK-HEA 126

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV  W+ AL     + G
Sbjct: 127 REEDHEKVASWRRALTSLASISG 149



>pir|C84545|C84545 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC005167_1532222 Arabidopsis
           thaliana chromosome 2 clone F12A24 map mi398, complete
           sequence.
          Length = 1109

 Score =  129 bits (325), Expect = 6e-29
 Identities = 71/172 (41%), Positives = 99/172 (57%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y VF SF GPDVRK+F+    +     GI  F DD ++ +   I+ SL   IRESK  
Sbjct: 10  WNYRVFASFHGPDVRKSFLSHFRKQFICNGITMF-DDQKIVRSQTIAPSLTQGIRESKIS 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL EL  +++C+E +  QIV+ +FY V+P+DVR Q G F   F +  
Sbjct: 69  IVILSKNYASSTWCLNELLEILKCREDI-GQIVMTVFYGVDPSDVRKQTGEFGTVFNKTC 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  + +++ R W +ALN  G + G H  N  N  EA   E +A D+  +LN
Sbjct: 128 AR--RTEKERRNWSQALNVVGNIAGEHFLNWDN--EAEMIEKIARDVSEKLN 175



>gb:AB019223_1514026 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 1160

 Score =  129 bits (324), Expect = 8e-29
 Identities = 70/174 (40%), Positives = 106/174 (60%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W+Y VF SF G DVR TF+    + L+R+ I +FKD++ +E+   +   L + IR S+
Sbjct: 10  RNWSYHVFPSFSGEDVRNTFLSHFLKELDRKLIISFKDNE-IERSQSLDPELKHGIRNSR 68

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  +++C+++   Q+V+PIFY+++P+ VR Q G F   F++
Sbjct: 69  IAVVVFSKTYASSSWCLNELLEIVKCKKEF-GQLVIPIFYNLDPSHVRKQTGDFGKIFEK 127

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                   DEK+ RWKEAL     + GYH+    N  EA+  E +A DI  ++N
Sbjct: 128 TCRN-KTVDEKI-RWKEALTDVANILGYHIVTWDN--EASMIEEIANDILGKMN 177



>pir|F71436|F71436 hypothetical protein - Arabidopsis thaliana
          Length = 477

 Score =  129 bits (324), Expect = 8e-29
 Identities = 78/199 (39%), Positives = 109/199 (54%), Gaps = 3/199 (1%)
 Frame = +2

Query: 95  NLPSNYFPACVRGIRPIEFRPYQYMXXXXXXXXXXXXXXXXXQGWT---YDVFLSFRGPD 265
           NLP   +  C+R   P +FRP                     Q      YDVF SF G D
Sbjct: 275 NLPGLGYLDCLRRCNPSKFRPEHLKDLTVRCNNKLEKLWEGVQRKRIRRYDVFPSFSGVD 334

Query: 266 VRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKW 445
           VRKTF+  L E+L+RR I+TF D   + +   I+ +L  AIRE++  I +FS+ YASS W
Sbjct: 335 VRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADALITAIREARISIVIFSENYASSTW 393

Query: 446 CLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRW 625
           CL EL  + +C +K  EQ+V+P+FY V+P+ VR Q G F + FK+  E   K +++ +RW
Sbjct: 394 CLNELVEIHKCYKK-GEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE--DKPEDQKQRW 450

Query: 626 KEALNKAGQLKGYHLKNDY 682
            +AL     L G  L+N Y
Sbjct: 451 VKALTDISNLAGEDLRNGY 469



>pir|E96754|E96754 Similar to downy mildew resistance protein RPP5
           [imported] - Arabidopsis thaliana>gb:AE005173_894839
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536437 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AY044312_1561027 Arabidopsis thaliana
           Similar to downy mildew resistance protein RPP5
           (F3N23.13) mRNA, complete cds.>gb:AY065114_1566268
           Arabidopsis thaliana similar to downy mildew resistance
           protein RPP5 (At1g72930; F3N23.13) mRNA, complete
           cds.>gb:AY081663_1568923 Arabidopsis thaliana similar to
           downy mildew resistance protein RPP5 (At1g72930) mRNA,
           complete cds.>gb:AY086809_1571852 Arabidopsis thaliana
           clone 2795 mRNA, complete sequence.
          Length = 176

 Score =  129 bits (324), Expect = 8e-29
 Identities = 70/143 (48%), Positives = 87/143 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  FI FL++ L RR I TFKDD  LE G   S  L + I  S+F + 
Sbjct: 9   YDVFLSFRGHDTRHNFISFLYKELVRRSIRTFKDDKELENGQRFSPELKSPIEVSRFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S WCL+EL T+M+  EK     V+PIFY VEP  VR Q G     FK+   +
Sbjct: 69  VVSENYAASSWCLDELVTIMDF-EKKGSITVMPIFYGVEPNHVRWQTGVLAEQFKKHASR 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV +W++AL    QL G
Sbjct: 128 --EDPEKVLKWRQALTNFAQLSG 148



>gb:AK175233_1817221 Arabidopsis thaliana mRNA for disease
           resistance RPP5 like protein, complete cds, clone:
           RAFL21-66-E12.>gb:AK176509_1818497 Arabidopsis thaliana
           mRNA for disease resistance RPP5 like protein, complete
           cds, clone: RAFL25-02-P11.
          Length = 568

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 106/170 (62%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 8   SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +Q+V+PIFY V+P+ VR Q G F   F E  +
Sbjct: 67  VVFSKNYASSTWCLDELVKIQECYEKL-DQMVIPIFYKVDPSHVRKQTGEFGMVFGETCK 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 126 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 171



>gb:BT005928_1638850 Arabidopsis thaliana At4g16990 gene, complete
           cds.>gb:AK118421_1816399 Arabidopsis thaliana At4g16990
           mRNA for putative disease resistance RPP5 protein,
           complete cds, clone: RAFL19-67-F10.
          Length = 582

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 106/170 (62%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 8   SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +Q+V+PIFY V+P+ VR Q G F   F E  +
Sbjct: 67  VVFSKNYASSTWCLDELVKIQECYEKL-DQMVIPIFYKVDPSHVRKQTGEFGMVFGETCK 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 126 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 171



>gb:BT002524_1636127 Arabidopsis thaliana Unknown protein mRNA,
           complete cds.
          Length = 520

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 106/170 (62%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 8   SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +Q+V+PIFY V+P+ VR Q G F   F E  +
Sbjct: 67  VVFSKNYASSTWCLDELVKIQECYEKL-DQMVIPIFYKVDPSHVRKQTGEFGMVFGETCK 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 126 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 171



>gb:ATH299417_1552413 Arabidopsis thaliana mRNA for hypothetical
           protein (ORF1), clone c29.049.
          Length = 796

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 106/170 (62%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 8   SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +Q+V+PIFY V+P+ VR Q G F   F E  +
Sbjct: 67  VVFSKNYASSTWCLDELVKIQECYEKL-DQMVIPIFYKVDPSHVRKQTGEFGMVFGETCK 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 126 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 171



>gb:AB019223_1514027 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 192

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 102/170 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFL+F G DVR TF++  F+ LER+ I  FKD++  E+   +S  L +AIRES+  + 
Sbjct: 3   YDVFLNFSGEDVRGTFLNHFFKELERKSIIAFKDNES-ERSQNLSPELTHAIRESRITVV 61

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFSK Y+SS WCL EL  V EC + + +  V+PIFY ++P+ VR Q G F  +F++    
Sbjct: 62  VFSKNYSSSTWCLNELLQVYECYQSM-DLPVIPIFYGLDPSHVRKQTGEFGKNFEKTCR- 119

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             + +  V +W+ AL       GYH  N  N  EAT  E VA D+  +LN
Sbjct: 120 -NETEACVYQWRRALCDVSNFLGYHSPNWAN--EATMIEQVANDVLFKLN 166



>pir|F85189|F85189 disease resistance RPP5 like protein (partial)
           [imported] - Arabidopsis thaliana>gb:ATCHRIV45_1545501
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 45.>gb:ATFCA7_1551749 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 439

 Score =  129 bits (323), Expect = 1e-28
 Identities = 73/170 (42%), Positives = 106/170 (62%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 8   SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 66

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +Q+V+PIFY V+P+ VR Q G F   F E  +
Sbjct: 67  VVFSKNYASSTWCLDELVKIQECYEKL-DQMVIPIFYKVDPSHVRKQTGEFGMVFGETCK 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 126 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 171



>pir|F96754|F96754 Similar to NL27 [imported] - Arabidopsis
           thaliana>gb:AE005173_894840 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536438 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.>gb:AY064998_1566167 Arabidopsis thaliana
           At1g72940/F3N23_14 mRNA, complete
           cds.>gb:AY149960_1584909 Arabidopsis thaliana
           At1g72940/F3N23_14 mRNA, complete cds.
          Length = 371

 Score =  129 bits (323), Expect = 1e-28
 Identities = 69/143 (48%), Positives = 85/143 (59%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+ FI FL++   RR I TFKDD  LE G  IS  L  AI ESKF + 
Sbjct: 9   YDVFLSFRGVDTRRNFISFLYKEFVRRKIRTFKDDKELENGRRISPELKRAIEESKFAVV 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S  YA+S WCL+EL  +M+ + K     V+PIFY V+P  +R Q G     FK+ HE 
Sbjct: 69  VVSVNYAASPWCLDELVKIMDFENK-GSITVMPIFYGVDPCHLRRQIGDVAEQFKK-HEA 126

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             +D EKV  W+ AL     + G
Sbjct: 127 REEDHEKVASWRRALTSLASISG 149



>gb:AC022492_1539059 Genomic sequence for Arabidopsis thaliana BAC
           F1L3 from chromosome I, complete sequence.
          Length = 1075

 Score =  128 bits (322), Expect = 1e-28
 Identities = 76/169 (44%), Positives = 102/169 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D RKT +  L+ +L+ RGI TFKDD RLE GD IS  L  A+  S F + 
Sbjct: 12  YDVFLSFRGEDTRKTIVSHLYAALDSRGIVTFKDDQRLEIGDHISDELHRALGSSSFAVV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S+WCL EL  +ME  ++ + + V PIFY V+P+ VR+Q GSF     +  E 
Sbjct: 72  VLSENYATSRWCLLELQLIMELMKEGRLE-VFPIFYGVDPSVVRHQLGSFSLVKYQGLEM 130

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           +    +KV RW+EALN    L G  + + +   EA     +A DI  R+
Sbjct: 131 V----DKVLRWREALNLIANLSG--VVSSHCVDEAIMVGEIARDISRRV 173



>gb:AF175399_1774513 Glycine max resistance protein MG13 mRNA,
           partial cds.
          Length = 344

 Score =  128 bits (321), Expect = 2e-28
 Identities = 67/174 (38%), Positives = 104/174 (59%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F   L+++L  +G HTF D+D+L  G+ I+ +L  AI++S+  I 
Sbjct: 12  YDVFLSFRGTDTRYGFTGNLYKALCDKGFHTFFDEDKLHSGEEITPALLKAIQDSRVAII 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA S +CL+EL T+  C  K +  +V+P+FY V+P+ VR+QKGS+  +  +  E+
Sbjct: 72  VLSENYAFSSFCLDELVTIFHC--KREGLLVIPVFYKVDPSYVRHQKGSYGEAMTKHQER 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
                EK++ W+ AL +   L G H K D   YE     ++  ++  ++   SL
Sbjct: 130 FKDKMEKLQEWRMALKQVADLSGSHFK-DGGSYEYEFIGSIVEEVSRKIGRGSL 182



>gb:AF139523_1771437 Tagetes erecta disease-resistance protein NRSA1
           gene, complete cds.
          Length = 221

 Score =  128 bits (321), Expect = 2e-28
 Identities = 75/185 (40%), Positives = 105/185 (56%), Gaps = 16/185 (8%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQS-------------L 376
           DVFLSF+G D  KTF+D L+ +L+++GI TFK D+R++K   I+               L
Sbjct: 16  DVFLSFKGQDTPKTFVDNLYHALQQKGITTFKYDERIKKEHVIASDQQTTETRRNIMDYL 75

Query: 377 PNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKG 556
              I +SKF I V SK Y SS WCL+EL  +MEC  K  + IV PIFY VEPT+VR+Q G
Sbjct: 76  IRFIEDSKFHIIVLSKNYVSSSWCLDELVKIMEC-HKTAKHIVYPIFYDVEPTEVRHQYG 134

Query: 557 SFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLK---NDYNEYEATCAENVAADI 727
               +     E     DE+++RWK+ALN+A  L G+ L    +  +  E    + +  DI
Sbjct: 135 PVGEALATHVE-----DEQIKRWKDALNEAANLVGWELNALDSITHRLEMKFIQEIVQDI 189

Query: 728 HARLN 742
             +L+
Sbjct: 190 SLKLS 194



>gb:ATAC016829_1543647 Arabidopsis thaliana chromosome III BAC T6K12
           genomic sequence, complete sequence.
          Length = 896

 Score =  127 bits (319), Expect = 3e-28
 Identities = 69/176 (39%), Positives = 106/176 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SFRG DVRK F+  + +  +R+GI  F D++ +++G+ I   L  AIR SK  I 
Sbjct: 63  YDVFPSFRGEDVRKDFLSHIQKEFQRQGITPFVDNN-IKRGESIGPELIRAIRGSKIAII 121

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK YASS WCL+EL  +++C+E++ + ++V IFY V+P+ V+   G F   F+   + 
Sbjct: 122 LLSKNYASSSWCLDELVEIIKCKEEMGQTVIV-IFYKVDPSLVKKLTGDFGKVFRNTCK- 179

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGR 760
            GK+ E + RW+EA  K   + GY  +   N  E+   E + +DI   LNH++  R
Sbjct: 180 -GKERENIERWREAFKKVATIAGYDSRKWDN--ESGMIEKIVSDISEMLNHSTPSR 232



>gb:AB009048_1510578 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15E6.
          Length = 986

 Score =  127 bits (319), Expect = 3e-28
 Identities = 72/172 (41%), Positives = 99/172 (57%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W Y+VF SF G D+RKTF+  L +     GI  F DD  +E+   I+ +L  AIRES+  
Sbjct: 7   WRYNVFPSFHGGDIRKTFLSHLRKQFNSNGITMF-DDQGIERSQTIAPALIQAIRESRIS 65

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I V SK YASS WCL EL  +++C++     +V+PIFY V+P+DVR Q G F  +FK   
Sbjct: 66  IVVLSKNYASSSWCLNELVEILKCKD-----VVMPIFYEVDPSDVRKQTGDFGKAFKNSC 120

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           +   K  E+ +RW +AL   G + G H     N  EA   E +A D+  +LN
Sbjct: 121 K--SKTKEERQRWIQALIFVGNIAGEHSLKWEN--EADMIEKIAKDVSDKLN 168



>gb:AB005233_1509309 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBK23.
          Length = 1038

 Score =  127 bits (319), Expect = 3e-28
 Identities = 72/170 (42%), Positives = 100/170 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF SF G DVR+ F+  L      +GI  FKD + +E+G  I   L  AIRES+  + 
Sbjct: 11  YHVFPSFHGSDVRRKFLSHLRFHFAIKGIVAFKDQE-IERGQRIGPELVQAIRESRVSLV 69

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V SK Y SS WCL+EL  +++C+E  +EQIV+PIFY ++P+DVR Q G F  +F +    
Sbjct: 70  VLSKNYPSSSWCLDELVEILKCKED-QEQIVMPIFYEIDPSDVRKQSGDFGKAFGK--TC 126

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           +GK  E  +RW  AL +A  + G H  N  +  EA   E + AD+  +LN
Sbjct: 127 VGKTKEVKQRWTNALTEAANIGGEHSLNWTD--EAEMIEKIVADVSNKLN 174



>gb:AF440696_1800093 Arabidopsis thaliana disease resistance protein
           RPP4 (RPP4) gene, complete cds.
          Length = 1135

 Score =  127 bits (318), Expect = 4e-28
 Identities = 72/169 (42%), Positives = 104/169 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+ +L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADALITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS+ YASS WCL EL  + +C +K  EQ+V+P+FY V+P+ VR Q G F + FK+  E 
Sbjct: 72  IFSENYASSTWCLNELVEIHKCYKK-GEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K +++ +RW +AL     L G  L+N     EA   + +A D+  +L
Sbjct: 130 -DKPEDQKQRWVKALTDISNLAGEDLRN--GPTEAFMVKKIANDVSNKL 175



>gb:AY120755_1579637 Arabidopsis thaliana disease resistance
           RPP5-like protein (At4g16860) mRNA, complete cds.
          Length = 1147

 Score =  127 bits (318), Expect = 4e-28
 Identities = 72/169 (42%), Positives = 104/169 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+ +L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADALITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS+ YASS WCL EL  + +C +K  EQ+V+P+FY V+P+ VR Q G F + FK+  E 
Sbjct: 72  IFSENYASSTWCLNELVEIHKCYKK-GEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K +++ +RW +AL     L G  L+N     EA   + +A D+  +L
Sbjct: 130 -DKPEDQKQRWVKALTDISNLAGEDLRN--GPTEAFMVKKIANDVSNKL 175



>gb:AC006528_1534363 Arabidopsis thaliana chromosome 2 clone F9B22
           map mi398, complete sequence.
          Length = 972

 Score =  127 bits (318), Expect = 4e-28
 Identities = 70/173 (40%), Positives = 106/173 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVF SF G DVRK+F+  + +  +R+GI TF D++ +E+   I   L  AI+ SK  + 
Sbjct: 56  HDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNN-IERSKSIGPELIEAIKGSKIAVV 114

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK YASS WCL EL  +M+C+ K+ +Q V+ IFY V+PTDV+ Q G F   FK+    
Sbjct: 115 LLSKDYASSSWCLNELVEIMKCR-KMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKK--TC 171

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHAS 751
           +GK +   R+W EAL++   + G H  N   + EA   E ++ DI  +LN+++
Sbjct: 172 MGKTNAVSRKWIEALSEVATIAGEHSIN--WDTEAAMIEKISTDISNKLNNST 222



>pir|C71436|C71436 probable resistance gene - Arabidopsis
           thaliana>gb:ATCHRIV45_1545488 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 45.>gb:ATFCA7_1551736
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 7.
          Length = 1256

 Score =  127 bits (318), Expect = 4e-28
 Identities = 72/169 (42%), Positives = 104/169 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+ +L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADALITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS+ YASS WCL EL  + +C +K  EQ+V+P+FY V+P+ VR Q G F + FK+  E 
Sbjct: 72  IFSENYASSTWCLNELVEIHKCYKK-GEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             K +++ +RW +AL     L G  L+N     EA   + +A D+  +L
Sbjct: 130 -DKPEDQKQRWVKALTDISNLAGEDLRN--GPTEAFMVKKIANDVSNKL 175



>pir|H84513|H84513 probable disease resistance protein [imported] -
           Arabidopsis thaliana
          Length = 1215

 Score =  127 bits (318), Expect = 4e-28
 Identities = 70/173 (40%), Positives = 106/173 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVF SF G DVRK+F+  + +  +R+GI TF D++ +E+   I   L  AI+ SK  + 
Sbjct: 56  HDVFPSFHGADVRKSFLSHILKEFKRKGIDTFIDNN-IERSKSIGPELIEAIKGSKIAVV 114

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK YASS WCL EL  +M+C+ K+ +Q V+ IFY V+PTDV+ Q G F   FK+    
Sbjct: 115 LLSKDYASSSWCLNELVEIMKCR-KMLDQTVMTIFYEVDPTDVKKQTGDFGKVFKK--TC 171

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHAS 751
           +GK +   R+W EAL++   + G H  N   + EA   E ++ DI  +LN+++
Sbjct: 172 MGKTNAVSRKWIEALSEVATIAGEHSIN--WDTEAAMIEKISTDISNKLNNST 222



>gb:AY099773_1576798 Arabidopsis thaliana disease resistance gene,
           putative (At1g31540) mRNA, complete
           cds.>gb:BT010346_1640292 Arabidopsis thaliana At1g31540
           mRNA, complete cds.
          Length = 776

 Score =  126 bits (317), Expect = 5e-28
 Identities = 69/171 (40%), Positives = 102/171 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG DVR TF     + L+R+ I  F+D++ +E+   +   L  AI+ES+  
Sbjct: 10  WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNE-IERSHSLWPDLEQAIKESRIA 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFSK YASS WCL EL  ++ C +K    IV+P+FYHV+P+ VR+Q G F   F+   
Sbjct: 69  VVVFSKNYASSSWCLNELLEIVNCNDK----IVIPVFYHVDPSQVRHQIGDFGKIFENTC 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           ++   D+E   +WK+AL     + G+     +N+ EA   E +A D+  +L
Sbjct: 125 KR-QTDEEVKNQWKKALTLVANMLGFD-SAKWND-EAKMIEEIANDVLGKL 172



>gb:AC074360_1541422 Arabidopsis thaliana chromosome 1 BAC F27M3
           genomic sequence, complete sequence.
          Length = 1202

 Score =  126 bits (317), Expect = 5e-28
 Identities = 69/171 (40%), Positives = 102/171 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG DVR TF     + L+R+ I  F+D++ +E+   +   L  AI+ES+  
Sbjct: 10  WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNE-IERSHSLWPDLEQAIKESRIA 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFSK YASS WCL EL  ++ C +K    IV+P+FYHV+P+ VR+Q G F   F+   
Sbjct: 69  VVVFSKNYASSSWCLNELLEIVNCNDK----IVIPVFYHVDPSQVRHQIGDFGKIFENTC 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           ++   D+E   +WK+AL     + G+     +N+ EA   E +A D+  +L
Sbjct: 125 KR-QTDEEVKNQWKKALTLVANMLGFD-SAKWND-EAKMIEEIANDVLGKL 172



>gb:AC027135_1539890 Arabidopsis thaliana chromosome 1 BAC T8E3
           genomic sequence, complete sequence.
          Length = 1198

 Score =  126 bits (317), Expect = 5e-28
 Identities = 69/171 (40%), Positives = 102/171 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG DVR TF     + L+R+ I  F+D++ +E+   +   L  AI+ES+  
Sbjct: 10  WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNE-IERSHSLWPDLEQAIKESRIA 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFSK YASS WCL EL  ++ C +K    IV+P+FYHV+P+ VR+Q G F   F+   
Sbjct: 69  VVVFSKNYASSSWCLNELLEIVNCNDK----IVIPVFYHVDPSQVRHQIGDFGKIFENTC 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           ++   D+E   +WK+AL     + G+     +N+ EA   E +A D+  +L
Sbjct: 125 KR-QTDEEVKNQWKKALTLVANMLGFD-SAKWND-EAKMIEEIANDVLGKL 172



>gb:STU300266_1723034 Solanum tuberosum subsp. andigena ry-1 gene
           for resistance gene-like, exons 1-6, splice variants C38
           and C19.
          Length = 1101

 Score =  126 bits (316), Expect = 7e-28
 Identities = 67/155 (43%), Positives = 100/155 (64%), Gaps = 5/155 (3%)
 Frame = +2

Query: 323 TFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQI 502
           +F+DD RLE GD +S+ L  AI+ES+  + +FSK YA+S+WCL E+  +MEC+E+   Q+
Sbjct: 28  SFRDDKRLENGDSLSKELVKAIKESQVAVIIFSKNYATSRWCLNEVVKIMECKEE-NGQL 86

Query: 503 VVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDD----EKVRRWKEALNKAGQLKGYHL 670
           V+P+FY V+P+DVR Q  SF  +F E HE   KDD    +KV+RW+ AL++A  LKGY +
Sbjct: 87  VIPVFYDVDPSDVRKQTKSFAEAFAE-HESRYKDDVEGMQKVQRWRTALSEAADLKGYDI 145

Query: 671 KNDYNEYEATCAENVAADIHARLNHASLGRI-DVI 772
           +      E+ C   +  +I  +L   SL  + DV+
Sbjct: 146 R---ERIESECIGELVNEISPKLCETSLSYLTDVV 177



>gb:AY179750_1587463 Arabidopsis thaliana TIR-NBS-LRR (SSI4) gene,
           complete cds.
          Length = 1055

 Score =  126 bits (316), Expect = 7e-28
 Identities = 70/170 (41%), Positives = 99/170 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF SF GPDVRK F+  L      +GI TF +D ++E+G  I   L   IRE++  I 
Sbjct: 13  YQVFSSFHGPDVRKGFLSHLHSLFASKGITTF-NDQKIERGQTIGPELIQGIREARVSIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V SK YASS WCL+EL  ++ C+E L  QIV+ +FY V+P+DV+ Q G F   F++  + 
Sbjct: 72  VLSKKYASSSWCLDELVEILNCKEAL-VQIVMTVFYEVDPSDVKKQSGEFGKVFEKTCQ- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            GK++E  +RW+ AL     + G H  N  N  EA   + +  D+  +LN
Sbjct: 130 -GKNEEVEQRWRNALADVAIIAGEHSLNWDN--EADMIQKIVTDVSDKLN 176



>gb:AB011481_1511464 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSI17.
          Length = 1059

 Score =  126 bits (316), Expect = 7e-28
 Identities = 73/176 (41%), Positives = 102/176 (57%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  + +  +R+GI  F D+D +++   I   L  AIR SK  I 
Sbjct: 57  YDVFPSFHGADVRKTFLSHMLKEFKRKGIVPFIDND-IDRSKSIGPELDEAIRGSKIAIV 115

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK YASS WCL EL  + +C++ L  Q V+ IFY V+PTDV+ Q G F   F+   E 
Sbjct: 116 MLSKNYASSSWCLNELVEITKCRKDL-NQTVMTIFYGVDPTDVKKQTGEFGKVFERTCE- 173

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGR 760
             K +E+V+ W+E L+ A  + G H     N  EA+  E ++ D+   LN +S  R
Sbjct: 174 -SKTEEQVKTWREVLDGAATIAGEHWHIWDN--EASMIEKISIDVSNILNRSSPSR 226



>gb:AB025639_1516695 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 1285

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/150 (42%), Positives = 90/150 (60%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W + VF SF G DVRKTF+  + E+   +GI  F D+  +E+   I   L  AIR S+  
Sbjct: 51  WKHQVFPSFHGADVRKTFLSHVLEAFRGKGIDPFIDNS-IERSKSIGPELVEAIRGSRIA 109

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + S+ YASS WC+ EL  +M+C+E L  QIV+ IFY V+PT ++ Q G F   FKE  
Sbjct: 110 IVLLSRNYASSSWCMNELVEIMKCKEDL-GQIVITIFYEVDPTHIKKQTGDFGKVFKETC 168

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKN 676
           +  GK  E+++RW++AL     + GYH  N
Sbjct: 169 K--GKTKEEIKRWRKALEGVATIAGYHSSN 196



>gb:AB025635_1516627 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUF8.
          Length = 1068

 Score =  125 bits (313), Expect = 2e-27
 Identities = 69/170 (40%), Positives = 100/170 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF SF GPDVRK F+  L      +GI TF +D ++++G  I   L   IRE++  I 
Sbjct: 13  YQVFSSFHGPDVRKGFLSHLHSVFASKGITTF-NDQKIDRGQTIGPELIQGIREARVSIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V SK YASS WCL+EL  +++C+E L  QIV+ +FY V+P+DV+ Q G F  +F++  + 
Sbjct: 72  VLSKKYASSSWCLDELVEILKCKEAL-GQIVMTVFYEVDPSDVKKQSGVFGEAFEKTCQ- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            GK++E   RW+ AL     + G H  N  N  EA   + +  D+  +LN
Sbjct: 130 -GKNEEVKIRWRNALAHVATIAGEHSLNWDN--EAKMIQKIVTDVSDKLN 176



>pir|G71437|G71437 probable resistance gene - Arabidopsis thaliana
          Length = 766

 Score =  124 bits (312), Expect = 2e-27
 Identities = 71/170 (41%), Positives = 103/170 (60%), Gaps = 1/170 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+  L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADELITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMEC-QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
           +FS+ YASS WCL EL  + +C ++K  +Q+V+P+FY V+P+ VR Q G F + FK+  E
Sbjct: 72  IFSENYASSTWCLNELVEIHKCHKDKDLDQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE 131

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
              K +++ +RW +AL     L G  L+N     EA     +A D+  +L
Sbjct: 132 --DKPEDQKQRWVKALTDISNLAGEDLRN--GPSEAAMVVKIANDVSNKL 177



>pir|C85189|C85189 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545498 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551746 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1041

 Score =  124 bits (312), Expect = 2e-27
 Identities = 71/170 (41%), Positives = 103/170 (60%), Gaps = 1/170 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+  L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADELITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMEC-QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
           +FS+ YASS WCL EL  + +C ++K  +Q+V+P+FY V+P+ VR Q G F + FK+  E
Sbjct: 72  IFSENYASSTWCLNELVEIHKCHKDKDLDQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE 131

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
              K +++ +RW +AL     L G  L+N     EA     +A D+  +L
Sbjct: 132 --DKPEDQKQRWVKALTDISNLAGEDLRN--GPSEAAMVVKIANDVSNKL 177



>pir|A85189|A85189 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545496 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551744 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1103

 Score =  124 bits (312), Expect = 2e-27
 Identities = 71/170 (41%), Positives = 103/170 (60%), Gaps = 1/170 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+  L  AIRE++  I 
Sbjct: 6   YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADELITAIREARISIV 64

Query: 413 VFSKGYASSKWCLEELATVMEC-QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
           +FS+ YASS WCL EL  + +C ++K  +Q+V+P+FY V+P+ VR Q G F + FK+  E
Sbjct: 65  IFSENYASSTWCLNELVEIHKCHKDKDLDQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE 124

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
              K +++ +RW +AL     L G  L+N     EA     +A D+  +L
Sbjct: 125 --DKPEDQKQRWVKALTDISNLAGEDLRN--GPSEAAMVVKIANDVSNKL 170



>gb:AK119099_1817041 Arabidopsis thaliana At4g16860 mRNA for
           putative disease resistance RPP5, complete cds, clone:
           RAFL21-45-F24.
          Length = 157

 Score =  124 bits (310), Expect = 3e-27
 Identities = 67/148 (45%), Positives = 95/148 (64%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+RR I+TF D   + +   I+ +L  AIRE++  I 
Sbjct: 13  YDVFPSFSGVDVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADALITAIREARISIV 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS+ YASS WCL EL  + +C +K  EQ+V+P+FY V+P+ VR Q G F + FK+  E 
Sbjct: 72  IFSENYASSTWCLNELVEIHKCYKK-GEQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKN 676
             K +++ +RW +AL     L G  L+N
Sbjct: 130 -DKPEDQKQRWVKALTDISNLAGEDLRN 156



>gb:AF541963_1809966 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 264

 Score =  124 bits (310), Expect = 3e-27
 Identities = 66/179 (36%), Positives = 109/179 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFL+FRG D R  F   L+ +L  +GI TF D+++L  G+ I+ +L  AI++S+  I 
Sbjct: 12  YDVFLNFRGEDTRYGFTSNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ +ASS +CL+EL +++ C +     +++P+FY V P+DVR+QKG++  +  +   K
Sbjct: 72  VLSEDFASSSFCLDELTSIVHCAQ-YNGMMIIPVFYKVYPSDVRHQKGTYGEALAK--HK 128

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDV 769
           I +  EK + W+ AL +   L G+H K   +EYE    E + A +  ++N A +   D+
Sbjct: 129 I-RFPEKFQNWEMALRQVADLSGFHFKY-RDEYEYKFIERIVASVSEKINPARVHVADL 185



>gb:AF541963_1809960 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 264

 Score =  124 bits (310), Expect = 3e-27
 Identities = 66/179 (36%), Positives = 109/179 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFL+FRG D R  F   L+ +L  +GI TF D+++L  G+ I+ +L  AI++S+  I 
Sbjct: 12  YDVFLNFRGEDTRYGFTGNLYRALSDKGIRTFFDEEKLHSGEEITPALLKAIKDSRIAIT 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ +ASS +CL+EL +++ C +     +++P+FY V P+DVR+QKG++  +  +   K
Sbjct: 72  VLSEDFASSSFCLDELTSIVHCAQ-YNGMMIIPVFYKVYPSDVRHQKGTYGEALAK--HK 128

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDV 769
           I +  EK + W+ AL +   L G+H K   +EYE    E + A +  ++N A +   D+
Sbjct: 129 I-RFPEKFQNWEMALRQVADLSGFHFKY-RDEYEYKFIERIVASVSEKINPARIHVADL 185



>gb:AK119065_1817010 Arabidopsis thaliana At1g63880 mRNA for
           putative disease resistance protein, complete cds,
           clone: RAFL21-41-E18.
          Length = 1017

 Score =  123 bits (309), Expect = 4e-27
 Identities = 71/174 (40%), Positives = 101/174 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q + ++VF SF GPDVRKT +  +     R GI  F DD ++ +   I  SL  AI+ES+
Sbjct: 10  QNYKFNVFASFHGPDVRKTLLSHIRLQFNRNGITMF-DDQKIVRSATIGPSLVEAIKESR 68

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + SK YASS WCL+EL  ++EC +K   QIV+ IFY V+P+DVR Q G F  +F E
Sbjct: 69  ISIVILSKKYASSSWCLDELVEILEC-KKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNE 127

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              +  K +E+ ++W +ALN+   + G       N  EA   E +A D+  +LN
Sbjct: 128 TCAR--KTEEERQKWSKALNQVSNIAGEDFLRWDN--EAIMIEKIARDVLDKLN 177



>gb:AY522496_1611363 Arabidopsis thaliana TIR-NBS-LRR (RAC1) gene,
           complete cds.
          Length = 1160

 Score =  123 bits (309), Expect = 4e-27
 Identities = 68/171 (39%), Positives = 101/171 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVFLSFRG DVR TF     + L+R+ I  F+D++ +E+   +   L  AI+ES+  
Sbjct: 10  WLYDVFLSFRGEDVRVTFRSHFLKELDRKLITAFRDNE-IERSHSLWPDLEQAIKESRIA 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           + VFS  YASS WCL EL  ++ C +K    IV+P+FYHV+P+ VR+Q G F   F+   
Sbjct: 69  VVVFSINYASSSWCLNELLEIVNCNDK----IVIPVFYHVDPSQVRHQIGDFGKIFENTC 124

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           ++   D+E   +WK+AL     + G+     +N+ EA   E +A D+  +L
Sbjct: 125 KR-QTDEEVKNQWKKALTLVANMLGFD-SAKWND-EAKMIEEIANDVLGKL 172



>gb:AE005172_891596 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC000348_1530075 Genomic sequence
           for Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 1560

 Score =  123 bits (309), Expect = 4e-27
 Identities = 61/149 (40%), Positives = 93/149 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R  F D L+++L+ + +  F+D++ +E+GD IS SL   + +S   + 
Sbjct: 161 YDVFLSFRGADTRDNFGDHLYKALKDK-VRVFRDNEGMERGDEISSSLKAGMEDSAASVI 219

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ Y+ S+WCL+ELA + + +  L  +I+ PIFYHV+P+ VR Q    +  F+E   +
Sbjct: 220 VISRNYSGSRWCLDELAMLCKMKSSLDRRIL-PIFYHVDPSHVRKQSDHIKKDFEEHQVR 278

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKND 679
             ++ EKV+ W+EAL   G L GY    D
Sbjct: 279 FSEEKEKVQEWREALTLVGNLAGYVCDKD 307



 Score =  100 bits (248), Expect = 5e-20
 Identities = 60/152 (39%), Positives = 91/152 (59%), Gaps = 3/152 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDC-ISQSLPNAIRESKFFI 409
           +DVFLSF+  D R  F + L+E L +  +  + +DD +E+G+  +  SL  A+ +S   +
Sbjct: 16  WDVFLSFQR-DARHKFTERLYEVLVKEQVRVWNNDD-VERGNHELGASLVEAMEDSVALV 73

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            V S  YA S WCLEELA + + +  L  ++V+PIFY VEP  +R Q G +E  F+E  +
Sbjct: 74  VVLSPNYAKSHWCLEELAMLCDLKSSL-GRLVLPIFYEVEPCMLRKQNGPYEMDFEEHSK 132

Query: 590 KIGKDDEKVRRWKEALNKAGQLKG--YHLKND 679
           +    +EK++RW+ ALN  G + G  Y LK D
Sbjct: 133 RF--SEEKIQRWRRALNIIGNIPGFVYRLKYD 162



>pir|H96663|H96663 hypothetical protein T12P18.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_894049 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010852_1537132 Arabidopsis thaliana
           chromosome 1 BAC T12P18 genomic sequence, complete
           sequence.
          Length = 1017

 Score =  123 bits (309), Expect = 4e-27
 Identities = 71/174 (40%), Positives = 101/174 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q + ++VF SF GPDVRKT +  +     R GI  F DD ++ +   I  SL  AI+ES+
Sbjct: 10  QNYKFNVFASFHGPDVRKTLLSHIRLQFNRNGITMF-DDQKIVRSATIGPSLVEAIKESR 68

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + SK YASS WCL+EL  ++EC +K   QIV+ IFY V+P+DVR Q G F  +F E
Sbjct: 69  ISIVILSKKYASSSWCLDELVEILEC-KKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNE 127

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              +  K +E+ ++W +ALN+   + G       N  EA   E +A D+  +LN
Sbjct: 128 TCAR--KTEEERQKWSKALNQVSNIAGEDFLRWDN--EAIMIEKIARDVLDKLN 177



>gb:AC058785_1540226 Arabidopsis thaliana chromosome 1 BAC F13N6
           genomic sequence, complete sequence.
          Length = 897

 Score =  123 bits (308), Expect = 6e-27
 Identities = 71/174 (40%), Positives = 102/174 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W Y+VF SF GPDVR  F+  L +     GI  F DD+ +E+   I+ +L  AI ES+
Sbjct: 9   RNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMF-DDNGIERSQIIAPALKKAIGESR 67

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + SK YASS W L+EL  +++C+E +  QIV+ +FY V+P+DVRNQ G F  +FKE
Sbjct: 68  IAILLLSKNYASSSWSLDELLEILKCKEDI-GQIVMTVFYEVDPSDVRNQTGDFGIAFKE 126

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                 K +E+ ++W +AL   G + G   K+  N  EA   E +A D+   LN
Sbjct: 127 TCAH--KTEEERQKWTQALTYVGNIAGEDFKHWPN--EAKMIEKIARDVSDILN 176



>gb:AB022222_1515163 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUD12.
          Length = 1031

 Score =  123 bits (308), Expect = 6e-27
 Identities = 72/169 (42%), Positives = 100/169 (59%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVFLSFRG D R + +  L+E+L  RGI TFKDD RLE GD IS+ L  AI  S F +
Sbjct: 11  SYDVFLSFRGEDTRHSIVSHLYEALTSRGIATFKDDKRLELGDHISEELQRAIEGSDFVV 70

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            V S+ Y +S+WCL EL ++ME Q + +   V P+FY VEP+ VR Q GSF+    E ++
Sbjct: 71  VVLSENYPTSRWCLMELQSIMELQMEGRLG-VFPVFYRVEPSAVRYQLGSFD---LEGYQ 126

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHAR 736
           +  +  + V +W++AL     L G  + +     EAT    +  DI  R
Sbjct: 127 RDPQMADMVPKWRQALKLIADLSG--VASGQCIDEATMVRKIVEDISKR 173



>pir|H96606|H96606 hypothetical protein F25P12.102 [imported] -
           Arabidopsis thaliana>gb:AE005173_893529 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009323_1536731 Arabidopsis thaliana
           chromosome I BAC F25P12 genomic sequence, complete
           sequence.
          Length = 889

 Score =  123 bits (308), Expect = 6e-27
 Identities = 71/174 (40%), Positives = 102/174 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W Y+VF SF GPDVR  F+  L +     GI  F DD+ +E+   I+ +L  AI ES+
Sbjct: 9   RNWRYNVFTSFHGPDVRIKFLSHLRQQFIYNGITMF-DDNGIERSQIIAPALKKAIGESR 67

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + SK YASS W L+EL  +++C+E +  QIV+ +FY V+P+DVRNQ G F  +FKE
Sbjct: 68  IAILLLSKNYASSSWSLDELLEILKCKEDI-GQIVMTVFYEVDPSDVRNQTGDFGIAFKE 126

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
                 K +E+ ++W +AL   G + G   K+  N  EA   E +A D+   LN
Sbjct: 127 TCAH--KTEEERQKWTQALTYVGNIAGEDFKHWPN--EAKMIEKIARDVSDILN 176



>gb:AB022222_1515160 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUD12.
          Length = 1152

 Score =  122 bits (307), Expect = 8e-27
 Identities = 62/147 (42%), Positives = 91/147 (61%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           W YDVF SF G DVRKTF+  L   L+R+ I +FKD++ +E+   I+  L   I++S+  
Sbjct: 10  WVYDVFPSFSGEDVRKTFLSHLQLVLDRKLITSFKDNE-IERSQSIAPELVQGIKDSRIA 68

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I +FSK YASS WCL EL  ++ C+E  K Q+V+P+FY ++PT VR Q G F  +F+   
Sbjct: 69  IVIFSKNYASSSWCLNELLEIVSCKED-KGQLVIPVFYALDPTHVRKQTGDFGMAFE--R 125

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYH 667
             + K +++   W+ AL     + GYH
Sbjct: 126 TCLNKTEDEKNLWRVALTHVANILGYH 152



>gb:AB011477_1511421 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHK7.
          Length = 1104

 Score =  122 bits (307), Expect = 8e-27
 Identities = 72/170 (42%), Positives = 100/170 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF SF GPDVR  F+  L    E +GI  FKD + +E+G  I   L  AIRES+  I 
Sbjct: 12  YHVFSSFHGPDVRSGFLSHLHNHFESKGITPFKDQE-IERGHTIGPELIQAIRESRVSIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YASS WCL+EL  +++C+E    Q+V+ IFY V+P+DVR Q+G F ++FK+  E 
Sbjct: 71  VLSEKYASSCWCLDELVEILKCKE-ASGQVVMTIFYKVDPSDVRKQRGDFGSTFKKTCE- 128

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            GK     +RW +AL     + G H  +  N  EA   + +A D+  +LN
Sbjct: 129 -GKTWIVKQRWIKALEYIATVAGEHSLSWAN--EAELIQKIATDVSNKLN 175



>gb:ATF2I11_1550473 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 1189

 Score =  122 bits (306), Expect = 1e-26
 Identities = 68/167 (40%), Positives = 99/167 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           WT+ VF SF G DVR+ F+  +    +R GI  F D++ +++G+ I   L  AIR SK  
Sbjct: 60  WTHQVFPSFSGEDVRRDFLSHIQMEFQRMGITPFVDNE-IKRGESIGPELLRAIRGSKIA 118

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + S+ YASSKWCL+EL  +M+C+E+   Q V+ IFY V+P+DV+N  G F   F++  
Sbjct: 119 IILLSRNYASSKWCLDELVEIMKCREEY-GQTVMAIFYKVDPSDVKNLTGDFGKVFRK-- 175

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
              GK  + + RW++A  K   + GYH  N  N  EA   + +A DI
Sbjct: 176 TCAGKPKKDIGRWRQAWEKVATVAGYHSINWDN--EAAMIKKIATDI 220



>pir|G96754|G96754 hypothetical protein F3N23.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894841 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536439 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 379

 Score =  122 bits (305), Expect = 1e-26
 Identities = 68/144 (47%), Positives = 90/144 (62%), Gaps = 1/144 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVFLSFRG D R++FI FL++ L RR I TFKDD  L+ G  I+  L  AI  S+F + 
Sbjct: 11  FDVFLSFRGLDTRRSFISFLYKELIRRNIRTFKDDKELKNGRRITPELIRAIEGSRFAVV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S  YA+S+WCLEEL  +M+  E +    V+PIFY V+P  VR Q G     FK+ HE 
Sbjct: 71  VVSVNYAASRWCLEELVKIMDF-ENMGSLKVMPIFYGVDPCHVRRQIGEVAEQFKK-HE- 127

Query: 593 IGKDD-EKVRRWKEALNKAGQLKG 661
            G++D EKV  W++AL     + G
Sbjct: 128 -GREDHEKVLSWRQALTNLASISG 150



>pir|B85189|B85189 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545497 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551745 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1317

 Score =  121 bits (304), Expect = 2e-26
 Identities = 71/172 (41%), Positives = 103/172 (59%), Gaps = 3/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+ + I+TF D   +E+   I+  L +AIRE++  I 
Sbjct: 12  YDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHG-IERSRTIAPELISAIREARISIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+P+FY V+P++VR Q G F   F++  E 
Sbjct: 71  IFSKNYASSTWCLNELVEIHKCFNDL-GQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCE- 128

Query: 593 IGKD---DEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           + KD    ++ +RW +AL     + G  L N  N  EA   E ++ D+  +L
Sbjct: 129 VSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPN--EAHMVEKISNDVSNKL 178



>pir|F96662|F96662 hypothetical protein F24D7.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_894039 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537264 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.
          Length = 1131

 Score =  121 bits (303), Expect = 2e-26
 Identities = 68/172 (39%), Positives = 103/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + + VF SF GPDVRKT +  L E  + +GI  F DD+++++G  +S SL  AI+ SK  
Sbjct: 16  YKFKVFSSFHGPDVRKTLLSNLREHFQGKGITMF-DDEKIKRGGDLSPSLKRAIKTSKIS 74

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + S+ YASS WCL+EL  +M+ ++K  +QIV+ +FY VEP+DVR Q G F  +F +  
Sbjct: 75  IVILSQKYASSSWCLDELLEIMK-RKKAMKQIVMTVFYGVEPSDVRKQTGDFGIAFNK-- 131

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             + K D++ + W +AL     + G   K   N  EA   + +A D+  +LN
Sbjct: 132 TCVNKTDKERKEWSKALTDVSNIAGEDFKKWDN--EANMIKKIARDVSYKLN 181



>pir|B86398|B86398 protein T7N9.24 [imported] - Arabidopsis
           thaliana>gb:AE005172_891597 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530076 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 1590

 Score =  121 bits (303), Expect = 2e-26
 Identities = 62/145 (42%), Positives = 89/145 (61%), Gaps = 1/145 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESL-ERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           Y VFLSFRG D R  F + L+ +L E++ +  F+D++ +EKGD I  SL  AI +S   +
Sbjct: 210 YSVFLSFRGFDTRTNFCERLYIALNEKQNVRVFRDNEGMEKGDKIDPSLFEAIEDSAASV 269

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            + S  YA+S WCL+ELA + + +  LK   ++PIFY V P DVR Q G F   F+E  +
Sbjct: 270 IILSTNYANSSWCLDELALLCDLRSSLKRP-MIPIFYGVNPEDVRKQSGEFRKDFEEKAK 328

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGY 664
               D+E ++RWK A+N  G + GY
Sbjct: 329 SF--DEETIQRWKRAMNLVGNIPGY 351



 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 58/149 (38%), Positives = 84/149 (56%), Gaps = 5/149 (3%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDC-----ISQSLPNAIRES 397
           +D FLSF+  D    F D L+E+L +  +  + DD  LE+ D      +  SL  AI +S
Sbjct: 51  WDAFLSFQR-DTSHNFTDRLYEALVKEELRVWNDD--LERVDHDHDHELRPSLVEAIEDS 107

Query: 398 KFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFK 577
             F+ V S  YA+S   LEELA +  C  K    ++VPIFY VEP +V+ Q G FE  F+
Sbjct: 108 VAFVVVLSPNYANSHLRLEELAKL--CDLKC---LMVPIFYKVEPREVKEQNGPFEKDFE 162

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGY 664
           E  ++ G  +EK++RWK A+   G + G+
Sbjct: 163 EHSKRFG--EEKIQRWKGAMTTVGNISGF 189



>gb:AY093215_1575169 Arabidopsis thaliana disease resistance
           protein-like (At5g38850) mRNA, partial cds.
          Length = 672

 Score =  120 bits (302), Expect = 3e-26
 Identities = 70/169 (41%), Positives = 97/169 (57%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           +VF SF G D+RKTF+  L +     GI  F DD  +E+   I+ +L  AIRES+  I V
Sbjct: 1   NVFPSFHGGDIRKTFLSHLRKQFNSNGITMF-DDQGIERSQTIAPALIQAIRESRISIVV 59

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKI 595
            SK YASS WCL EL  +++C++     +V+PIFY V+P+DVR Q G F  +FK   +  
Sbjct: 60  LSKNYASSSWCLNELVEILKCKD-----VVMPIFYEVDPSDVRKQTGDFGKAFKNSCK-- 112

Query: 596 GKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            K  E+ +RW +AL   G + G H     N  EA   E +A D+  +LN
Sbjct: 113 SKTKEERQRWIQALIFVGNIAGEHSLKWEN--EADMIEKIAKDVSDKLN 159



>gb:AY054221_1563042 Arabidopsis thaliana At1g63870/T12P18_11 mRNA,
           complete cds.>gb:AY066043_1566600 Arabidopsis thaliana
           At1g63870/T12P18_11 mRNA, complete cds.
          Length = 334

 Score =  120 bits (302), Expect = 3e-26
 Identities = 70/172 (40%), Positives = 102/172 (59%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + Y VF SF GPDVRKT +  + +  +  GI  F DD  +E+ + I+ SL  AI+ES+  
Sbjct: 12  YKYIVFPSFHGPDVRKTLLSHMRKQFDFNGITMF-DDQGIERSEEIAPSLKKAIKESRIS 70

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YASS WCL+EL  +++ ++K  +QIV+ +FY VEP  VRNQ G F  +F E  
Sbjct: 71  IVILSKKYASSSWCLDELVDILK-RKKAMKQIVMTVFYGVEPFGVRNQTGEFGIAFNETC 129

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  K DE+ ++W +ALN+   + G       N  EA   E +A D+  +LN
Sbjct: 130 AR--KTDEERQKWSKALNEVANIAGEDFLRCDN--EAKRIEKIARDVSNKLN 177



>gb:AB012242_1511715 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24G6.
          Length = 1190

 Score =  120 bits (302), Expect = 3e-26
 Identities = 76/172 (44%), Positives = 100/172 (58%), Gaps = 3/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+T +  L+ +L  +GI TFKDD  LE GD IS  L  AI  SKF + 
Sbjct: 14  YDVFLSFRGEDTRRTIVSHLYAALGAKGIITFKDDQDLEVGDHISSHLRRAIEGSKFAVV 73

Query: 413 VFSKGYASSKWCLEELATVMECQE--KLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           V S+ Y +S+WCL EL  +ME     KLK   V+P+FY V+P+DVR+Q+GSF      L 
Sbjct: 74  VLSERYTTSRWCLMELQLIMELYNLGKLK---VLPLFYEVDPSDVRHQRGSF-----GLE 125

Query: 587 EKIGKD-DEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
              G +  + V+RW+ AL     L G  + + Y   EA   E +   I +RL
Sbjct: 126 RYQGPEFADIVQRWRVALCMVANLSG--MVSRYCADEAMMLEEIVEVISSRL 175



>gb:ATCHRIV45_1545493 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 45.
          Length = 1072

 Score =  120 bits (301), Expect = 4e-26
 Identities = 70/171 (40%), Positives = 104/171 (60%), Gaps = 2/171 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+ +RR I+TF D   +E+   I+  L +AIRE++  I 
Sbjct: 12  YDVFPSFSGVDVRKTFLSNLLEAFDRRSINTFMDHG-IERSRTIAPELISAIREARISIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKE--QIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           +FSK YASS WCL+EL   +E   +L +  Q+V+ +FY V+P++VR Q G F + FK+  
Sbjct: 71  IFSKNYASSTWCLDEL---VEIHNRLNDWGQLVISVFYDVDPSEVRKQTGEFGDVFKKTC 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           E   K++++ +RW +AL     + G  L+N     EA     +A D+  +L
Sbjct: 128 E--DKEEDQKQRWMQALVDITNIAGEDLRN--GPSEAAMVVKIANDVSNKL 174



>pir|A71437|A71437 probable resistance gene - Arabidopsis
           thaliana>gb:ATFCA7_1551740 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1038

 Score =  120 bits (301), Expect = 4e-26
 Identities = 70/171 (40%), Positives = 104/171 (60%), Gaps = 2/171 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+ +RR I+TF D   +E+   I+  L +AIRE++  I 
Sbjct: 12  YDVFPSFSGVDVRKTFLSNLLEAFDRRSINTFMDHG-IERSRTIAPELISAIREARISIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKE--QIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           +FSK YASS WCL+EL   +E   +L +  Q+V+ +FY V+P++VR Q G F + FK+  
Sbjct: 71  IFSKNYASSTWCLDEL---VEIHNRLNDWGQLVISVFYDVDPSEVRKQTGEFGDVFKKTC 127

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           E   K++++ +RW +AL     + G  L+N     EA     +A D+  +L
Sbjct: 128 E--DKEEDQKQRWMQALVDITNIAGEDLRN--GPSEAAMVVKIANDVSNKL 174



>pir|G85188|G85188 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545494 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551742 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1304

 Score =  120 bits (301), Expect = 4e-26
 Identities = 71/179 (39%), Positives = 102/179 (56%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           D+F SF G DVRK F+  L + L RR I+TF D   +E+   I+ +L +AIRE++  I +
Sbjct: 10  DIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHV-IERSCIIADALISAIREARISIVI 68

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKI 595
           FSK YA+S WCL EL  +  C  K   Q V+P+FY V+P+ VR Q G F   FK+  E  
Sbjct: 69  FSKNYAASTWCLNELVEIDNC-SKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCE-- 125

Query: 596 GKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDVI 772
            K  ++ +RW +AL     + G  L+N  N  +A   E +A D+  +L H   G  D++
Sbjct: 126 DKPADQKQRWVKALTDISNIAGEDLRNGPN--DAHMVEKIANDVSNKLFHPPKGFGDLV 182



>pir|G96606|G96606 disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AE005173_893528 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC058785_1540225 Arabidopsis thaliana
           chromosome 1 BAC F13N6 genomic sequence, complete
           sequence.>gb:BT014857_1641847 Arabidopsis thaliana
           At1g56510 gene, complete cds.
          Length = 1007

 Score =  120 bits (301), Expect = 4e-26
 Identities = 69/177 (38%), Positives = 101/177 (57%), Gaps = 3/177 (1%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W Y+VF SF GPDVR  F+  L +     GI  F DD+ +E+   I+ +L  AI ES+
Sbjct: 9   RNWRYNVFTSFHGPDVRIKFLSHLRQQFVYNGITMF-DDNGIERSQIIAPALKKAIGESR 67

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I + SK YASS WCL+EL  +++C+E +  QIV+ +FY V+P+ VR Q G F  +FKE
Sbjct: 68  VAIVLLSKNYASSSWCLDELLEILKCKEYI-GQIVMTVFYEVDPSHVRKQTGDFGIAFKE 126

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKG---YHLKNDYNEYEATCAENVAADIHARLN 742
                 K +E+  +W +AL   G + G    H K+     EA   E +A D+  ++N
Sbjct: 127 TCAH--KTEEERSKWSQALTYVGNIAGEDFIHWKD-----EAKMIEKIARDVSTKIN 176



>gb:ATRPP5LE2_1554110 Arabidopsis thaliana RPP5 disease resistance
           locus, main contig.
          Length = 1361

 Score =  120 bits (300), Expect = 5e-26
 Identities = 70/172 (40%), Positives = 103/172 (59%), Gaps = 3/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L ++L+ + I+TF D   +E+   I+  L +AIRE++  I 
Sbjct: 12  YDVFPSFSGVDVRKTFLSHLLKALDGKSINTFIDHG-IERSRTIAPELISAIREARISIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+P+FY V+P++VR Q G F   F++  E 
Sbjct: 71  IFSKNYASSTWCLNELVEIHKCFNDL-GQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCE- 128

Query: 593 IGKD---DEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           + KD    ++ +RW +AL     + G  L N  N  EA   E ++ D+  +L
Sbjct: 129 VSKDKQPGDQKQRWVQALTDIANIAGEDLLNGPN--EAHMVEKISNDVSNKL 178



>gb:AB011481_1511465 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSI17.
          Length = 213

 Score =  120 bits (300), Expect = 5e-26
 Identities = 63/148 (42%), Positives = 91/148 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVF SF G DVRKTF+  + +  + +G+  F D+D +E+   I   L  AIR SK  I 
Sbjct: 60  HDVFPSFHGADVRKTFLAHILKEFKGKGVVPFIDND-IERSKSIGPELIEAIRGSKIAIV 118

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S+ YASS WCL EL  +M+C+E+L  Q V+ IFY V+PTDV+ Q G F   FK+  + 
Sbjct: 119 LLSRNYASSSWCLNELVEIMKCREQL-GQTVMTIFYDVDPTDVKKQTGDFGKVFKKTCK- 176

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKN 676
            GK  E+++RW++ L     + G H +N
Sbjct: 177 -GKPKEEIKRWQKVLEDVATIAGEHSRN 203



>gb:AK175839_1817827 Arabidopsis thaliana mRNA for putative disease
           resistance protein (TMV N-like), complete cds, clone:
           RAFL22-45-H02.>gb:AK175963_1817951 Arabidopsis thaliana
           mRNA for putative disease resistance protein (TMV
           N-like), complete cds, clone: RAFL22-65-L13.
          Length = 543

 Score =  119 bits (298), Expect = 8e-26
 Identities = 74/172 (43%), Positives = 102/172 (59%), Gaps = 2/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVFLSFRG D R  F   L ++L  RGI +F DD RL +GD ++ +L + I +SK  I 
Sbjct: 11  FDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDD-RLRRGDNLT-ALFDRIEKSKIAII 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS  YA+S WCL EL  ++EC+    +Q+VVPIFY V+ +DV  Q+ SF   FK L E 
Sbjct: 69  VFSTNYANSAWCLRELVKILECRNS-NQQLVVPIFYKVDKSDVEKQRNSFAVPFK-LPEL 126

Query: 593 I--GKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              G   E++  WK AL  A  + GY +K + +  EA   + +A D   +LN
Sbjct: 127 TFPGVTPEEISSWKAALASASNILGYVVK-EISTSEAKLVDEIAVDTFKKLN 177



>gb:AB010698_1511218 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 1145

 Score =  119 bits (298), Expect = 8e-26
 Identities = 64/173 (36%), Positives = 103/173 (59%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVFLSFRG DVR TF     + L+R+ I  F+D++ +E+   +   L  AI++S+
Sbjct: 8   RNWLYDVFLSFRGGDVRVTFRSHFLKELDRKLITAFRDNE-IERSHSLWPDLEQAIKDSR 66

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + +FSK YASS WCL EL  ++ C +K    IV+P+FY V+P+ VR+Q G F   F++
Sbjct: 67  IAVVIFSKNYASSSWCLNELLEIVNCNDK----IVIPVFYGVDPSQVRHQIGDFGKIFEK 122

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  + ++   +WK+AL     + G+   +   + EA   E +A D+ A+L
Sbjct: 123 TCKR--QTEQVKNQWKKALTDVANMLGF--DSATWDDEAKMIEEIANDVLAKL 171



>pir|T06608|T06608 disease resistance protein homolog F16J13.80 -
           Arabidopsis thaliana>gb:ATCHRIV33_1544966 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           33.>gb:ATF16J13_1548801 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16J13 (ESSA project).
          Length = 1219

 Score =  119 bits (298), Expect = 8e-26
 Identities = 74/172 (43%), Positives = 102/172 (59%), Gaps = 2/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVFLSFRG D R  F   L ++L  RGI +F DD RL +GD ++ +L + I +SK  I 
Sbjct: 11  FDVFLSFRGFDTRNNFTGHLQKALRLRGIDSFIDD-RLRRGDNLT-ALFDRIEKSKIAII 68

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS  YA+S WCL EL  ++EC+    +Q+VVPIFY V+ +DV  Q+ SF   FK L E 
Sbjct: 69  VFSTNYANSAWCLRELVKILECRNS-NQQLVVPIFYKVDKSDVEKQRNSFAVPFK-LPEL 126

Query: 593 I--GKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              G   E++  WK AL  A  + GY +K + +  EA   + +A D   +LN
Sbjct: 127 TFPGVTPEEISSWKAALASASNILGYVVK-EISTSEAKLVDEIAVDTFKKLN 177



>gb:AY039923_1560436 Arabidopsis thaliana putative disease
           resistance protein (At1g69550) mRNA, complete
           cds.>gb:BT001958_1635561 Arabidopsis thaliana clone
           U09505 putative disease resistance protein (At1g69550)
           mRNA, complete cds.
          Length = 703

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/174 (38%), Positives = 102/174 (58%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           T+ VF SFRG DVR+ F+  + +   R+GI  F D++ + +G+ I   L  AIRESK  I
Sbjct: 79  THHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNE-IRRGESIGPELIKAIRESKIAI 137

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            + S+ YASSKWCLEEL  +M+C+++     V  IFY V+P+ V+   G F   F++  +
Sbjct: 138 VLLSRNYASSKWCLEELVEIMKCKKEF-GLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCK 196

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHAS 751
             G+  E + RW++A  +   + GY  +N  N  EA   E +A +I  RL ++S
Sbjct: 197 --GRTKENIMRWRQAFEEVATIAGYDSRNWEN--EAAMIEEIAIEISKRLINSS 246



>gb:AC073178_1541009 Arabidopsis thaliana chromosome 1 BAC F10D13
           genomic sequence, complete sequence.
          Length = 1398

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/174 (38%), Positives = 102/174 (58%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           T+ VF SFRG DVR+ F+  + +   R+GI  F D++ + +G+ I   L  AIRESK  I
Sbjct: 77  THHVFPSFRGDDVRRNFLSHIQKEFRRKGITPFIDNE-IRRGESIGPELIKAIRESKIAI 135

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            + S+ YASSKWCLEEL  +M+C+++     V  IFY V+P+ V+   G F   F++  +
Sbjct: 136 VLLSRNYASSKWCLEELVEIMKCKKEF-GLTVFAIFYEVDPSHVKKLTGEFGAVFQKTCK 194

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHAS 751
             G+  E + RW++A  +   + GY  +N  N  EA   E +A +I  RL ++S
Sbjct: 195 --GRTKENIMRWRQAFEEVATIAGYDSRNWEN--EAAMIEEIAIEISKRLINSS 244



>gb:AY143973_1583430 Arabidopsis thaliana At3g04210/T6K12_17 mRNA,
           complete cds.
          Length = 531

 Score =  118 bits (296), Expect = 1e-25
 Identities = 68/173 (39%), Positives = 100/173 (57%)
 Frame = +2

Query: 224 GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF 403
           G  + VF SF G DVRK+F+  + +  + +GI  F D D +++G  I   L  AIR S+ 
Sbjct: 63  GRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKD-IKRGKSIGPELTEAIRGSRV 121

Query: 404 FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKEL 583
            I   S+ YASS WCL ELA +M+C+++L    V+ +FY ++PTDVR Q G F  +FKE 
Sbjct: 122 AIVFLSRKYASSSWCLNELALIMKCRKEL-GLTVMTLFYDLDPTDVRKQTGDFGMAFKET 180

Query: 584 HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  GK  +++ RW+ AL +  ++ GYH  +   + EA     V  DI   LN
Sbjct: 181 CK--GKTKDEIGRWRHALEEVAKIAGYH--SSIWDNEADMIGIVTTDISNTLN 229



>gb:AY057522_1563940 Arabidopsis thaliana AT3g04210/T6K12_17 mRNA,
           complete cds.
          Length = 531

 Score =  118 bits (296), Expect = 1e-25
 Identities = 68/173 (39%), Positives = 100/173 (57%)
 Frame = +2

Query: 224 GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF 403
           G  + VF SF G DVRK+F+  + +  + +GI  F D D +++G  I   L  AIR S+ 
Sbjct: 63  GRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKD-IKRGKSIGPELTEAIRGSRV 121

Query: 404 FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKEL 583
            I   S+ YASS WCL ELA +M+C+++L    V+ +FY ++PTDVR Q G F  +FKE 
Sbjct: 122 AIVFLSRKYASSSWCLNELALIMKCRKEL-GLTVMTLFYDLDPTDVRKQTGDFGMAFKET 180

Query: 584 HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  GK  +++ RW+ AL +  ++ GYH  +   + EA     V  DI   LN
Sbjct: 181 CK--GKTKDEIGRWRHALEEVAKIAGYH--SSIWDNEADMIGIVTTDISNTLN 229



>gb:ATAC016829_1543648 Arabidopsis thaliana chromosome III BAC T6K12
           genomic sequence, complete sequence.
          Length = 505

 Score =  118 bits (296), Expect = 1e-25
 Identities = 68/173 (39%), Positives = 100/173 (57%)
 Frame = +2

Query: 224 GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF 403
           G  + VF SF G DVRK+F+  + +  + +GI  F D D +++G  I   L  AIR S+ 
Sbjct: 37  GRKHQVFPSFHGADVRKSFLSHIMKEFKSKGIDIFIDKD-IKRGKSIGPELTEAIRGSRV 95

Query: 404 FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKEL 583
            I   S+ YASS WCL ELA +M+C+++L    V+ +FY ++PTDVR Q G F  +FKE 
Sbjct: 96  AIVFLSRKYASSSWCLNELALIMKCRKEL-GLTVMTLFYDLDPTDVRKQTGDFGMAFKET 154

Query: 584 HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            +  GK  +++ RW+ AL +  ++ GYH  +   + EA     V  DI   LN
Sbjct: 155 CK--GKTKDEIGRWRHALEEVAKIAGYH--SSIWDNEADMIGIVTTDISNTLN 203



>gb:AC022492_1539060 Genomic sequence for Arabidopsis thaliana BAC
           F1L3 from chromosome I, complete sequence.
          Length = 827

 Score =  118 bits (296), Expect = 1e-25
 Identities = 64/145 (44%), Positives = 88/145 (60%), Gaps = 1/145 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVFLSFRG D R+TFI FL++ L   GI TFKDD  L+ G  I+  L  AI  SK  + 
Sbjct: 462 FDVFLSFRGKDTRRTFISFLYKELIEMGIRTFKDDVELQSGRRIASDLLAAIENSKIAVV 521

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK Y++S WCL+EL  +M+  EK    IV+PIFY+VEP  VR Q    E   K+  + 
Sbjct: 522 IISKNYSASPWCLQELVMIMDV-EKKGSIIVMPIFYNVEPAHVRRQ---IEQVAKQFRKH 577

Query: 593 IGKDD-EKVRRWKEALNKAGQLKGY 664
            G+++ E V  W++AL     + G+
Sbjct: 578 EGRENYETVVSWRQALTNLASISGH 602



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 46/142 (32%), Positives = 61/142 (42%), Gaps = 1/142 (0%)
 Frame = +2

Query: 224 GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKG-DCISQSLPNAIRESK 400
           G   DVFLSF G       +DF ++ L R GI  FK +   E     I      A+ ESK
Sbjct: 11  GRELDVFLSFSGKIALD--VDFGYD-LSRNGIKAFKSESWKESSFKPIDLRTLEALTESK 67

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + + S    SS   LEEL  ++E QEK +   V+P+F    P DV      F    K 
Sbjct: 68  VAVVMTSDEEVSSVGFLEELIVIIEFQEK-RSLTVIPVFLTKHPLDVEKVSQIFPERAKI 126

Query: 581 LHEKIGKDDEKVRRWKEALNKA 646
               I K D    ++  + N A
Sbjct: 127 WRTAIAKLDNIAAQYSFSRNLA 148



>gb:AB019223_1514031 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 1298

 Score =  118 bits (296), Expect = 1e-25
 Identities = 64/173 (36%), Positives = 102/173 (58%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVFLSF G DVR TF     + L+R+ I  F+D++ +E+   +   L  AI++S+
Sbjct: 46  RNWVYDVFLSFSGKDVRVTFRSHFLKELDRKLISAFRDNE-IERSHSLWPDLEQAIKDSR 104

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  ++ C +K    I++P+FY V+P+ VR Q G F + F++
Sbjct: 105 IAVVVFSKNYASSSWCLNELLEIVNCNDK----IIIPVFYGVDPSQVRYQIGEFGSIFEK 160

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  + +E   +WK+AL     + G+   +   + EA   E +A D+ A+L
Sbjct: 161 TCKR--QTEEVKNQWKKALTDVANMLGF--DSAKWDDEAKMIEEIANDVLAKL 209



>pir|T06143|T06143 disease resistence protein homolog F24J7.60 -
           Arabidopsis thaliana>gb:ATCHRIV51_1545790 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           51.>gb:ATF24J7_1549921 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24J7 (ESSA project).
          Length = 1239

 Score =  118 bits (296), Expect = 1e-25
 Identities = 72/180 (40%), Positives = 105/180 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF   DVR++F+  L + L+RR I+TF D   +E+   I   L +AI ES+  I 
Sbjct: 11  YDVFPSFSKVDVRRSFLAHLLKELDRRLINTFTDHG-MERNLPIDAELLSAIAESRISIV 69

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL+EL  +  C ++L  QIVVP+F++V P+ V+ Q G F   F +  + 
Sbjct: 70  IFSKNYASSTWCLDELVEIHTCYKEL-AQIVVPVFFNVHPSQVKKQTGEFGKVFGKTCK- 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDVI 772
            GK + +  RW +AL     + GY L+N  +  EA   E VA D+  +L  +S    D++
Sbjct: 128 -GKPENRKLRWMQALAAVANIAGYDLQNWPD--EAVMIEMVADDVSKKLFKSSNDFSDIV 184



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 29/90 (32%), Positives = 53/90 (58%)
 Frame = +2

Query: 395 SKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSF 574
           S+  I + S  Y SS+  L+ L  VME   K  + +++PI++ V  +D+   KG FE +F
Sbjct: 583 SRVGIMILSSSYVSSRQSLDHLVAVME-HWKTTDLVIIPIYFKVRLSDICGLKGRFEAAF 641

Query: 575 KELHEKIGKDDEKVRRWKEALNKAGQLKGY 664
            +LH  + +D  +V++WK A+++   + G+
Sbjct: 642 LQLHMSLQED--RVQKWKAAMSEIVSIGGH 669



>pir|E71437|E71437 probable resistance gene - Arabidopsis thaliana
          Length = 192

 Score =  118 bits (296), Expect = 1e-25
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 3/153 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SF G DVRKTF+  L E+L+ + I+TF D   +E+   I+  L +AIRE++  I 
Sbjct: 12  YDVFPSFSGVDVRKTFLSHLIEALDGKSINTFIDHG-IERSRTIAPELISAIREARISIV 70

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+P+FY V+P++VR Q G F   F++  E 
Sbjct: 71  IFSKNYASSTWCLNELVEIHKCFNDL-GQMVIPVFYDVDPSEVRKQTGEFGKVFEKTCE- 128

Query: 593 IGKD---DEKVRRWKEALNKAGQLKGYHLKNDY 682
           + KD    ++ +RW +AL     + G  L N Y
Sbjct: 129 VSKDKQPGDQKQRWVQALTDIANIAGEDLLNGY 161



>gb:AB019223_1514030 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 1353

 Score =  117 bits (294), Expect = 2e-25
 Identities = 64/173 (36%), Positives = 106/173 (61%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVF SF G DVR+ F+  L + L +  +++F+D + +E+   +   L  AIR+S+
Sbjct: 5   RNWVYDVFPSFSGTDVRRNFLSHLLKGLHK-SVNSFRDQN-MERSQSLDPMLKQAIRDSR 62

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  +++C+E+   Q+V+PIFY ++P+ VR+Q G F  +F+E
Sbjct: 63  IALVVFSKNYASSSWCLNELLEIVKCKEEF-GQMVIPIFYCLDPSHVRHQDGDFGKNFEE 121

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
              +   ++EK+ +W++AL     L G+   +   + EA   E +A D+  +L
Sbjct: 122 TCGR-NTEEEKI-QWEKALTDVANLAGF--DSVTWDDEAKMIEEIANDVSGKL 170



>gb:AB010698_1511217 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 1205

 Score =  117 bits (294), Expect = 2e-25
 Identities = 64/173 (36%), Positives = 100/173 (57%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVFLSFRG DVR TF     +  +R+ I  F+D++ +E+   +   L  AI+ES+
Sbjct: 8   RNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNE-IERSHSLWPDLEQAIKESR 66

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  ++ C +K    I++P+FY V+P+ VR Q G F   F++
Sbjct: 67  IAVVVFSKNYASSSWCLNELLEIVNCNDK----IIIPVFYGVDPSQVRYQIGEFGKIFEK 122

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  + +E   +WK+AL     + G+   +   + EA   E +A D+  +L
Sbjct: 123 TCKR--QTEEVKNQWKKALTHVANMLGF--DSSKWDDEAKMIEEIANDVLRKL 171



>pir|D96753|D96753 Similar to disease resistance proteins [imported]
           - Arabidopsis thaliana>gb:AE005173_894830 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008017_1536428 Arabidopsis thaliana
           chromosome I BAC F3N23 genomic sequence, complete
           sequence.
          Length = 1112

 Score =  117 bits (294), Expect = 2e-25
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 1/120 (0%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSFRG D R+T +  L+ +L   G+ TFKDD +LE GD I+  L  AI+ S F + 
Sbjct: 15  YDVFLSFRGVDTRQTIVSHLYVALRNNGVLTFKDDRKLEIGDTIADGLVKAIQTSWFAVV 74

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQI-VVPIFYHVEPTDVRNQKGSFENSFKELHE 589
           + S+ YA+S WCLEEL  +M+     +EQI V+PIFY V+P+DVR Q+GSF  +F+ + E
Sbjct: 75  ILSENYATSTWCLEELRLIMQLHS--EEQIKVLPIFYGVKPSDVRYQEGSFATAFQSVDE 132



>pir|H71436|H71436 hypothetical protein - Arabidopsis thaliana
          Length = 1184

 Score =  117 bits (293), Expect = 3e-25
 Identities = 67/165 (40%), Positives = 99/165 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SFRG DVR +F+  L + L  + I TF DD+ +E+   I   L +AI+ES+  I 
Sbjct: 12  YDVFPSFRGEDVRDSFLSHLLKELRGKAI-TFIDDE-IERSRSIGPELLSAIKESRIAIV 69

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+PIF+HV+ ++V+ Q G F   F+E  + 
Sbjct: 70  IFSKNYASSTWCLNELVEIHKCYTNL-NQMVIPIFFHVDASEVKKQTGEFGKVFEETCK- 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
             K +++ + WK+AL     + GY L+   +  EA   E +A D+
Sbjct: 128 -AKSEDEKQSWKQALAAVAVMAGYDLRKWPS--EAAMIEELAEDV 169



>pir|D85188|D85188 disease resistance RPP5 like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV45_1545491 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           45.>gb:ATFCA7_1551739 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 7.
          Length = 1301

 Score =  117 bits (293), Expect = 3e-25
 Identities = 67/165 (40%), Positives = 99/165 (60%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SFRG DVR +F+  L + L  + I TF DD+ +E+   I   L +AI+ES+  I 
Sbjct: 12  YDVFPSFRGEDVRDSFLSHLLKELRGKAI-TFIDDE-IERSRSIGPELLSAIKESRIAIV 69

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+PIF+HV+ ++V+ Q G F   F+E  + 
Sbjct: 70  IFSKNYASSTWCLNELVEIHKCYTNL-NQMVIPIFFHVDASEVKKQTGEFGKVFEETCK- 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
             K +++ + WK+AL     + GY L+   +  EA   E +A D+
Sbjct: 128 -AKSEDEKQSWKQALAAVAVMAGYDLRKWPS--EAAMIEELAEDV 169



>gb:AY830391_1629352 Brassica rapa disease resistance-like protein 9
           (RGA9) mRNA, partial cds.
          Length = 284

 Score =  116 bits (290), Expect = 7e-25
 Identities = 66/164 (40%), Positives = 94/164 (57%)
 Frame = +2

Query: 251 FRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGY 430
           F G DVRK  +  + +  +RRGI TF D++ +E+   I   L  AIR S+  I + SK Y
Sbjct: 1   FHGADVRKKILSHVLKEFKRRGIDTFIDNN-IERSKSIGPKLIEAIRGSRVAIVLLSKNY 59

Query: 431 ASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDE 610
           ASS WCL EL  + +C+ +   Q V+P+FY V+P+DV+ Q G F   F+++    GK +E
Sbjct: 60  ASSTWCLNELVEITKCRREF-GQTVMPVFYEVDPSDVKKQSGEFGKVFQDICN--GKKEE 116

Query: 611 KVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             R W+EAL +   + G H  N  +  EA   E +AADI   LN
Sbjct: 117 DTRTWREALVEVATIAGEHSSNWCS--EAEMIEKIAADISNVLN 158



>gb:AY510018_1610308 Arabidopsis thaliana SNC1-like protein (SNW)
           gene, partial cds.
          Length = 1052

 Score =  115 bits (289), Expect = 9e-25
 Identities = 70/165 (42%), Positives = 97/165 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVF SFRG DVR +F+  L + L  + I TF DD+ +E+   I   L +AI+ES+  I 
Sbjct: 12  YDVFPSFRGEDVRDSFLSHLLKELRGKAI-TFIDDE-IERSRSIGPELLSAIKESRIAIV 69

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK YASS WCL EL  + +C   L  Q+V+PIF+HV+ ++V+ Q G F   F E    
Sbjct: 70  IFSKNYASSTWCLNELVEIHKCYTNL-NQMVIPIFFHVDASEVKKQTGEFGKVF-EXTCN 127

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
              +DEK + WK+AL     + GY L+   N  EA   E +A D+
Sbjct: 128 ANLEDEK-QSWKQALAAVAVMAGYDLRKWPN--EAAMIEELAEDV 169



>gb:AY057653_1564066 Arabidopsis thaliana AT5g46490/K11I1_8 mRNA,
           complete cds.>gb:AY143872_1583329 Arabidopsis thaliana
           At5g46490/K11I1_8 mRNA, complete cds.
          Length = 357

 Score =  115 bits (288), Expect = 1e-24
 Identities = 63/173 (36%), Positives = 100/173 (57%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVFLSFRG DVR TF     +  +R+ I  F+D++ +E+   +   L  AI++S+
Sbjct: 8   RNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNE-IERSHSLWPDLEQAIKDSR 66

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  ++ C +K    I++P+FY V+P+ VR Q G F   F++
Sbjct: 67  IAVVVFSKNYASSSWCLNELLEIVNCNDK----IIIPVFYGVDPSQVRYQIGDFGRIFEK 122

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  + +E   +WK+AL     + G+   +   + EA   E +A D+  +L
Sbjct: 123 TCKR--QTEEVKNQWKKALTLVANMLGF--DSAKWDDEAKMIEEIANDVLRKL 171



>gb:AB019223_1514028 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11I1.
          Length = 858

 Score =  115 bits (288), Expect = 1e-24
 Identities = 63/173 (36%), Positives = 100/173 (57%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W YDVFLSFRG DVR TF     +  +R+ I  F+D++ +E+   +   L  AI++S+
Sbjct: 8   RNWLYDVFLSFRGGDVRVTFRSHFLKEFDRKLITAFRDNE-IERSHSLWPDLEQAIKDSR 66

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             + VFSK YASS WCL EL  ++ C +K    I++P+FY V+P+ VR Q G F   F++
Sbjct: 67  IAVVVFSKNYASSSWCLNELLEIVNCNDK----IIIPVFYGVDPSQVRYQIGDFGRIFEK 122

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             ++  + +E   +WK+AL     + G+   +   + EA   E +A D+  +L
Sbjct: 123 TCKR--QTEEVKNQWKKALTLVANMLGF--DSAKWDDEAKMIEEIANDVLRKL 171



>gb:AB015473_1512540 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCM23.
          Length = 780

 Score =  114 bits (285), Expect = 3e-24
 Identities = 61/144 (42%), Positives = 88/144 (61%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +Y VF SF G DVR+ F+  L + L+  GI  FKD   +++   I   L  AI ESK FI
Sbjct: 15  SYHVFPSFCGEDVRRNFLSHLHKELQHNGIDAFKDGG-IKRSRSIWPELKQAIWESKIFI 73

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            V SK YA S WCL+EL  +MEC+E + + + VPIFY V+P+ VR Q G F  +F ++ +
Sbjct: 74  VVLSKNYAGSCWCLDELVEIMECREVVGKTL-VPIFYDVDPSSVRKQTGDFGKAFDKICD 132

Query: 590 KIGKDDEKVRRWKEALNKAGQLKG 661
              + +E+ +RW++AL   G + G
Sbjct: 133 V--RTEEERQRWRQALTNVGNIAG 154



>pir|G96663|G96663 hypothetical protein T12P18.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_894048 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010852_1537133 Arabidopsis thaliana
           chromosome 1 BAC T12P18 genomic sequence, complete
           sequence.
          Length = 1031

 Score =  114 bits (284), Expect = 4e-24
 Identities = 67/172 (38%), Positives = 96/172 (55%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + ++VF SF GP+VRKT +  + +     GI  F DD  +E+ + I  SL  AI+ES+  
Sbjct: 15  YRFNVFSSFHGPNVRKTLLSHMRKQFNFNGITMF-DDQGIERSEEIVPSLKKAIKESRIS 73

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           I + SK YA S+WCL+EL  +++C+E +   IV+ IFY VEP+DVR Q G F   F E  
Sbjct: 74  IVILSKKYALSRWCLDELVEILKCKE-VMGHIVMTIFYGVEPSDVRKQTGEFGFHFNETC 132

Query: 587 EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
               + DE  + W +AL   G + G       N  EA   E +A D+  +LN
Sbjct: 133 AH--RTDEDKQNWSKALKDVGNIAGEDFLRWDN--EAKMIEKIARDVSDKLN 180



>gb:AY820142_1628814 Brassica rapa disease resistance-like protein
           (RGA8) mRNA, partial cds.
          Length = 285

 Score =  113 bits (283), Expect = 5e-24
 Identities = 59/164 (35%), Positives = 99/164 (60%)
 Frame = +2

Query: 251 FRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGY 430
           F G DVR  F+  + +  + +GI  F D+D +++   I   L +AI+ S+  + + S+ Y
Sbjct: 1   FHGADVRTNFLSHVVKEPKSKGIDLFIDND-IDRSKSIGPELVDAIKGSRIAMVLLSEDY 59

Query: 431 ASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDE 610
           ASS WCL EL  +++C+++   Q V+ IFY V+P+DV+ Q G F   FK+  +  GK ++
Sbjct: 60  ASSTWCLNELVEIIKCRQEF-GQTVMSIFYQVDPSDVKKQTGQFGKVFKKTCK--GKTED 116

Query: 611 KVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           ++RRWK AL +  Q+ G+H  N   + EA   E++A D+  +L+
Sbjct: 117 EIRRWKRALTEVAQIAGFHSSN--GKSEAEMIEDIATDVSNKLS 158



>gb:AY091566_1574671 Pinus taeda putative TIR/NBS/LRR disease
           resistance protein mRNA, partial cds.
          Length = 987

 Score =  113 bits (283), Expect = 5e-24
 Identities = 57/163 (34%), Positives = 94/163 (57%), Gaps = 10/163 (6%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF 406
           + +D+FL+ RGPD +KT    L++ L + G+  F D+D L+ G+ I   + +AIR +   
Sbjct: 22  FVFDIFLNHRGPDSKKTLAKHLYDGLSKHGLRVFLDEDELQAGEYIKPQIESAIRTAWVH 81

Query: 407 IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVR----NQKGSFENSF 574
           IA+FSKGYA S WCL EL  + +         ++P+FY V+P D+R    ++KG +  S 
Sbjct: 82  IAIFSKGYADSPWCLNELLLMFQ-----SGSTIIPVFYDVDPADLRWVTHSEKGVYARSL 136

Query: 575 KELHEKIGKDD------EKVRRWKEALNKAGQLKGYHLKNDYN 685
           + L +K   D       + +++W++AL  A ++KG+  K  YN
Sbjct: 137 QTLEKKRKADSTPRYDPDTIQKWRKALTDAAEIKGFD-KKTYN 178



>pir|B71437|B71437 probable resistance gene - Arabidopsis thaliana
          Length = 1422

 Score =  113 bits (283), Expect = 5e-24
 Identities = 63/149 (42%), Positives = 88/149 (59%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           D+F SF G DVRK F+  L + L RR I+TF D   +E+   I+ +L +AIRE++  I +
Sbjct: 10  DIFPSFSGEDVRKNFLSHLLKQLNRRSINTFMDHV-IERSCIIADALISAIREARISIVI 68

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKI 595
           FSK YA+S WCL EL  +  C  K   Q V+P+FY V+P+ VR Q G F   FK+  E  
Sbjct: 69  FSKNYAASTWCLNELVEIDNC-SKYFGQKVIPVFYDVDPSHVRKQIGEFGKVFKKTCE-- 125

Query: 596 GKDDEKVRRWKEALNKAGQLKGYHLKNDY 682
            K  ++ +RW +AL     + G  L+N Y
Sbjct: 126 DKPADQKQRWVKALTDISNIAGEDLRNGY 154



>pir|D71437|D71437 probable resistance gene - Arabidopsis thaliana
          Length = 2467

 Score =  112 bits (279), Expect = 1e-23
 Identities = 64/160 (40%), Positives = 96/160 (60%), Gaps = 1/160 (0%)
 Frame = +2

Query: 263  DVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSK 442
            DVRKTF+  L E+L+RR I+TF D   + +   I+  L  AIRE++  I +FS+ YASS 
Sbjct: 1145 DVRKTFLSHLIEALDRRSINTFMDHG-IVRSCIIADELITAIREARISIVIFSENYASST 1203

Query: 443  WCLEELATVMEC-QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVR 619
            WCL EL  + +C ++K  +Q+V+P+FY V+P+ VR Q G F + FK+  E   K +++ +
Sbjct: 1204 WCLNELVEIHKCHKDKDLDQMVIPVFYGVDPSHVRKQIGGFGDVFKKTCE--DKPEDQKQ 1261

Query: 620  RWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            RW +AL     L G  L+N     EA     +A D+  +L
Sbjct: 1262 RWVKALTDISNLAGEDLRN--GPSEAAMVVKIANDVSNKL 1299



>gb:AF541963_1809959 Glycine max cv Williams 82 BAC clone
           Gm_ISb001_091_F11, complete sequence.
          Length = 893

 Score =  111 bits (277), Expect = 2e-23
 Identities = 65/174 (37%), Positives = 100/174 (57%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           YDVFLSF   D  + F  +L+++L  RGI+TF  D  L +   ++  L  AI  S+  I 
Sbjct: 12  YDVFLSFIREDTHRGFTFYLYKALNDRGIYTFFYDQELPRETEVTPGLYKAILASRVAII 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA S +CL+EL T++ C     E+ V+P+F++V+P+DVR+QKGS+  +  + H+K
Sbjct: 72  VLSENYAFSSFCLDELVTILHC-----EREVIPVFHNVDPSDVRHQKGSYGEAMAK-HQK 125

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASL 754
             K  +K+++W+ AL +   L GYH K D   YE      +   +      ASL
Sbjct: 126 RFK-AKKLQKWRMALKQVANLCGYHFK-DGGSYEYMLIGRIVKQVSRMFGLASL 177



>pir|D84729|D84729 probable disease resistance protein [imported] -
           Arabidopsis thaliana>gb:AC006223_1533677 Arabidopsis
           thaliana chromosome 2 clone F22D22 map TEn5, complete
           sequence.
          Length = 238

 Score =  111 bits (277), Expect = 2e-23
 Identities = 55/138 (39%), Positives = 87/138 (63%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF+SFRG ++RK FI FL  +L+++ I+ F D+  +   D IS  L   I ESK  + +F
Sbjct: 23  VFISFRGKELRKGFISFLVPALKKKNINVFIDEHEVRGKDLIS--LFRRIGESKIALVIF 80

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  SKWCL+EL  + +C ++ K+ I +PIFY ++P  V+  KG F + F++L E+  
Sbjct: 81  SEGYTESKWCLDELVQIKKCVDQ-KKIIAIPIFYKLDPAVVKGLKGKFGDKFRDLIERYH 139

Query: 599 KDDEKVRRWKEALNKAGQ 652
            + E+ ++W EAL    +
Sbjct: 140 HEPERYQKWTEALTSVSR 157



>gb:AF322633_1786135 Glycine max putative resistance protein (L33)
           mRNA, complete cds.
          Length = 522

 Score =  110 bits (274), Expect = 5e-23
 Identities = 60/175 (34%), Positives = 104/175 (59%), Gaps = 3/175 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQS---LPNAIRES 397
           + +DVFLSFRG D R  F+  L+++L  +G HTF  + +L +G+ I+ S   +  AI+ S
Sbjct: 14  YEFDVFLSFRGEDTRLGFVGNLYKALTEKGFHTFFRE-KLVRGEEIAASPSVVEKAIQHS 72

Query: 398 KFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFK 577
           + F+ VFS+ YASS  CLEEL +++   +  +   V+P+FY+V+P+DV  Q G +  +  
Sbjct: 73  RVFVVVFSQNYASSTRCLEELLSILRFSQDNRRP-VLPVFYYVDPSDVGLQTGMYGEALA 131

Query: 578 ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
              ++   + +KV +W++AL +A  L G+  K+  + YE    E +   +  ++N
Sbjct: 132 MHEKRFNSESDKVMKWRKALCEAAALSGWPFKHG-DGYEYELIEKIVEGVSKKIN 185



>pir|T01463|T01463 hypothetical protein T24H24.18 - Arabidopsis
           thaliana>gb:ATCHRIV11_1544255 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 11.>gb:T24H24_1723873
           Arabidopsis thaliana BAC T24H24.
          Length = 239

 Score =  110 bits (274), Expect = 5e-23
 Identities = 60/174 (34%), Positives = 95/174 (54%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           Q W   VF SF   D+R+TF+    + L+R+ I  FKD++ +E+   ++  L   IR+S+
Sbjct: 39  QFWVLYVFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNE-IERSQSLNPDLKRPIRDSR 97

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I +FSK YASS WCL EL  ++ C+E     +V+P+FY ++P+ VR Q G+F   FK+
Sbjct: 98  IAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKK 157

Query: 581 LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
             +   +D+  +RR   AL       GYH        +A   + +  D+  +LN
Sbjct: 158 TCQNRTEDEINLRR--RALIDVANTLGYH----STICKANMTKEITNDVLVKLN 205



>gb:AB019224_1514034 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17O22.>gb:BT010864_1640810 Arabidopsis
           thaliana At5g45070 mRNA, complete
           cds.>gb:BT012618_1641688 Arabidopsis thaliana At5g45070
           gene, complete cds.
          Length = 354

 Score =  109 bits (273), Expect = 7e-23
 Identities = 61/156 (39%), Positives = 92/156 (58%), Gaps = 4/156 (2%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+R  F+ FL  ++    I+ F D D +   D ++  +   I+ES+  + +F
Sbjct: 16  VFINFRGKDLRNGFLSFLEPAMREANINVFIDKDEVVGTDLVNLFV--RIQESRVAVVIF 73

Query: 419 SKGYASSKWCLEELATVMEC--QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           SK Y SS+WCL+ELA + +C  Q  L     +PIFY + P+ V   KG F ++F+ L EK
Sbjct: 74  SKDYTSSEWCLDELAEIKDCINQGGLN---AIPIFYKLAPSSVLELKGGFGDTFRVLKEK 130

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHL--KNDYNEYE 694
              D E+ ++W+EAL    +LKG  L  K+D NE E
Sbjct: 131 YKNDPERTQKWQEALESIPKLKGLRLAEKSDRNERE 166



>pir|E96610|E96610 probable disease resistance protein RPP1-WsB
           [imported] - Arabidopsis thaliana>gb:AE005173_893558
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC079733_1732754 Arabidopsis thaliana
           chromosome 1 BAC T8L23 genomic sequence, complete
           sequence.
          Length = 172

 Score =  109 bits (272), Expect = 9e-23
 Identities = 64/153 (41%), Positives = 90/153 (58%), Gaps = 3/153 (1%)
 Frame = +2

Query: 227 WTYDVFLSFRGPDVRKTFI-DFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF 403
           W YDVF SF G DVRK F+   L +   R+ I+ F D + +E+G+ I   L  AI+ SK 
Sbjct: 20  WDYDVFPSFHGEDVRKAFLSQILKKEFGRKAINFFVDHE-MERGEFIGPVLKQAIKGSKI 78

Query: 404 FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKEL 583
            + + SK YASS  CL+EL  +M   +K   Q V+ IFY V+P +V+ Q G F  +FKE 
Sbjct: 79  ALVLLSKNYASSWCCLDELVEIM---KKESGQTVITIFYEVDPNEVKKQTGDFGKAFKET 135

Query: 584 HEKIGKDDEKVRRWKEALNKAG--QLKGYHLKN 676
            +  GK +EKV+ W++AL   G   + G+H  N
Sbjct: 136 CQ--GKTEEKVQTWRKALEGVGLATIAGFHSSN 166



>gb:AC006081_1533426 Arabidopsis thaliana chromosome 2 clone T2G17
           map mi148, complete sequence.>gb:AF361584_1791330
           Arabidopsis thaliana At2g20141 mRNA, complete cds.
          Length = 187

 Score =  108 bits (271), Expect = 1e-22
 Identities = 60/181 (33%), Positives = 101/181 (55%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVF+SFR  D R  F+  L   L R+ I TF  D+ L   +   +SL  AI  SK  + 
Sbjct: 9   HDVFISFRSKDTRDNFVSHLCGCLRRKRIKTFLYDE-LPADERYEESL-KAIEVSKISVI 66

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ +  S+WCL+E+  +++C+EK   QIV+P+ YHV+P D+ NQ GSF ++F +  +K
Sbjct: 67  VFSENFGDSRWCLDEVVAILKCKEKFG-QIVIPVLYHVDPLDIENQTGSFGDAFAKRRDK 125

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDVI 772
                E+++ WK++  +A  L G+     Y  Y      ++   + + L    +  I+++
Sbjct: 126 A----EQLQEWKDSFTEAINLPGW--STAYLRYNPKLILSIKVTVVSELQDVLISGINIM 179

Query: 773 L 775
           +
Sbjct: 180 I 180



>gb:AY099745_1576770 Arabidopsis thaliana putative disease
           resistance protein (At1g63740) mRNA, complete cds.
          Length = 992

 Score =  108 bits (270), Expect = 1e-22
 Identities = 60/137 (43%), Positives = 81/137 (59%)
 Frame = +2

Query: 332 DDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVP 511
           DD  +E+G  IS  L   IRES+  I V SK YASS WCL+EL  +++C+E +  QIV+ 
Sbjct: 3   DDQAIERGQTISPELTRGIRESRISIVVLSKNYASSSWCLDELLEILKCKEDI-GQIVMT 61

Query: 512 IFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEY 691
           +FY V+ +DVR Q G     FK+     GK +EK RRW +ALN  G + G H  N  N  
Sbjct: 62  VFYGVDLSDVRKQTGDILKVFKKTCS--GKTEEKRRRWSQALNDVGNIAGEHFLNWDN-- 117

Query: 692 EATCAENVAADIHARLN 742
           E+   E +A DI  ++N
Sbjct: 118 ESKMMEKIARDISNKVN 134



>pir|F71405|F71405 probable TMV resistance protein - Arabidopsis
           thaliana>gb:ATCHRIV38_1545201 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 38.>gb:ATFCA1_1551487
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 1996

 Score =  108 bits (270), Expect = 1e-22
 Identities = 58/137 (42%), Positives = 84/137 (61%)
 Frame = +2

Query: 332 DDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVP 511
           DD  +E+   I+ +L  AI+ES+  I + SK YASS WCL+EL  +++C+E +  QIV+ 
Sbjct: 3   DDQEIERSQTIAPALIKAIKESRISIILLSKNYASSSWCLDELLEIVKCKEAM-GQIVMT 61

Query: 512 IFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEY 691
           +FY V+P+DVR Q G F  SF E   +  K  EK R+W +ALN  G + G H +N  N  
Sbjct: 62  VFYGVDPSDVRKQTGEFGRSFNETCSRSTK--EKRRKWSQALNHVGNIAGEHFQNWDN-- 117

Query: 692 EATCAENVAADIHARLN 742
           E+   E ++ DI  +LN
Sbjct: 118 ESKMIEKISRDISNKLN 134



>gb:AF316418_1785542 Helianthus annuus resistance gene analog NBS14
           (NBS14) gene, partial cds.
          Length = 208

 Score =  106 bits (265), Expect = 6e-22
 Identities = 57/131 (43%), Positives = 83/131 (63%)
 Frame = +2

Query: 365 SQSLPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVR 544
           ++  P AI+ES+  + VFSK YA S WCL+ELA +MEC +  + QIV+PIFYHV+P+DVR
Sbjct: 15  TKHFPGAIQESRVAVIVFSKNYADSSWCLDELAHIMECMD-TRGQIVMPIFYHVDPSDVR 73

Query: 545 NQKGSFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAAD 724
            QKG +  +F + HE+  K   KV  W++AL KAG+L G+ + +  N  +    E    D
Sbjct: 74  KQKGKYGEAFTK-HERENK--LKVESWRKALEKAGKLSGWVINDIENSKDLIGIETRLQD 130

Query: 725 IHARLNHASLG 757
           + ++L   S G
Sbjct: 131 LISKLEIGSGG 141



>gb:AF316416_1785540 Helianthus annuus resistance gene analog NBS12
           (NBS12) gene, partial cds.
          Length = 207

 Score =  104 bits (260), Expect = 2e-21
 Identities = 55/118 (46%), Positives = 78/118 (66%)
 Frame = +2

Query: 386 IRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFE 565
           I+ES+  + VFS+ YA S WCL+ELA +MEC +  K QIV PIFY V+P+DVR QKG + 
Sbjct: 1   IQESRIALVVFSENYADSSWCLDELAHIMECVD-TKGQIVEPIFYFVDPSDVRKQKGKYG 59

Query: 566 NSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            +F++ H++  K   KV  W++AL KAG L G+ +    N +EA C + + A I +RL
Sbjct: 60  KAFRK-HKRENK--HKVESWRKALEKAGNLSGWVINE--NSHEAKCIKEIVATISSRL 112



>gb:AY187301_1588155 Manihot esculenta RCa11 gene, partial cds.
          Length = 98

 Score =  104 bits (260), Expect = 2e-21
 Identities = 50/99 (50%), Positives = 67/99 (67%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           +VFLSFRG D RK+F D L+ SL ++GI  F+DD  L++G  I   +  AI ES+F I +
Sbjct: 1   EVFLSFRGQDTRKSFTDHLYASLNQKGIIVFRDDPSLKRGKEIVPEIMKAIEESRFSIVI 60

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEP 532
           FS+ YASS WCL+EL  + EC    K QI+ P+FY V+P
Sbjct: 61  FSRNYASSSWCLDELVQIHECM-NTKGQIIFPVFYDVDP 98



>gb:AB011480_1511453 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPI7.
          Length = 1188

 Score =  103 bits (258), Expect = 4e-21
 Identities = 61/141 (43%), Positives = 85/141 (60%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG ++RK F+  L + L+R+GI+ F D D  E G  +S  L   I  S+  +A+F
Sbjct: 19  VFINFRGVELRKNFVSHLEKGLKRKGINAFIDTDE-EMGQELSVLLER-IEGSRIALAIF 76

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S  Y  SKWCL+ELA + E  E+ KE +V+PIFY V+P  V+  KG F + F+EL +   
Sbjct: 77  SPRYTESKWCLKELAKMKERTEQ-KELVVIPIFYKVQPVTVKELKGDFGDKFRELVKSTD 135

Query: 599 KDDEKVRRWKEALNKAGQLKG 661
           K  +K   WKEAL     L G
Sbjct: 136 KKTKK--EWKEALQYVPFLTG 154



>gb:AX765792_1474585 Sequence 1 from Patent
           WO03008440.>gb:AB012242_1511716 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC clone:K24G6.
          Length = 669

 Score =  103 bits (256), Expect = 6e-21
 Identities = 55/141 (39%), Positives = 88/141 (62%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VFLSF+G D R+TF+  L  SL+R+GI TF+D++   +G+  S ++   I ESK  + + 
Sbjct: 14  VFLSFQGLDTRRTFVSHLRRSLDRKGIKTFEDENESLRGELDSSAVYQTIGESKVAVVLI 73

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S  YASS  CL+ L  +++  +     +++PIFY V+P DVR Q G    +F  LHE+  
Sbjct: 74  SVNYASSPLCLDSLLKILKFHQS-GSLVLIPIFYEVDPMDVRKQIGKLYEAF-SLHER-- 129

Query: 599 KDDEKVRRWKEALNKAGQLKG 661
           ++ EKV+ W++AL++   + G
Sbjct: 130 ENPEKVQTWRQALSQLVSIPG 150



>pir|T06145|T06145 disease resistance protein homolog F24J7.80 -
            Arabidopsis thaliana>gb:ATCHRIV51_1545792 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            51.>gb:ATF24J7_1549923 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F24J7 (ESSA project).
          Length = 1715

 Score =  103 bits (256), Expect = 6e-21
 Identities = 71/170 (41%), Positives = 95/170 (55%), Gaps = 2/170 (1%)
 Frame = +2

Query: 236  DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCI-SQSLPN-AIRESKFFI 409
            DVF+SF G D RK FI    + L  +GI       R+  GD I S+SL N  I+ES   +
Sbjct: 1373 DVFVSFHGKDFRKQFISDFLKKLVYKGI-------RICIGDKILSRSLINKVIKESSIAV 1425

Query: 410  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
             VFS+ YASS  CL +L  +M+C E+L  Q+V+PIFY V P+D+RNQ G F   FK+  +
Sbjct: 1426 VVFSENYASSSLCLLQLMEIMKCWEELG-QVVMPIFYKVNPSDIRNQSGHFGKGFKKTCK 1484

Query: 590  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            K   D+   +RW  AL  A  + G    N  +  +A   E VA DI  +L
Sbjct: 1485 KTINDER--QRWSRALTDAASIAGECSLNWAS--DADMIEKVANDIRKKL 1530



 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 42/160 (26%), Positives = 79/160 (49%)
 Frame = +2

Query: 290 LFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLEELATV 469
           + +  +R+G+  F  +D     D  ++    AI +++  + +FS+ +ASSK CL E   V
Sbjct: 1   MVDEFQRKGVSVFASEDSASD-DRFAEESDAAIAKARVSVVIFSENFASSKGCLNEFLKV 59

Query: 470 MECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRWKEALNKAG 649
            +C+ + K  +VVP+FY +  + V+      +  +          D+KV  W+ AL    
Sbjct: 60  SKCR-RSKGLVVVPVFYGLTNSIVKKHCLELKKMY---------PDDKVDEWRNALWDIA 109

Query: 650 QLKGYHLKNDYNEYEATCAENVAADIHARLNHASLGRIDV 769
            L+G H+ + +   ++   E + AD+  +L+    GRI V
Sbjct: 110 DLRGGHV-SSHKRSDSELVEKIVADVRQKLDRR--GRIGV 146



>gb:AF528682_1808707 Arabidopsis lyrata T8F5.18 gene, partial cds.
          Length = 184

 Score =  102 bits (253), Expect = 1e-20
 Identities = 56/139 (40%), Positives = 86/139 (61%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL N I ESK  + +F
Sbjct: 10  VFINFRGKDLRKGFLSFLKPALKKEKINVFIDEQE-ERGKYLI-SLFNTIGESKIALVIF 67

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S WC++EL T+ E  +K + +I +PIFY +E   V++  G F N+F  + +K  
Sbjct: 68  SEGYCESHWCMDELVTIKEYMDKNRLKI-IPIFYRLELDVVKDLTGKFGNNFWNMVDKYQ 126

Query: 599 KDDEKVRRWKEALNKAGQL 655
            + EK+ +W EAL    QL
Sbjct: 127 PEPEKLHKWTEALFSVCQL 145



>pir|T06144|T06144 disease resistance protein homolog F24J7.70 -
           Arabidopsis thaliana>gb:ATCHRIV51_1545791 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           51.>gb:ATF24J7_1549922 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24J7 (ESSA project).
          Length = 1164

 Score =  102 bits (253), Expect = 1e-20
 Identities = 59/144 (40%), Positives = 85/144 (59%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           +DVF+SFRG D R  F   L + L  +GI  F D  +L  G+ IS  L + I +SK  I 
Sbjct: 24  FDVFVSFRGADTRHDFTSHLVKYLRGKGIDVFSDA-KLRGGEYISL-LFDRIEQSKMSIV 81

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           VFS+ YA+S WCLEE+  +M+ +++     V+PIFY V  +DV NQ GSFE  F+   + 
Sbjct: 82  VFSEDYANSWWCLEEVGKIMQRRKEFNHG-VLPIFYKVSKSDVSNQTGSFEAVFQSPTKI 140

Query: 593 IGKDDEKVRRWKEALNKAGQLKGY 664
              D++K+   K AL  A  ++G+
Sbjct: 141 FNGDEQKIEELKVALKTASNIRGF 164



>gb:AB019224_1514033 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17O22.
          Length = 1165

 Score =  100 bits (249), Expect = 4e-20
 Identities = 55/135 (40%), Positives = 84/135 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG D+R  F+  L E+LE   I  F D+   +KG+ + ++L   I +SK  +A
Sbjct: 14  HQVFINFRGEDLRLGFVSHLVEALENDNIKVFIDN-YADKGEPL-ETLLTKIHDSKIALA 71

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  S WCL ELA + +C EK K  + +PIFY V+P+ VR  +G F ++F++L E 
Sbjct: 72  IFSGKYTESTWCLRELAMIKDCVEKGK-LVAIPIFYKVDPSTVRGVRGQFGDAFRDLEE- 129

Query: 593 IGKDDEKVRRWKEAL 637
             +D  K + WK+AL
Sbjct: 130 --RDVIKKKEWKQAL 142



>gb:AF528690_1808715 Arabidopsis thaliana ecotype Cvi-0 T8F5.18
           gene, partial cds.>gb:AF528691_1808716 Arabidopsis
           thaliana ecotype Bs-1 T8F5.18 gene, partial
           cds.>gb:AF528692_1808717 Arabidopsis thaliana ecotype
           Chi-1 T8F5.18 gene, partial cds.>gb:AF528693_1808718
           Arabidopsis thaliana ecotype Co-1 T8F5.18 gene, partial
           cds.>gb:AF528694_1808719 Arabidopsis thaliana ecotype
           Gr-3 T8F5.18 gene, partial cds.>gb:AF528695_1808720
           Arabidopsis thaliana ecotype Ita-0 T8F5.18 gene, partial
           cds.>gb:AF528696_1808721 Arabidopsis thaliana ecotype
           Lisse-2 T8F5.18 gene, partial cds.>gb:AF528697_1808722
           Arabidopsis thaliana ecotype Bu-0 T8F5.18 gene, partial
           cds.>gb:AF528698_1808723 Arabidopsis thaliana ecotype
           El-0 T8F5.18 gene, partial cds.>gb:AF528699_1808724
           Arabidopsis thaliana ecotype Jl-3 T8F5.18 gene, partial
           cds.>gb:AF528700_1808725 Arabidopsis thaliana ecotype
           Pi-0 T8F5.18 gene, partial cds.>gb:AF528701_1808726
           Arabidopsis thaliana ecotype Sf-1 T8F5.18 gene, partial
           cds.>gb:AF528702_1808727 Arabidopsis thaliana ecotype
           Ler-0 T8F5.18 gene, partial cds.>gb:AF528703_1808728
           Arabidopsis thaliana ecotype An-2 T8F5.18 gene, partial
           cds.>gb:AF528704_1808729 Arabidopsis thaliana ecotype
           Lu-1 T8F5.18 gene, partial cds.
          Length = 184

 Score =  100 bits (248), Expect = 5e-20
 Identities = 50/133 (37%), Positives = 86/133 (64%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 10  VFINFRGKDLRKGFMSFLTPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 67

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S+WC++EL  + E  ++    +++PIFY ++   V++ KG F N+F +L +K  
Sbjct: 68  SEGYCESRWCMDELVQIKEYMDQ-NRLVIIPIFYRIDLDVVKHLKGKFGNNFLDLVDKYH 126

Query: 599 KDDEKVRRWKEAL 637
            + +K+++W EAL
Sbjct: 127 PEPKKLQKWMEAL 139



>gb:AF528689_1808714 Arabidopsis thaliana ecotype Kas-1 T8F5.18
           gene, partial cds.
          Length = 184

 Score =  100 bits (248), Expect = 5e-20
 Identities = 50/133 (37%), Positives = 86/133 (64%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 10  VFINFRGKDLRKGFMSFLTPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 67

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S+WC++EL  + E  ++    +++PIFY ++   V++ KG F N+F +L +K  
Sbjct: 68  SEGYCESRWCMDELVQIKEYMDQ-NRLVIIPIFYRIDLDVVKHLKGKFGNNFLDLVDKYH 126

Query: 599 KDDEKVRRWKEAL 637
            + +K+++W EAL
Sbjct: 127 PEPKKLQKWMEAL 139



>gb:AF083726_1766956 Arabidopsis thaliana clone sps358 unknown mRNA.
          Length = 414

 Score =  100 bits (248), Expect = 5e-20
 Identities = 50/133 (37%), Positives = 86/133 (64%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 27  VFINFRGKDLRKGFMSFLTPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 84

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S+WC++EL  + E  ++    +++PIFY ++   V++ KG F N+F +L +K  
Sbjct: 85  SEGYCESRWCMDELVQIKEYMDQ-NRLVIIPIFYRIDLDVVKHLKGKFGNNFLDLVDKYH 143

Query: 599 KDDEKVRRWKEAL 637
            + +K+++W EAL
Sbjct: 144 PEPKKLQKWMEAL 156



>pir|T06146|T06146 disease resistance protein homolog F24J7.90 -
           Arabidopsis thaliana>gb:ATCHRIV51_1545793 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           51.>gb:ATF24J7_1549924 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24J7 (ESSA project).
          Length = 1167

 Score =  100 bits (248), Expect = 5e-20
 Identities = 58/173 (33%), Positives = 96/173 (55%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VFL+FRG ++R  F+  L ++L  + I+ F D+  +EKG+ +  +L   I +S+  +A
Sbjct: 15  HQVFLNFRGDELRNNFVSHLDKALRGKQINVFIDE-AVEKGENLD-NLFKEIEKSRIALA 72

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + S+ Y  SKWCL EL  + E + KL   + +PIFY+VEP  VR QK +F  +  +  E 
Sbjct: 73  IISQKYTESKWCLNELVKMKELEGKL---VTIPIFYNVEPATVRYQKEAFGAALTKTQE- 128

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLNHAS 751
               D ++++WKEAL     L G+   +   E E T  + +   +  +L+  S
Sbjct: 129 -NDSDGQMKKWKEALTYVSLLVGFPFNSKSKEKETTLIDKIVDAVLQKLSKIS 180



>gb:BT010754_1640700 Arabidopsis thaliana At5g44900 gene, complete
           cds.>gb:BT010985_1640931 Arabidopsis thaliana At5g44900
           mRNA, complete cds.
          Length = 252

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 49/135 (36%), Positives = 83/135 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF++FRG  +R  F+ FL ++L +  ++ F DD  L   D     L + I ES+  + 
Sbjct: 18  YQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDL--DHLFSRIEESRVALT 75

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK + +S+WCL+ELA + EC ++ +   V+PIF+ ++  DV+  KG+F ++F++L   
Sbjct: 76  IFSKNFTNSRWCLDELAKIKECVDQ-ESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLT 134

Query: 593 IGKDDEKVRRWKEAL 637
              + E  RRWK+A+
Sbjct: 135 HRGEPETYRRWKDAI 149



>gb:AB010693_1511127 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21C13.
          Length = 274

 Score = 99.4 bits (246), Expect = 9e-20
 Identities = 49/135 (36%), Positives = 83/135 (61%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           Y VF++FRG  +R  F+ FL ++L +  ++ F DD  L   D     L + I ES+  + 
Sbjct: 18  YQVFINFRGEKLRDGFLGFLVDALLKENVNVFIDDHELRGRDL--DHLFSRIEESRVALT 75

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FSK + +S+WCL+ELA + EC ++ +   V+PIF+ ++  DV+  KG+F ++F++L   
Sbjct: 76  IFSKNFTNSRWCLDELAKIKECVDQ-ESLTVIPIFFKMKTDDVKKLKGNFGDNFRDLKLT 134

Query: 593 IGKDDEKVRRWKEAL 637
              + E  RRWK+A+
Sbjct: 135 HRGEPETYRRWKDAI 149



>gb:AY091563_1574668 Pinus taeda TIR/P-loop/LRR mRNA, complete cds.
          Length = 348

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 49/150 (32%), Positives = 81/150 (54%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           ++ VF++ RG DV+KTF+  L+  L  +G+  F +++ ++ G  IS  L +AIR +   +
Sbjct: 11  SHQVFINHRGVDVKKTFVRSLYRRLREKGLTAFFNEEEMQGGCEISSQLADAIRTASVHV 70

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
           A+FS  Y  S+WCL EL  +++         +VP+FY V+P DVR   G +  +      
Sbjct: 71  AIFSPRYVESEWCLNELLLMLKSNGP-----IVPVFYRVKPQDVRWMLGLYGEALATHEM 125

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKND 679
           K   D   +  W+ ALN+     G+ L+ D
Sbjct: 126 KGRHDPSTIEEWRNALNEVANKSGFELQKD 155



>gb:AB010693_1511138 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21C13.
          Length = 371

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 48/135 (35%), Positives = 84/135 (62%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG ++RK+F+ FL +++    I+ F D+  +   D   Q+L + I ES+  IA
Sbjct: 15  HQVFINFRGEELRKSFLGFLLKAMRDAKINVFTDEIEVRGRDI--QNLLSRIEESRVAIA 72

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           + SK Y  S WCL+EL  + E  ++  E +V+PIFY ++ T+ +  +G F ++F+ L   
Sbjct: 73  ILSKRYTESSWCLDELVKMKERIDQ-DELVVIPIFYRLDATNCKRLEGPFGDNFRNLERD 131

Query: 593 IGKDDEKVRRWKEAL 637
              + E++++WKEAL
Sbjct: 132 YRSEPERIKKWKEAL 146



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 43/136 (31%), Positives = 71/136 (52%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++F   ++   FI  L  +L   GI+ FKD  +L  G    Q +  +I  S   +A+F
Sbjct: 224 VFVNFCNDELGDNFIKHLVWALRDSGINVFKDSFKLI-GSGQKQEVFMSIENSNIALAIF 282

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           SK Y+ S  CL EL  + E  ++ K  +V+P+FY V+  +VR  +G F   F+   E+  
Sbjct: 283 SKRYSESYRCLNELVKMEELAKEGK-LVVIPVFYSVKTNEVRRLEGEFGIHFRNTKERFA 341

Query: 599 KDDEKVRRWKEALNKA 646
            +   V  W+++L  +
Sbjct: 342 MEPMMVESWEKSLKSS 357



>pir|A71438|A71438 probable resistance protein - Arabidopsis
           thaliana
          Length = 906

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 62/170 (36%), Positives = 91/170 (53%)
 Frame = +2

Query: 230 TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI 409
           +YDVF +FRG DVR + +  L + L+R+ I+TF +D+R+E+   I+  L  AI  S+  +
Sbjct: 251 SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTF-NDNRIERSRKITPELLLAIENSRISL 309

Query: 410 AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHE 589
            VFSK YASS WCL+EL  + EC EKL +                   G F   F E  +
Sbjct: 310 VVFSKNYASSTWCLDELVKIQECYEKLDQ-----------------MTGEFGMVFGETCK 352

Query: 590 KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
             G+ + + R+W  AL +   L G  L+N  +  EA   EN+A D+  +L
Sbjct: 353 --GRTENEKRKWMRALAEVAHLAGEDLRNWRS--EAEMLENIAKDVSNKL 398



>pir|F96612|F96612 probable disease resistance protein RPS4
           F12K22.13 [imported] - Arabidopsis
           thaliana>gb:AE005173_893575 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC079732_1732738 Arabidopsis thaliana
           chromosome 1 BAC F12K22 genomic sequence, complete
           sequence.
          Length = 164

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 61/144 (42%), Positives = 83/144 (57%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+R  FI  L  + E  GI+ F D    ++G+ ++  L   I ESK  +A+F
Sbjct: 19  VFINFRGEDIRYGFISHLVAAFEVHGIYFFIDKYE-QRGNDLTY-LFKRIEESKIVLAIF 76

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S  YA SKWCL ELATV +  E+ K + V+PIFY V+  DVR QKG F  +F  L     
Sbjct: 77  SGKYAQSKWCLNELATVKKLAEENKLK-VIPIFYKVKVGDVRRQKGEFGRNFWNLARI-- 133

Query: 599 KDDEKVRRWKEALNKAGQLKGYHL 670
              E++++WKEAL       G  L
Sbjct: 134 SSGEEIKQWKEALEFVSHKMGLEL 157



>pir|T04584|T04584 TMV resistance protein N homolog F23E13.40 -
           Arabidopsis thaliana>gb:ATCHRIV84_1547575 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           84.>gb:ATF23E13_1549743 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII project).
          Length = 1179

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 56/155 (36%), Positives = 91/155 (58%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VFL+FRG  +R  F+  L ++L R GI+ F D +  +  D    +L + I+ES+  +A
Sbjct: 19  HQVFLNFRGKQLRNGFVSHLEKALRRDGINVFIDRNETKGRDL--SNLFSRIQESRIALA 76

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  S WCL+EL  + +C + L   +V+PIFY V+  DV+N KG+F  +F +L + 
Sbjct: 77  IFSSMYTESYWCLDELVKIKDCVD-LGTLVVIPIFYMVDTDDVKNLKGAFGYTFWKLAKT 135

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEA 697
              + EK+ +WK+AL    +  G+ L    +E E+
Sbjct: 136 C--NGEKLDKWKQALKDVPKKLGFTLSEMSDEGES 168



>gb:ATH249264_1552132 Arabidopsis thaliana RPS4-Ler gene for disease
           resistance protein, ecotype Landsberg erecta.
          Length = 1217

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 51/143 (35%), Positives = 82/143 (57%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG D+R+ F+  L  +L+   I+ F DD   ++G  +   L   I ESK  +A
Sbjct: 16  HQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYE-DRGQPLDVLLKR-IEESKIVLA 73

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  S WC+ EL  + +C ++    + +PIFY +EP+ VR+ KG F + F+ +   
Sbjct: 74  IFSGNYTESVWCVRELEKIKDCTDE-GTLVAIPIFYKLEPSTVRDLKGKFGDRFRSM--- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             K DE+ ++WKEA N    + G
Sbjct: 130 -AKGDERKKKWKEAFNLIPNIMG 151



>pir|T51141|T51141 disease resistance protein rps4 [imported] -
           Arabidopsis thaliana>gb:ATH249263_1552131 Arabidopsis
           thaliana rps4-RLD gene for disease resistance protein,
           ecotype RLD.
          Length = 1217

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 51/143 (35%), Positives = 82/143 (57%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG D+R+ F+  L  +L+   I+ F DD   ++G  +   L   I ESK  +A
Sbjct: 16  HQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYE-DRGQPLDVLLKR-IEESKIVLA 73

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  S WC+ EL  + +C ++    + +PIFY +EP+ VR+ KG F + F+ +   
Sbjct: 74  IFSGNYTESVWCVRELEKIKDCTDE-GTLVAIPIFYKLEPSTVRDLKGKFGDRFRSM--- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             K DE+ ++WKEA N    + G
Sbjct: 130 -AKGDERKKKWKEAFNLIPNIMG 151



>pir|T51140|T51140 disease resistance protein RPS4 [imported] -
           Arabidopsis thaliana>gb:AB020744_1514581 Arabidopsis
           thaliana genomic DNA, chromosome 5, TAC
           clone:K9E15.>gb:ATH243468_1552097 Arabidopsis thaliana
           RPS4 gene for disease resistance protein.
          Length = 1217

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 51/143 (35%), Positives = 82/143 (57%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG D+R+ F+  L  +L+   I+ F DD   ++G  +   L   I ESK  +A
Sbjct: 16  HQVFINFRGADLRRRFVSHLVTALKLNNINVFIDDYE-DRGQPLDVLLKR-IEESKIVLA 73

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  S WC+ EL  + +C ++    + +PIFY +EP+ VR+ KG F + F+ +   
Sbjct: 74  IFSGNYTESVWCVRELEKIKDCTDE-GTLVAIPIFYKLEPSTVRDLKGKFGDRFRSM--- 129

Query: 593 IGKDDEKVRRWKEALNKAGQLKG 661
             K DE+ ++WKEA N    + G
Sbjct: 130 -AKGDERKKKWKEAFNLIPNIMG 151



>pir|T02283|T02283 probable disease resistance protein T13D8.20 -
           Arabidopsis thaliana>gb:AE005173_893711 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:T13D8_1723409 Arabidopsis thaliana
           chromosome 1 BAC T13D8, complete sequence.
          Length = 162

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 60/141 (42%), Positives = 87/141 (61%), Gaps = 4/141 (2%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG ++R +F+  L  + E  GI+ F D D  +  D   + L   I++S+  +A+F
Sbjct: 17  VFINFRGEEIRYSFLSHLAAAFELHGINFFIDKDEQKGKDL--KHLFKRIKQSQIALAIF 74

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+ YA S WCL ELA + +  +K K   VVPIFY VE  DVR+Q+G F ++F +L  KI 
Sbjct: 75  SERYAESPWCLNELAKMKKLAKKGKLN-VVPIFYKVEVNDVRHQEGKFGSNFWKL-AKIS 132

Query: 599 KDDEKVRRWKEAL----NKAG 649
             DE +++WKEAL    NK G
Sbjct: 133 SGDE-IKKWKEALEFFSNKMG 152



>gb:AB010693_1511129 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21C13.
          Length = 253

 Score = 96.7 bits (239), Expect = 6e-19
 Identities = 60/177 (33%), Positives = 97/177 (54%), Gaps = 9/177 (5%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG ++R+ F++ L   L   GI+ F D    +KG  + Q L   I++SK  +A+F
Sbjct: 13  VFINFRGDELREIFVNHLELQLRNAGINVFIDTKE-QKGRRL-QYLFTRIKKSKIALAIF 70

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVR---------NQKGSFENS 571
           SK Y  SKWCL+EL T+ E Q K K+ +V+PIFY+V   DV+         N  G F   
Sbjct: 71  SKRYCESKWCLDELVTMNE-QMKEKKLVVIPIFYNVRSDDVKRAANPDGEGNLDGEFSLP 129

Query: 572 FKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
           FK+L +    + E+V  W+ AL    +  G+   N  ++++     ++  ++  +LN
Sbjct: 130 FKQLKQNHAGEPERVEGWERALRSVTKRIGFSRSN--SKHDTDFVLDIVKEVKKQLN 184



>gb:AY271889_1594225 Manihot esculenta RCa12.2 TIR type resistance
           protein gene, partial cds.
          Length = 97

 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 48/99 (48%), Positives = 67/99 (67%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           +VFLSFRG D R  F D+L+++L ++GI TF D+ +L +G+ I+  L   I ES   + V
Sbjct: 1   EVFLSFRGKDTRNNFTDYLYKALSQKGIETFIDN-KLNRGEGITPELLRTIEESMVAVIV 59

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEP 532
           FS+ YA S WCLEEL  +MEC +K   Q V+P+FY V+P
Sbjct: 60  FSQNYADSPWCLEELVHIMEC-KKAHGQNVLPVFYDVDP 97



>gb:AY187302_1588156 Manihot esculenta RCa12 gene, partial cds.
          Length = 97

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 48/99 (48%), Positives = 67/99 (67%)
 Frame = +2

Query: 236 DVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           +VFLSFRG D R  F D+L+++L ++GI TF D+ +L +G+ I+  L   I ES   + V
Sbjct: 1   EVFLSFRGKDTRNNFTDYLYKALSQKGIETFIDN-KLNRGEEITPELLRTIEESMVAVIV 59

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEP 532
           FS+ YA S WCLEEL  +MEC +K   Q V+P+FY V+P
Sbjct: 60  FSQNYADSPWCLEELVHIMEC-KKAHGQNVLPVFYDVDP 97



>pir|T04583|T04583 TMV resistance protein N homolog F23E13.30 -
           Arabidopsis thaliana>gb:ATCHRIV84_1547574 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           84.>gb:ATF23E13_1549742 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E13 (ESSAII project).
          Length = 1607

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 53/139 (38%), Positives = 83/139 (59%)
 Frame = +2

Query: 221 QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK 400
           + W ++VF SF   DV K+F+  + + L R+G     D++  E+   I   L NAI  S+
Sbjct: 46  RNWEHNVFSSFSSVDVPKSFLSRIRKELRRKGFEPLIDNET-ERCVSIGPELRNAISVSR 104

Query: 401 FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKE 580
             I V S+ YA S WCL+EL  +M+C+E+L ++ VV IFY+++P DV  Q G F ++F++
Sbjct: 105 IVIVVLSRNYALSPWCLDELVEIMKCKEELGQR-VVTIFYNLDPIDVLKQTGDFGDNFRK 163

Query: 581 LHEKIGKDDEKVRRWKEAL 637
             +  GK DE + +   AL
Sbjct: 164 TRK--GKTDEDIWKCTRAL 180



 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 43/155 (27%), Positives = 73/155 (47%)
 Frame = +2

Query: 275 TFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVFSKGYASSKWCLE 454
           +F   L     R+GI  F +          S++L + I      + VFSK   SS  CL+
Sbjct: 449 SFASHLSMDFRRKGISAFVN---------YSETL-DVIERVSASVLVFSKSCVSSTSCLD 498

Query: 455 ELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDDEKVRRWKEA 634
            L  V +C+ K   Q+VVP++Y +  +DV  Q+          H+ +    +++R W  A
Sbjct: 499 MLVRVFQCRRK-TGQLVVPVYYGISSSDVVVQE----------HKSV----DRIREWSSA 543

Query: 635 LNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
           L +  +L G+H + + +E E    E +  D+H +L
Sbjct: 544 LQELRELPGHHNREECSESE--LVEEIVKDVHEKL 576



>pir|T45788|T45788 probable disease resistance protein F26O13.210 -
           Arabidopsis thaliana>gb:ATF26O13_1550158 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F26O13.
          Length = 1226

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 56/153 (36%), Positives = 83/153 (54%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG ++R +F+  L  +L R G++ F D +  EKG  +       I ES+  +A
Sbjct: 19  HQVFVNFRGEELRNSFVSHLRSALVRHGVNIFIDTNE-EKGKPLHVFFQR-IEESRIALA 76

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           +FS  Y  SKWCL EL  + EC +K K  +++PIFY V+  +VR QKG F   FK L   
Sbjct: 77  IFSVRYTESKWCLNELVKMKECMDKGK-LLIIPIFYKVKAYEVRYQKGRFGCVFKNLR-- 133

Query: 593 IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEY 691
              D  K  +W EAL+      G+      +E+
Sbjct: 134 -NVDVHKKNQWSEALSSVADRIGFSFDGKSDEH 165



>gb:AB012240_1511687 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18C1.
          Length = 546

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 2/137 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           + VF++FRG  +R  F+ +L ++L R  I+ F D+   ++G+ ++ +L   I +S   I 
Sbjct: 331 FQVFINFRGDQLRNNFVGYLVDALRRSEINVFIDNQE-QRGEDLN-TLFKRIEDSGIAIV 388

Query: 413 VFSKGYASSKWCLEELATVMEC--QEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH 586
           VFS  Y  SKWCLEEL  + E   Q  LK   V+PIFY V PT+V+  KG F + F++  
Sbjct: 389 VFSSRYTESKWCLEELVKIKERVHQGLLK---VLPIFYKVTPTNVKRPKGEFGDHFRDKE 445

Query: 587 EKIGKDDEKVRRWKEAL 637
                D+  ++RWKEA+
Sbjct: 446 YMYESDEPMIKRWKEAI 462



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 53/172 (30%), Positives = 86/172 (50%), Gaps = 3/172 (1%)
 Frame = +2

Query: 233 YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQS---LPNAIRESKF 403
           + VF+ + G   R  FI  L  +LE++ I+ F     +    CI +    L N I ES  
Sbjct: 16  HTVFILYNGS--RMGFIYHLIMALEKKNINVF-----VGFNGCICEPVERLSNRI-ESII 67

Query: 404 FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKEL 583
            + +F+  Y  SKWCL +L  + +C EK    + +PIFY ++P+ VR   G F ++F++L
Sbjct: 68  VLVIFTSRYTESKWCLMKLVDINKCAEK-DHLVAIPIFYKLDPSTVRGLSGQFGDAFRDL 126

Query: 584 HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            E  G     + +WKEAL       G  ++ D +  +A   E V   + +R+
Sbjct: 127 RESTG----LMEKWKEALKSISDRPG--IRVDKSSPKAKRIEIVVKKVLSRI 172



>gb:AF369886_1791987 Pisum sativum TIR-similar-domain-containing
           protein mRNA, complete cds.
          Length = 464

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 64/171 (37%), Positives = 90/171 (52%), Gaps = 5/171 (2%)
 Frame = +2

Query: 242 FLSFRGPDVRKTFIDFLFESLERRGIHT---FKDDDRLEKGDCISQSLPNAIRESKFFIA 412
           FLSFRG          LF +L  +G        +D R  +GD  S SL N I  S+  I 
Sbjct: 294 FLSFRGRRYALRVYRVLFINLYVKGDSRPLWMMEDCR--RGDQTSPSLLNVIEASRLSII 351

Query: 413 VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEK 592
           V S+ YA+S  CL+EL  ++EC+ KLK+Q+V PIFY VEP+D+RN +  +          
Sbjct: 352 VLSENYANSTRCLDELVKILECK-KLKKQLVWPIFYKVEPSDIRNMRKCYGKDMARHENI 410

Query: 593 IGKDDEKVRRWKEALNKAGQLKG--YHLKNDYNEYEATCAENVAADIHARL 739
            G D E+V++WK AL +   L G  Y +  +Y  ++       A DI +RL
Sbjct: 411 FGVDSERVQKWKSALGEVCNLSGMAYSIGFEYEFFQKIVEH--ANDIRSRL 459



>gb:AF528686_1808711 Arabidopsis thaliana ecotype Bla-1 T8F5.18
           gene, partial cds.>gb:AF528687_1808712 Arabidopsis
           thaliana ecotype Lan-0 T8F5.18 gene, partial
           cds.>gb:AF528688_1808713 Arabidopsis thaliana ecotype
           Fi-0 T8F5.18 gene, partial cds.
          Length = 184

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 49/133 (36%), Positives = 83/133 (62%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 10  VFINFRGKDLRKGFMSFLKPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 67

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S WC++EL  + E  ++    I++PIFY ++   V++  G F ++F +L +K  
Sbjct: 68  SEGYCESHWCMDELVKIKEYMDQ-NRLIIIPIFYRLDLDVVKDLTGKFGDNFWDLVDKYQ 126

Query: 599 KDDEKVRRWKEAL 637
            + +K+ +W EAL
Sbjct: 127 PEPKKLHKWTEAL 139



>gb:AF325110_1786564 Arabidopsis thaliana hypothetical protein
           (T8F5.18) mRNA, complete cds.>gb:AK176581_1818569
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-11-F15.
          Length = 411

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 49/133 (36%), Positives = 83/133 (62%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 24  VFINFRGKDLRKGFMSFLKPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 81

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S WC++EL  + E  ++    I++PIFY ++   V++  G F ++F +L +K  
Sbjct: 82  SEGYCESHWCMDELVKIKEYMDQ-NRLIIIPIFYRLDLDVVKDLTGKFGDNFWDLVDKYQ 140

Query: 599 KDDEKVRRWKEAL 637
            + +K+ +W EAL
Sbjct: 141 PEPKKLHKWTEAL 153



>gb:AF316415_1785539 Helianthus annuus resistance gene analog NBS11
           (NBS11) gene, partial cds.
          Length = 101

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 47/104 (45%), Positives = 68/104 (65%)
 Frame = +2

Query: 374 LPNAIRESKFFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQK 553
           L  AI +S+  + VFSK YA S WCL ELA ++EC +K + QI++P+FY+V+P+DVR  K
Sbjct: 1   LLKAIEDSRIAVVVFSKNYADSSWCLAELAHIIECVDK-RGQILMPVFYYVDPSDVRKLK 59

Query: 554 GSFENSFKELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN 685
             +E  F + HE   K  EKV  W++AL KAG + G+ + +  N
Sbjct: 60  RKYEEVFSK-HETENK--EKVESWRKALEKAGSISGWTINDTIN 100



>pir|T02363|T02363 hypothetical protein T8F5.18 - Arabidopsis
           thaliana>gb:AE005173_894193 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T8F5_1724153 Arabidopsis thaliana
           chromosome 1 BAC T8F5 sequence, complete sequence.
          Length = 420

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 49/133 (36%), Positives = 83/133 (62%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF++FRG D+RK F+ FL  +L++  I+ F D+   E+G  +  SL + I ESK  + +F
Sbjct: 24  VFINFRGKDLRKGFMSFLKPALKKEKINVFIDEQE-ERGKYLI-SLFDTIGESKIALVIF 81

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
           S+GY  S WC++EL  + E  ++    I++PIFY ++   V++  G F ++F +L +K  
Sbjct: 82  SEGYCESHWCMDELVKIKEYMDQ-NRLIIIPIFYRLDLDVVKDLTGKFGDNFWDLVDKYQ 140

Query: 599 KDDEKVRRWKEAL 637
            + +K+ +W EAL
Sbjct: 141 PEPKKLHKWTEAL 153



>gb:AF316417_1785541 Helianthus annuus resistance gene analog NBS13
           (NBS13) gene, partial cds.
          Length = 194

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 49/104 (47%), Positives = 67/104 (64%)
 Frame = +2

Query: 428 YASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIGKDD 607
           YA S WCL+ELA +MEC +  + QIV+P+FYHV+P+DVR QKG +  +F++ H++  K  
Sbjct: 1   YADSSWCLDELAHIMECVDT-RGQIVMPVFYHVDPSDVRKQKGKYGKAFRK-HKRENK-- 56

Query: 608 EKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARL 739
            KV  W++AL  AG L G  L  D N YEA C + +   I  RL
Sbjct: 57  HKVESWRKALEMAGNLSG--LVIDENSYEAKCIKEIVDKISNRL 98



>pir|T05389|T05389 hypothetical protein F16G20.210 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546188 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           59.>gb:ATF16G20_1548790 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16G20 (ESSAII project).
          Length = 867

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 58/173 (33%), Positives = 87/173 (50%), Gaps = 10/173 (5%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
           VF+SFRG D R   +  L + L    ++ F DD    +     Q+L   IR+S+  I +F
Sbjct: 11  VFISFRGKDERNGLLTLLKQKLIDGNVNVFTDDKLTGQP---LQNLFGHIRKSRIAIVIF 67

Query: 419 SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELH---- 586
           SK YA S WCL+EL  + +C E    + V+PIF+ V+ + V+ Q G F   F  L     
Sbjct: 68  SKNYAESGWCLDELVEIKKCFETEALKAVIPIFHRVKVSSVKKQSGKFGEKFLALQNYLL 127

Query: 587 ------EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
                 +KI + + +++RWK+AL    ++ G  L +D N  E    E V   I
Sbjct: 128 AEEVDKKKIKRINSRIKRWKKALKIVTEIAG--LTHDKNSPELAFVEKVVEKI 178



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 54/176 (30%), Positives = 82/176 (46%), Gaps = 13/176 (7%)
 Frame = +2

Query: 239 VFLSFRGPDVRKTFIDFLFESLERRG-IHTFKDDDRLEKGDCISQSLPNAIRESKFFIAV 415
           VF+SFRG   RKT + F+   LE    I+ F D+  + +G  I+ +L   IRES   + +
Sbjct: 244 VFISFRGKAQRKTLVSFIKSKLEEISEINVFMDEYEI-RGRPIT-TLFERIRESSIALVI 301

Query: 416 FSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKI 595
           FS  Y  S+WCL+EL  + + Q +    +  PIFY V+   V+NQ G F N   +  E +
Sbjct: 302 FSDKYPESRWCLDELVEIKK-QMETGSIVPFPIFYKVKAESVKNQTGHFRNVLLKTEEDV 360

Query: 596 GK------------DDEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADI 727
            K             ++ +  W++AL   G   G+        Y   C  +   DI
Sbjct: 361 RKKVDRSNIRSILETEDMIWGWRQALVSVGGRMGF-------SYNHKCDNDFVNDI 409



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 12/186 (6%)
 Frame = +2

Query: 239  VFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIAVF 418
            VF+      + K  +  L E LE   I  + +D+   +           I+ES   +  F
Sbjct: 577  VFIGLGEKHLGKFLVSSLKEELESNQILVYVEDETKSR-----------IKESGVAVVFF 625

Query: 419  SKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSFENSFKELHEKIG 598
            SK Y +S+ CL+EL  + +  +  K    +P+FY ++   V+N KG F N   ++  ++ 
Sbjct: 626  SKKYPNSEKCLDELVEIKKLMDAGKID-PLPVFYSLKDEPVKNLKGYFLNRLLKIENEVR 684

Query: 599  KD------------DEKVRRWKEALNKAGQLKGYHLKNDYNEYEATCAENVAADIHARLN 742
            K+            + K+  W++AL+      G         YE +  +   +DI  ++N
Sbjct: 685  KNIKTRDDKSILDTEAKIWGWRDALSSIASRPGL-------SYELSTDDVFVSDIVTKVN 737

Query: 743  HASLGR 760
                 R
Sbjct: 738  ELFASR 743


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 918,463,039
Number of Sequences: 1806583
Number of extensions: 19075945
Number of successful extensions: 48314
Number of sequences better than 10.0: 363
Number of HSP's better than 10.0 without gapping: 45761
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47675
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 65853909672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)