BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3497
         (714 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY062513_1565169 Arabidopsis thaliana Unknown protein (Z97335...    99   6e-20   
pir|E71403|E71403 hypothetical protein - Arabidopsis thaliana>gb...    92   9e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP003888_1834882 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   
gb:AP002540_1822571 Oryza sativa (japonica cultivar-group) genom...    37   0.46    
gb:NCB9K17_1690465 Neurospora crassa DNA linkage group V BAC clo...    36   0.60    
gb:AY262693_1593711 Phytophthora sojae isolate UQ1200 clone 77 u...    36   0.60    
gb:AK077458_1171861 Mus musculus 8 days embryo whole body cDNA, ...    36   0.60    
pir|A46194|A46194 neurofilament protein NF-220, high-molecular-w...    36   0.60    
gb:AB016799_2460749 Danio rerio kheper mRNA, transcription facto...    35   1.3     
gb:AE014134_1127429 Drosophila melanogaster chromosome 2L, compl...    35   1.3     
pir|JC6510|JC6510 ras-responsive element binding transcription f...    35   1.3     Gallus gallus [bantam]
gb:AF440570_2256120 Shrimp white spot syndrome virus, complete g...    35   1.7     
gb:AF369029_2242336 White spot syndrome virus, complete genome.        35   1.7     
gb:AF332093_2236430 White spot syndrome virus, complete genome.>...    35   1.7     
gb:CR925678_118758 Ehrlichia ruminantium str. Welgevonden, compl...    35   1.7     
gb:CR767821_116883 Ehrlichia ruminantium strain Welgevonden, com...    35   1.7     
pir|T06458|T06458 nucleolin homolog - garden pea>gb:PEAORF_16997...    34   2.3     Pisum sativum [garden pea]
gb:BA000032_709240 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    34   3.0     
gb:AE017351_1759452 Cryptococcus neoformans var. neoformans JEC2...    33   3.9     
gb:AY080684_1568413 Arabidopsis thaliana unknown protein (At4g32...    33   3.9     
gb:U00040_1401431 Caenorhabditis elegans cosmid C18H2, complete ...    33   3.9     
pir|T15565|T15565 hypothetical protein C18H2.2 - Caenorhabditis ...    33   3.9     Caenorhabditis elegans [roundworm]
pir|T05345|T05345 hypothetical protein F8B4.50 - Arabidopsis tha...    33   3.9     Arabidopsis thaliana [mouse-ear cress]
sp|Q9K0N4|DNAK_NEIMB|DNAK_NEIMB Chaperone protein dnaK (Heat shock protein ...    33   3.9     Neisseria meningitidis serogroup B
gb:AL353813_1923190 Human DNA sequence from clone RP11-79D8 on c...    33   5.0     
gb:AE017348_1758398 Cryptococcus neoformans var. neoformans JEC2...    33   5.0     
gb:OSJN00281_1697891 Oryza sativa genomic DNA, chromosome 4, BAC...    33   5.0     
gb:TGO507036_1400181 Toxoplasma gondii mRNA for GPI transamidase...    33   5.0     
sp|P05432|MIG6_RAT|MIG6_RAT Mitogen-inducible gene 6 protein homolog (Mig...    33   5.0     Rattus norvegicus [brown rat]
sp|Q99JZ7|MIG6_MOUSE|MIG6_MOUSE Mitogen-inducible gene 6 protein homolog (M...    33   5.0     Mus musculus [mouse]
gb:BC082946_2563015 Xenopus laevis hypothetical LOC494807, mRNA ...    33   6.6     
gb:BC064196_2553749 Xenopus tropicalis hypothetical protein MGC7...    33   6.6     
gb:AX879644_1477918 Sequence 14549 from Patent EP1074617.>gb:AK0...    33   6.6     
gb:CEB0240_1359708 Caenorhabditis elegans cosmid B0240, complete...    33   6.6     
gb:AC006638_1203494 Caenorhabditis elegans cosmid F41G4, complet...    33   6.6     
gb:HSM803019_1186869 Homo sapiens mRNA; cDNA DKFZp761I0915 (from...    33   6.6     
gb:AE013599_1131650 Drosophila melanogaster chromosome 2R, compl...    33   6.6     
pir|T18674|T18674 hypothetical protein T04F3.1 - Caenorhabditis ...    33   6.6     Caenorhabditis elegans [roundworm]
gb:XLA224945_2582441 Xenopus laevis Grg-4 clone mRNA for Groucho...    32   8.6     
gb:BC057078_2102574 Mus musculus zinc finger protein 316, mRNA (...    32   8.6     
gb:BC043067_2098803 Mus musculus zinc finger protein 422, relate...    32   8.6     
gb:AF082568_2053868 Mus musculus zinc finger type transcription ...    32   8.6     
gb:AF062402_2052912 Rattus norvegicus versican V0 isoform mRNA, ...    32   8.6     
gb:BC077728_1989661 Homo sapiens hypothetical protein LOC126208,...    32   8.6     
gb:BC021997_1977642 Homo sapiens hypothetical protein FLJ13479, ...    32   8.6     
gb:AF000560_1875711 Homo sapiens TTF-I interacting peptide 20 mR...    32   8.6     
gb:AY551436_1613344 Hordeum vulgare subsp. vulgare ent-kaurene s...    32   8.6     
gb:AY366084_1429505 Bos taurus Kruppel-like factor 15 mRNA, part...    32   8.6     
gb:BX897699_826644 Bartonella henselae strain Houston-1, complet...    32   8.6     
pir|T33879|T33879 hypothetical protein Y14H12B.1 - Caenorhabditi...    32   8.6     Caenorhabditis elegans [roundworm]
sp|Q9ERB4|PGCV_RAT|PGCV_RAT Versican core protein precursor (Large fibrob...    32   8.6     Rattus norvegicus [brown rat]


>gb:AY062513_1565169 Arabidopsis thaliana Unknown protein
           (Z97335.29) mRNA, complete cds.>gb:BT002572_1636175
           Arabidopsis thaliana Unknown protein (At4g14190) mRNA,
           complete cds.
          Length = 784

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 54/121 (44%), Positives = 78/121 (64%), Gaps = 7/121 (5%)
 Frame = +1

Query: 121 MENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEAT 300
           M++QDH +    G  +H   +C KCGW + NPHPSAK+RRAHKK+CGTI+G+++ +SE  
Sbjct: 1   MDSQDHCSNSPGGGKNH---VCTKCGWSYSNPHPSAKNRRAHKKICGTIKGFEIFDSEMK 57

Query: 301 HLAIS-DDEHPSDDD--PRTPSPKVNNKS----LKEAAASFKSTRSEDELFSDAMTEFSD 459
              +   +EH  DD+  P TPSP V  KS    +++AA       SE+++F+DA+ EFS 
Sbjct: 58  KENLDLPEEHSLDDEQKPPTPSPTVVEKSAPTVVEKAANERIGDVSEEDVFTDAVCEFSR 117

Query: 460 S 462
           S
Sbjct: 118 S 118



>pir|E71403|E71403 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV38_1545184 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 38.>gb:ATFCA0_1551470
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 0.
          Length = 722

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 56/156 (35%), Positives = 89/156 (57%), Gaps = 20/156 (12%)
 Frame = +1

Query: 55  LSLFPCSSVPALLVFFSLYS*KMENQDHKATVSSGHASHGV-HLCHKCGWPFPNPHPSAK 231
           +++F  ++  +LL   S++    EN D +  V+  +   G  H+C KCGW + NPHPSAK
Sbjct: 18  INVFRITTEKSLLEKISIF----ENMDTEDFVNPCYIGGGKNHVCTKCGWSYSNPHPSAK 73

Query: 232 HRRAHKKVCGTIEGYKLTESEATHLAIS-DDEHPSDDDPRTPSPKVNN------------ 372
           +RRAHKK+CGTI+G+++ +SE     +   +EH  DD+ + P+P  NN            
Sbjct: 74  NRRAHKKICGTIKGFEIFDSEMKKENLDLPEEHSLDDEQKPPTPSKNNLCFGWIKLGPTV 133

Query: 373 --KS----LKEAAASFKSTRSEDELFSDAMTEFSDS 462
             KS    +++AA       SE+++F+DA+ EFS S
Sbjct: 134 VEKSAPTVVEKAANERIGDVSEEDVFTDAVCEFSRS 169



>gb:AP003888_1834882 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1191_A10.
          Length = 1067

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +1

Query: 151 SSGHASHGVHL-CHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDE 324
           +SG    G H+ CH CG+ +PN HPSAK RRAH+K CG       T + A H A+ + +
Sbjct: 23  ASGGGGGGNHMVCHLCGYQYPNAHPSAKQRRAHRKNCGNPSSPSPT-AAAAHAAVEEGD 80



>gb:AP002540_1822571 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0434B04.
          Length = 382

 Score = 36.6 bits (83), Expect = 0.46
 Identities = 13/29 (44%), Positives = 20/29 (68%)
 Frame = +1

Query: 172 GVHLCHKCGWPFPNPHPSAKHRRAHKKVC 258
           G  LC +CG+ +PN +P+ + RR+H K C
Sbjct: 18  GGQLCPECGYEYPNANPNPRLRRSHSKNC 46



>gb:NCB9K17_1690465 Neurospora crassa DNA linkage group V BAC clone
           B9K17.
          Length = 1417

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 41/166 (24%), Positives = 68/166 (40%), Gaps = 11/166 (6%)
 Frame = +1

Query: 226 AKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKS--LKEAAAS 399
           AK   A        E   +TESEA H    D   P+D + +    K  +KS   K+ + S
Sbjct: 70  AKKAAARALALAEAESQPVTESEAAHDEHEDSGAPNDAEKKKKKKKKKSKSKTSKDLSTS 129

Query: 400 FKSTRSEDELFSDAMTEFSD-SAHHNPVMDEGLEAAI-KLGKHAQKFPGGD-------EL 552
             S   E      A TE ++ ++   P ++E  E  + ++ + ++  P  +       E 
Sbjct: 130 IASILGE----QPAQTETAEQTSEIKPAVEEQPEQQLEEVSQPSEPAPEPETVEVKEAEQ 185

Query: 553 PKVDAPTDASKPLDDPLKTSQLGDPQLLGSEVKPLDATTPFGSKSK 690
           P  DA  + SKP + P   S    P +  +E  P   T P  ++ +
Sbjct: 186 PVADAQVEESKPEEAPAPGSTEQTPAMT-TEEAPTAVTEPVSTEEQ 230



>gb:AY262693_1593711 Phytophthora sojae isolate UQ1200 clone 77
           unknown mRNA linked to Avr4/6.
          Length = 733

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 39/164 (23%), Positives = 64/164 (39%), Gaps = 4/164 (2%)
 Frame = +1

Query: 223 SAKHR-RAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSP---KVNNKSLKEA 390
           S++H  +  KK  G  +G+   ES  +  + S+ E  S+ +  + S       + S  E+
Sbjct: 338 SSRHAPKTTKKKEGGAKGFYSDESSGSESSGSESESESESESGSGSEYDSDSGSSSGSES 397

Query: 391 AASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQKFPGGDELPKVDAP 570
           A+S   + SE     ++ +E S      P   E         K   K P     PK   P
Sbjct: 398 ASSNSGSESEASSSEESESEESSEEEDRPRRRE---------KGKTKSPQKQSQPKKTKP 448

Query: 571 TDASKPLDDPLKTSQLGDPQLLGSEVKPLDATTPFGSKSKDSIG 702
            +A  PLD       LG P +  +   P+ A  P    + + +G
Sbjct: 449 ANAFDPLD------LLGSPTVNPAAAPPMQAFAPMAPATSNLLG 486



>gb:AK077458_1171861 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730411P13
           product:TTF-I INTERACTING PEPTIDE 20 (FRAGMENT) homolog
           [Homo sapiens], full insert sequence.
          Length = 312

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 7/97 (7%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV-------CGTIEGYKLTESEATHLAISD 318
           H     + C  CG  F      AKHRR+H  +       CG   G+   +S A HL +  
Sbjct: 144 HTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCG--RGFSQPKSMARHLRL-- 199

Query: 319 DEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDEL 429
             HP    P   + KV   S++ A A  ++T ++ E+
Sbjct: 200 --HPELSGPGV-AAKVLAASVRRAKAPEEATAADGEI 233



>pir|A46194|A46194 neurofilament protein NF-220, high-molecular-weight
            splice form - longfin squid>gb:SQDNF220A_1398049 Squid
            neurofilament protein (NF220) mRNA, complete cds.
          Length = 1200

 Score = 36.2 bits (82), Expect = 0.60
 Identities = 37/183 (20%), Positives = 73/183 (39%), Gaps = 18/183 (9%)
 Frame = +1

Query: 202  PFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSL 381
            P  +P PS K   + K     +   K    ++    +  ++  S+   R+P P   ++S 
Sbjct: 957  PAKSPVPSEKAAESEKSARSPVPSEKAESEKSARSPVPSEKAESEKSARSPVPSEKDESE 1016

Query: 382  KEAAASFKSTRSEDELFSDAMTEFSDS--AHHNPVMDEGLEAAIKLGKH----AQKFPGG 543
            K A +      + D+  S   +E ++S  +  +PV  E +++ +   K     + + P  
Sbjct: 1017 KSAKSP-----TSDQARSPVPSEKAESEKSARSPVTSEHVKSPVPSEKSESEKSARSPVT 1071

Query: 544  DELPKVDAPTD------------ASKPLDDPLKTSQLGDPQLLGSEVKPLDATTPFGSKS 687
             E  K   P++            AS+P   P+ + +    +   S V    AT+P  S+ 
Sbjct: 1072 SEHVKSPVPSEKAESEKSAKSPVASEPAKSPIPSEKAESEKSAKSPVTSEHATSPVASEK 1131

Query: 688  KDS 696
             +S
Sbjct: 1132 SES 1134



>gb:AB016799_2460749 Danio rerio kheper mRNA, transcription factor
            with zinc finger domain and homeo domain, complete cds.
          Length = 1078

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 26/131 (19%), Positives = 53/131 (40%), Gaps = 1/131 (0%)
 Frame = +1

Query: 160  HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDD 339
            H+    + C KCG  F +    ++H       C      K  + +     + ++++P ++
Sbjct: 881  HSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCK-----KEAQGQGLGQGVEEEDNPGEE 935

Query: 340  DPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGK 519
             P+T S   +  S  ++     STR ++       +E  D      ++DE     +K+G+
Sbjct: 936  QPQTGSTATSPPSHLDSDERGSSTRDDE-------SEEEDEMGSGSLVDEDEIQVVKIGE 988

Query: 520  HA-QKFPGGDE 549
               +   G DE
Sbjct: 989  EGDEDDQGADE 999



>gb:AE014134_1127429 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003578_1216190 Drosophila melanogaster
           chromosome 2L, section 13 of 83 of the complete
           sequence.>gb:AY069577_1294307 Drosophila melanogaster
           LD31554 full length cDNA.
          Length = 714

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 32/138 (23%), Positives = 49/138 (35%), Gaps = 28/138 (20%)
 Frame = +1

Query: 133 DHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKK----VCGTIE-GYKLTESEA 297
           D K  + S H+    H+C  CG  F   +    HRR H +     C   +  ++ +    
Sbjct: 565 DLKYHIISRHSDVKAHMCEFCGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLL 624

Query: 298 THLAISDDEHPSD---------------------DDPRTPSPKVNNKSLKEAAASFKS-- 408
           +H+ +   E P +                     D  RT  P       K AAAS K   
Sbjct: 625 SHIKVHTGERPYECSICEKKFRVSGDLKRHSRIHDPSRTSQPPAEKAKKKRAAASNKQLP 684

Query: 409 TRSEDELFSDAMTEFSDS 462
              +DEL ++     SD+
Sbjct: 685 IEEDDELATNIQNNKSDA 702



>pir|JC6510|JC6510 ras-responsive element binding transcription factor
            RREB-1 homolog - chicken>gb:AF013754_2468592 Gallus
            gallus transcription factor RREB-1 (rreb-1) mRNA,
            complete cds.
          Length = 1615

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 40/177 (22%), Positives = 60/177 (33%), Gaps = 15/177 (8%)
 Frame = +1

Query: 160  HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDD 339
            H     + C  C   F   H   +H+R H+KV  T    K ++ E T     +D      
Sbjct: 1441 HTGERPYKCQTCERTFTLKHSLVRHQRIHQKVKNTRNHGKESDKEETQSRCGEDSENESS 1500

Query: 340  DPRTPSPKVNNKSLKEAAASFKS-TRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLG 516
               T     N         S  S TRS  E    A  +        P         ++  
Sbjct: 1501 HSGTNPISENECDFAGVVGSHPSGTRSRKESLVGAAKDV-PCEEERPSGQGATADLVEPA 1559

Query: 517  KHAQKFPGGDELPK----VDAPT----------DASKPLDDPLKTSQLGDPQLLGSE 645
            K  QK P  D+ P+    ++ P+          +   P++  L ++    PQLLG E
Sbjct: 1560 KSTQKQPAKDQEPRGSSELERPSGFIQDLLEMHNKKSPMNHILASAD-STPQLLGVE 1615



>gb:AF440570_2256120 Shrimp white spot syndrome virus, complete
           genome.
          Length = 674

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 22/71 (30%), Positives = 34/71 (47%)
 Frame = +1

Query: 55  LSLFPCSSVPALLVFFSLYS*KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKH 234
           L L PC   PA++    L   K  +Q++  T++    S    +C K    F N   +A+H
Sbjct: 567 LLLHPCCKAPAIIKSVWLQILKDFSQENIKTINEKVQSLSSEICQKSNDRFKNKKIAAEH 626

Query: 235 RRAHKKVCGTI 267
            R+ KK+  TI
Sbjct: 627 VRSVKKLLNTI 637



>gb:AF369029_2242336 White spot syndrome virus, complete genome.
          Length = 674

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 22/71 (30%), Positives = 34/71 (47%)
 Frame = +1

Query: 55  LSLFPCSSVPALLVFFSLYS*KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKH 234
           L L PC   PA++    L   K  +Q++  T++    S    +C K    F N   +A+H
Sbjct: 567 LLLHPCCKAPAIIKSVWLQILKDFSQENIKTINEKVQSLSSEICQKSNDRFKNKKIAAEH 626

Query: 235 RRAHKKVCGTI 267
            R+ KK+  TI
Sbjct: 627 VRSVKKLLNTI 637



>gb:AF332093_2236430 White spot syndrome virus, complete
           genome.>gb:AY048545_2292083 White spot syndrome virus
           ORF853 (ORF853) gene, partial cds.
          Length = 674

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 22/71 (30%), Positives = 34/71 (47%)
 Frame = +1

Query: 55  LSLFPCSSVPALLVFFSLYS*KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKH 234
           L L PC   PA++    L   K  +Q++  T++    S    +C K    F N   +A+H
Sbjct: 567 LLLHPCCKAPAIIKSVWLQILKDFSQENIKTINEKVQSLSSEICQKSNDRFKNKKIAAEH 626

Query: 235 RRAHKKVCGTI 267
            R+ KK+  TI
Sbjct: 627 VRSVKKLLNTI 637



>gb:CR925678_118758 Ehrlichia ruminantium str. Welgevonden, complete
            genome.
          Length = 1569

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 1/124 (0%)
 Frame = +1

Query: 313  SDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEG 492
            +DD+ P DDD +  S + N   L E + +   T + D   +D  ++ S S   + V +  
Sbjct: 1329 TDDKTPGDDDNKDESVQQNESDLGEESNTTDRTDTMDS--TDDTSDSSVSEGESDVSESD 1386

Query: 493  LEAAIKLGKHAQKFPGGDELPKVDAPTDASKPLDDPLKTSQLGDPQL-LGSEVKPLDATT 669
            +E++            GD   +V + TD   P DD  K   +   +  LG E    D T 
Sbjct: 1387 VESS------------GDNTTEVGSNTDDKTPGDDDNKDESVQQNESDLGEESNTTDRTD 1434

Query: 670  PFGS 681
               S
Sbjct: 1435 TMDS 1438



>gb:CR767821_116883 Ehrlichia ruminantium strain Welgevonden, complete
            genome.
          Length = 1529

 Score = 34.7 bits (78), Expect = 1.7
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 1/124 (0%)
 Frame = +1

Query: 313  SDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEG 492
            +DD+ P DDD +  S + N   L E + +   T + D   +D  ++ S S   + V +  
Sbjct: 1289 TDDKTPGDDDNKDESVQQNESDLGEESNTTDRTDTMDS--TDDTSDSSVSEGESDVSESD 1346

Query: 493  LEAAIKLGKHAQKFPGGDELPKVDAPTDASKPLDDPLKTSQLGDPQL-LGSEVKPLDATT 669
            +E++            GD   +V + TD   P DD  K   +   +  LG E    D T 
Sbjct: 1347 VESS------------GDNTTEVGSNTDDKTPGDDDNKDESVQQNESDLGEESNTTDRTD 1394

Query: 670  PFGS 681
               S
Sbjct: 1395 TMDS 1398



>pir|T06458|T06458 nucleolin homolog - garden pea>gb:PEAORF_1699719
           Pisum sativum L. (clone na-481-5) mRNA, complete cds.
          Length = 611

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 3/120 (2%)
 Frame = +1

Query: 313 SDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEG 492
           SD    SDD+  T   K    ++ ++AA  K T  +DE  SD     SD  +       G
Sbjct: 223 SDSSEDSDDEEDT---KPTVTAVSKSAAVAKKTEDDDEDSSDEEDSSSDEDNKTSKPSNG 279

Query: 493 LEAAIKLGKHAQKFPGGDELPKVDAPTDA---SKPLDDPLKTSQLGDPQLLGSEVKPLDA 663
            +  + + K   K     +    D  +D+   S+  D+P KT     PQ    +V+ +DA
Sbjct: 280 NKKPVTVSKKEDKMNVDKDSSDSDEESDSDEESESEDEPSKT-----PQKKTKDVEMIDA 334



>gb:BA000032_709240 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 545

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 33/124 (26%), Positives = 52/124 (41%)
 Frame = +1

Query: 202 PFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSL 381
           P P  HP    +R H  +      Y+  +   T L++            TPS        
Sbjct: 233 PHPVHHPYVDRKREHM-LNDIARDYERIDELETALSLFGQTQ------LTPS-------- 277

Query: 382 KEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQKFPGGDELPKV 561
           +E  A      + D+LFSD +TE      H+P+    LE A KL +  ++   G+++P+V
Sbjct: 278 RERRARIYDKLNHDDLFSDIVTEML----HSPIDVSELEVAQKLEQRLKR-KQGEKVPRV 332

Query: 562 DAPT 573
             PT
Sbjct: 333 TKPT 336



>gb:AE017351_1759452 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 1515

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 34/127 (26%), Positives = 45/127 (35%), Gaps = 9/127 (7%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESE-----ATHLAISDDE 324
           H     H C +C   FPN    A   RAH     +  G KLT        +T +A S  E
Sbjct: 424 HVVQAEHRCQQCDMVFPN----AMDLRAHVNSPFSHGGEKLTPDNFPPLGSTSIAPSSSE 479

Query: 325 HPSDDDPRTPSPKVNNKSLKEAAASF----KSTRSEDELFSDAMTEFSDSAHHNPVMDEG 492
             S   P TP    +  +   +  SF    +   +  +  S    E   +   NP   E 
Sbjct: 480 SVSQHKPITPYASYSQPAWDTSMPSFVLAARPASNRQQFKSAISPEAKLTPDDNPAETEA 539

Query: 493 LEAAIKL 513
            EA  KL
Sbjct: 540 EEAVPKL 546



>gb:AY080684_1568413 Arabidopsis thaliana unknown protein
           (At4g32350) mRNA, complete cds.>gb:AY122956_1579834
           Arabidopsis thaliana unknown protein (At4g32350) mRNA,
           complete cds.
          Length = 732

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 38/162 (23%), Positives = 64/162 (39%), Gaps = 5/162 (3%)
 Frame = +1

Query: 118 KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGT-----IEGYKL 282
           K+++++H     +GH +  V L  K          S+  +RA K V G       +GYK 
Sbjct: 368 KVKHENH--VQGNGHKNGVVDLHKKIEVNASEKLKSSSSKRADKLVIGFKQESFFQGYKH 425

Query: 283 TESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDS 462
            ++E       +  H   +D  +  PK N+KS +  + +                    S
Sbjct: 426 EKNE-------EHAHQKVEDSTSRPPKPNSKSKRAESIN------------------PGS 460

Query: 463 AHHNPVMDEGLEAAIKLGKHAQKFPGGDELPKVDAPTDASKP 588
            HHN    E  E A+ +GK  ++ P GD +   +   D + P
Sbjct: 461 RHHND--RESKENAVLVGKSTEEDPSGDNVKGGEYEYDHANP 500



>gb:U00040_1401431 Caenorhabditis elegans cosmid C18H2, complete
           sequence.
          Length = 366

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +1

Query: 256 CGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFS 435
           CG  E      +++  L  S++    +++P++    ++N   + +A     T  +DELF 
Sbjct: 173 CGDSESDISEYTDSRRLRTSENSDDENEEPQSDYSNIDNVENENSALV---TSKDDELFE 229

Query: 436 DAMTEFSDSAH 468
            +MT F  S H
Sbjct: 230 SSMTSFDTSTH 240



>pir|T15565|T15565 hypothetical protein C18H2.2 - Caenorhabditis
           elegans
          Length = 767

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +1

Query: 256 CGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFS 435
           CG  E      +++  L  S++    +++P++    ++N   + +A     T  +DELF 
Sbjct: 574 CGDSESDISEYTDSRRLRTSENSDDENEEPQSDYSNIDNVENENSALV---TSKDDELFE 630

Query: 436 DAMTEFSDSAH 468
            +MT F  S H
Sbjct: 631 SSMTSFDTSTH 641



>pir|T05345|T05345 hypothetical protein F8B4.50 - Arabidopsis
           thaliana>gb:ATCHRIV77_1547155 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 77.>gb:ATF10M6_1548188
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10M6
           (ESSAII project).>gb:ATF8B4_1551091 Arabidopsis thaliana
           DNA chromosome 4, BAC clone F8B4 (ESSA project).
          Length = 730

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 38/162 (23%), Positives = 64/162 (39%), Gaps = 5/162 (3%)
 Frame = +1

Query: 118 KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGT-----IEGYKL 282
           K+++++H     +GH +  V L  K          S+  +RA K V G       +GYK 
Sbjct: 366 KVKHENH--VQGNGHKNGVVDLHKKIEVNASEKLKSSSSKRADKLVIGFKQESFFQGYKH 423

Query: 283 TESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDS 462
            ++E       +  H   +D  +  PK N+KS +  + +                    S
Sbjct: 424 EKNE-------EHAHQKVEDSTSRPPKPNSKSKRAESIN------------------PGS 458

Query: 463 AHHNPVMDEGLEAAIKLGKHAQKFPGGDELPKVDAPTDASKP 588
            HHN    E  E A+ +GK  ++ P GD +   +   D + P
Sbjct: 459 RHHND--RESKENAVLVGKSTEEDPSGDNVKGGEYEYDHANP 498



>sp|Q9K0N4|DNAK_NEIMB Chaperone protein dnaK (Heat shock protein 70)
           (Heat shock 70 kDa protein) (HSP70).>pir|H81185|H81185
           dnaK protein NMB0554 [imported] - Neisseria meningitidis
            (strain MC58 serogroup B)>gb:AE002411_46013 Neisseria
           meningitidis serogroup B strain MC58 section 53 of 206
           of the complete genome.>gb:AE002098_896126 Neisseria
           meningitidis serogroup B strain MC58 complete
           genome.>gb:AX565957_1470569 Sequence 191 from Patent
           WO02077648.
          Length = 642

 Score = 33.5 bits (75), Expect = 3.9
 Identities = 31/121 (25%), Positives = 49/121 (40%)
 Frame = +1

Query: 217 HPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAA 396
           H SAK +   K    TI+G      E     + D E  +++D          K L E  A
Sbjct: 486 HVSAKDKGTGKAANITIQGSSGLSEEEIERMVKDAEANAEED----------KKLTELVA 535

Query: 397 SFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQKFPGGDELPKVDAPTD 576
           S     +       ++ ++ D    +    E +EAA+K  + A K   GD+   +DA T+
Sbjct: 536 SRNQAEALIHSVKKSLADYGDKL--DAAEKEKIEAALKEAEEAVK---GDDKAAIDAKTE 590

Query: 577 A 579
           A
Sbjct: 591 A 591



>gb:AL353813_1923190 Human DNA sequence from clone RP11-79D8 on
           chromosome 9 Contains the TLE4 gene for transducin-like
           enhancer of split 4 (E(sp1) homolog, Drosophila) (ESG4)
           and a novel pseudogene (BCE-1), complete
           sequence.>gb:AL358975_1925316 Human DNA sequence from
           clone RP11-375O18 on chromosome 9 Contains a novel gene,
           the 5' end of the TLE4 gene for transducin-like enhancer
           of split 4 (E(sp1) homolog, Drosophila) (ESG4) and a CpG
           island, complete sequence.>gb:AL445252_1927509 Human DNA
           sequence from clone RP11-362L2 on chromosome 9 Contains
           part of the TLE4 gene for transducin-like enhancer of
           split 4 (E(sp1) homolog, Drosophila) (ESG4), complete
           sequence.
          Length = 764

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 42/156 (26%), Positives = 55/156 (35%), Gaps = 29/156 (18%)
 Frame = +1

Query: 157 GHASHGVHLCHKCGWPFP-NPHPSAKHRRAHKKVCGTIEGYKLTESEA---THLAISDDE 324
           G      HL H  G P P  PHPS     A   + G+  G     S     +HL I D++
Sbjct: 130 GQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPI-GSSAGLLALSSALGGQSHLPIKDEK 188

Query: 325 HPSDDDPRTPSP--------------------KVNNKSLKEAAASFKS--TRSEDELFSD 438
              D+D +  SP                    K      KE AA + S   +S+D L  D
Sbjct: 189 KHHDNDHQRVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVD 248

Query: 439 AMTEFSDSAHHNPV---MDEGLEAAIKLGKHAQKFP 537
              E   S   +P     + GL+    L K A   P
Sbjct: 249 VSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISP 284



>gb:AE017348_1758398 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 917

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 32/138 (23%), Positives = 46/138 (33%)
 Frame = +1

Query: 118 KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEA 297
           K   +DH  +    H     H C  CG  F  P    KH R H     T E ++L     
Sbjct: 113 KCVKRDHITSHLRVHTPLKPHPCAVCGKTFKRPQDLKKHERIH-----TAEHHQL----- 162

Query: 298 THLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNP 477
                    H     P T  P+ N++    +A      RS     S +++  S S+H   
Sbjct: 163 ---------HKLSKAPTTADPEFNSRVSLSSATRIDRPRSP---LSTSLSPTSTSSHSLH 210

Query: 478 VMDEGLEAAIKLGKHAQK 531
                 +  +  G H  K
Sbjct: 211 SSSSPFDHLLATGFHTDK 228



>gb:OSJN00281_1697891 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0093G06, complete sequence.
          Length = 822

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 33/134 (24%), Positives = 51/134 (38%), Gaps = 7/134 (5%)
 Frame = +1

Query: 211 NPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDE-HPSDDDPR-TPSPKVNNKSLK 384
           +P P+   +   K    T E     ES+ T    S D  +PSD  P    S      + +
Sbjct: 402 DPDPAMTEQNISKDPEPTTENQPTAESQPTGTHASGDRANPSDLPPTGNQSATTETATTQ 461

Query: 385 EAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDE--GLEAAIKLGKHAQKFPGGD---E 549
           E     +S    D+   +  T+ + S       D   G     +   HAQ  P GD   E
Sbjct: 462 EPPTGNQSDAGPDQEIPEVETQTTTSQGPEAGNDSTIGSPGKEQRSPHAQPGPSGDDGEE 521

Query: 550 LPKVDAPTDASKPL 591
           +P++ A  D+  P+
Sbjct: 522 IPRIKATDDSRPPI 535



>gb:TGO507036_1400181 Toxoplasma gondii mRNA for GPI transamidase 8
           (gpi8 gene).
          Length = 604

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 30/144 (20%), Positives = 60/144 (41%), Gaps = 14/144 (9%)
 Frame = +1

Query: 142 ATVSSGHASHGVH---LCHKCGWPFPNPHPS--AKHRRAHKKVCGTIEGYK---LTESEA 297
           AT SS HA+HG++      +  W      P+   +H+R + +  G     +     E E 
Sbjct: 370 ATASSLHATHGLYPIKTQRRVSWRMCRDRPAQDTQHKRGNSRAGGENSSEREENSIEREE 429

Query: 298 THLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNP 477
           T  +   +E+ S+ +  +   + N+   +E ++  +   SE E  S    E S     N 
Sbjct: 430 TENSSEREENSSEREENSSEREENSSEREENSSEREENSSEREENSSEREENSSEREENS 489

Query: 478 V------MDEGLEAAIKLGKHAQK 531
           +       + G   A+++G + ++
Sbjct: 490 IEREENSSERGGRNAVRVGTYYER 513



>sp|P05432|MIG6_RAT Mitogen-inducible gene 6 protein homolog (Mig-6)
           (Gene 33 polypeptide).>pir|S03116|S03116 gene 33
           protein, hepatic - rat>gb:BC083845_2108908 Rattus
           norvegicus cDNA clone MGC:95004 IMAGE:7121187, complete
           cds.>gb:RAT3304_2131277 Rattus norvegicus gene 33 DNA,
           exon 4 and 3' end.>gb:RRG33A_2138144 Rat mRNA for gene
           33 polypeptide.
          Length = 459

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +1

Query: 202 PFPNPHPSAKH---RRAHKKVCGTIEGYKLTESEATHLAI-SDDEHPSDDDPRTPSP 360
           P PNP P   H   RR+H    G+     +  S  TH A  S DE   +  PR P P
Sbjct: 232 PDPNPPPPQSHRRLRRSHSGPAGSFNKPAIRISSCTHRASPSSDEDKPEIPPRVPIP 288



>sp|Q99JZ7|MIG6_MOUSE Mitogen-inducible gene 6 protein homolog
           (Mig-6).>gb:BC005546_2089963 Mus musculus RIKEN cDNA
           1300002F13 gene, mRNA (cDNA clone MGC:6714
           IMAGE:3585640), complete cds.>gb:BC057646_2102858 Mus
           musculus RIKEN cDNA 1300002F13 gene, mRNA (cDNA clone
           MGC:67908 IMAGE:4194124), complete cds.
          Length = 461

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +1

Query: 202 PFPNPHPSAKH---RRAHKKVCGTIEGYKLTESEATHLAI-SDDEHPSDDDPRTPSP 360
           P PNP P   H   RR+H    G+     +  S  TH A  S DE   +  PR P P
Sbjct: 233 PDPNPPPPQSHRRLRRSHSGPAGSFNKPAIRISSCTHRASPSSDEDKPEVPPRVPIP 289



>gb:BC082946_2563015 Xenopus laevis hypothetical LOC494807, mRNA
           (cDNA clone MGC:86318 IMAGE:7009457), complete cds.
          Length = 545

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 7/74 (9%)
 Frame = +1

Query: 130 QDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV-------CGTIEGYKLTE 288
           Q H+ T    H+    +LC +CG  F +P    +H+RAH+ V       CG  + ++   
Sbjct: 256 QSHQRT----HSGEKPYLCPQCGRMFSDPSSFRRHQRAHQGVKPYQCDKCG--KPFRQPA 309

Query: 289 SEATHLAISDDEHP 330
             A H  I   E P
Sbjct: 310 DLAMHQRIHTGERP 323



>gb:BC064196_2553749 Xenopus tropicalis hypothetical protein
           MGC76080, mRNA (cDNA clone MGC:76080 IMAGE:5307865),
           complete cds.
          Length = 550

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 7/74 (9%)
 Frame = +1

Query: 130 QDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV-------CGTIEGYKLTE 288
           Q H+ T    H+    +LC +CG  F +P    +H+RAH+ V       CG  + ++   
Sbjct: 256 QSHQRT----HSGEKPYLCPQCGRMFSDPSSFRRHQRAHQGVKPYQCDKCG--KPFRQPA 309

Query: 289 SEATHLAISDDEHP 330
             A H  I   E P
Sbjct: 310 DLAMHQRIHTGERP 323



>gb:AX879644_1477918 Sequence 14549 from Patent
           EP1074617.>gb:AK022706_1909258 Homo sapiens cDNA
           FLJ12644 fis, clone NT2RM4001979, weakly similar to ZINC
           FINGER PROTEIN 84.
          Length = 505

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 9/57 (15%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHK-------KVCGT--IEGYKLTESEATH 303
           H     H+C  CG  F   +   +H RAH+        +CG    + Y+LTE E  H
Sbjct: 200 HTGKKPHVCSLCGKAFYKKYRLTEHERAHRGEKPHGCSLCGKAFYKRYRLTEHERAH 256



>gb:CEB0240_1359708 Caenorhabditis elegans cosmid B0240, complete
            sequence.>gb:CET04F3_1367162 Caenorhabditis elegans
            cosmid T04F3, complete sequence.
          Length = 3167

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 35/139 (25%), Positives = 54/139 (38%), Gaps = 21/139 (15%)
 Frame = +1

Query: 271  GYKLTESEATHLAISDDEHPSDDDPRT-PSPKVNNKSL-------KEAAASFKSTRSEDE 426
            GY+     A  +A    + PS   P+  P  K  N S         E+  S  ST S D+
Sbjct: 2128 GYETATPPAISIAAISFDQPSSSSPQAFPRSKHQNLSSLTVPGKWNESMMSNTSTISLDD 2187

Query: 427  LFSDAMTEFSDSAHHNPVMDEGL-------------EAAIKLGKHAQKFPGGDELPKVDA 567
             F+++ ++ + S  + P M + L             EA  +  K A K P  D L    +
Sbjct: 2188 SFNNSFSKSNTSQVYEPRMRKPLTLPVDNWIDNLVSEATNEATKEAPKTPKSDTLNYFRS 2247

Query: 568  PTDASKPLDDPLKTSQLGD 624
            PT  S+ +        +GD
Sbjct: 2248 PTRISQEIKYEWVADMIGD 2266



>gb:AC006638_1203494 Caenorhabditis elegans cosmid F41G4, complete
           sequence.
          Length = 644

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 36/134 (26%), Positives = 54/134 (40%), Gaps = 16/134 (11%)
 Frame = +1

Query: 313 SDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDEL-----FS-DAMTEFSDSAHHN 474
           +DDE     D R    + + + L E A+SF    +   L     FS +A    S+S+  N
Sbjct: 57  ADDEQRQSADRRAQDHRESFRRLHEEASSFADFFTNARLPAMRTFSPEAARSSSNSSDRN 116

Query: 475 PVMDEGLEAAIKLG-KHAQKFPGGDELP----KVDAPTDASKPLDDPLKTSQLGDPQL-- 633
           P MD+  E A++L  +         +LP        P   S   D+    S  G   +  
Sbjct: 117 PRMDQDFELAMELACEEMSAIHARAQLPMNYEASHPPEQPSSESDEDKSVSSAGSGSITT 176

Query: 634 ---LGSEVKPLDAT 666
              L + V PL+AT
Sbjct: 177 AAVLANVVAPLEAT 190



>gb:HSM803019_1186869 Homo sapiens mRNA; cDNA DKFZp761I0915 (from
           clone DKFZp761I0915).>gb:BC005368_1969810 Homo sapiens
           hypothetical protein FLJ12644, mRNA (cDNA clone
           MGC:12483 IMAGE:3930849), complete cds.
          Length = 505

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 9/57 (15%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHK-------KVCGT--IEGYKLTESEATH 303
           H     H+C  CG  F   +   +H RAH+        +CG    + Y+LTE E  H
Sbjct: 200 HTGKKPHVCSLCGKAFYKKYRLTEHERAHRGEKPHGCSLCGKAFYKRYRLTEHERAH 256



>gb:AE013599_1131650 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003819_1226100 Drosophila melanogaster
           chromosome 2R, section 31 of 74 of the complete
           sequence.
          Length = 293

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 39/149 (26%), Positives = 59/149 (39%), Gaps = 15/149 (10%)
 Frame = +1

Query: 289 SEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAM-TEFSDSA 465
           SEA + A    +    DD   P   V    L  AAA    + +EDE  SD + T ++ + 
Sbjct: 116 SEANYPANEASDDTESDDEDEPGSTVYFMKLPAAAAEDTYSSTEDEDDSDFLNTTYTWNL 175

Query: 466 HHNP---VMDEGLEAAIKLGKHAQKFPGGD-----------ELPKVDAPTDASKPLDDPL 603
            + P   + D   E  + LG  A++ P  +           E PKV   T   K    P 
Sbjct: 176 RNVPKLRINDAEAEGELTLGHQAREVPQQEQPQEKQPCLEPEPPKVRPATPTPKA---PP 232

Query: 604 KTSQLGDPQLLGSEVKPLDATTPFGSKSK 690
           + S  G  Q L   +  L+ + P+  + K
Sbjct: 233 QESAEGQTQKLLFRLDKLERSWPWADREK 261



>pir|T18674|T18674 hypothetical protein T04F3.1 - Caenorhabditis
            elegans
          Length = 3147

 Score = 32.7 bits (73), Expect = 6.6
 Identities = 35/139 (25%), Positives = 54/139 (38%), Gaps = 21/139 (15%)
 Frame = +1

Query: 271  GYKLTESEATHLAISDDEHPSDDDPRT-PSPKVNNKSL-------KEAAASFKSTRSEDE 426
            GY+     A  +A    + PS   P+  P  K  N S         E+  S  ST S D+
Sbjct: 2128 GYETATPPAISIAAISFDQPSSSSPQAFPRSKHQNLSSLTVPGKWNESMMSNTSTISLDD 2187

Query: 427  LFSDAMTEFSDSAHHNPVMDEGL-------------EAAIKLGKHAQKFPGGDELPKVDA 567
             F+++ ++ + S  + P M + L             EA  +  K A K P  D L    +
Sbjct: 2188 SFNNSFSKSNTSQVYEPRMRKPLTLPVDNWIDNLVSEATNEATKEAPKTPKSDTLNYFRS 2247

Query: 568  PTDASKPLDDPLKTSQLGD 624
            PT  S+ +        +GD
Sbjct: 2248 PTRISQEIKYEWVADMIGD 2266



>gb:XLA224945_2582441 Xenopus laevis Grg-4 clone mRNA for Groucho
           family protein.
          Length = 766

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 46/185 (24%), Positives = 74/185 (40%), Gaps = 13/185 (7%)
 Frame = +1

Query: 178 HLCHKCGWPFP-NPHPSAKHRRAHKKVCGTIEGYKLTESEA---THLAISDDEHPSDDDP 345
           HL H  G P P  PHPS     A   + G+  G     S     +HL I D++   D D 
Sbjct: 132 HLSHAHGLPVPLTPHPSGLQPPAIPSI-GSSAGLLALSSALGGQSHLPIKDEKKHHDSDH 190

Query: 346 RTPSPKVNNKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHA 525
           +     + + S+   +ASF++            T++S  +       E  + A +     
Sbjct: 191 QRDRDSIKSSSV-SPSASFRAAEKHRN-----STDYSSESKKQKT--EEKDIAARYSSDG 242

Query: 526 QKFPGGDELPKVDAPTDASKPLDDPL---KTSQLGDPQLLGSE--VKPL----DATTPFG 678
           +K    D L +  +  D S P   P    + + L  P+LL  +  + P      ++TP  
Sbjct: 243 EK--SDDNLVRDVSNEDPSSPRGSPAHSPRENGLDKPRLLKKDAPISPASIASSSSTP-S 299

Query: 679 SKSKD 693
           SKSK+
Sbjct: 300 SKSKE 304



>gb:BC057078_2102574 Mus musculus zinc finger protein 316, mRNA (cDNA
            clone MGC:67468 IMAGE:5698016), complete cds.
          Length = 1016

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 38/157 (24%), Positives = 54/157 (34%), Gaps = 10/157 (6%)
 Frame = +1

Query: 160  HASHGVHLCHKCGWPFPNPHPSAKHRRAHK-------KVCGTIEGYKLTESEATHLAISD 318
            HA    H C  CG  F +     +HRR H          CG   G+    + A H     
Sbjct: 841  HAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCG--RGFAQRSNLAKHRRGHT 898

Query: 319  DEHPSDDDPRTPSPKVNNK-SLKEAAASFKSTRSEDE--LFSDAMTEFSDSAHHNPVMDE 489
             E P       P P+   + S +    + + T + +   L S+    FS S+H       
Sbjct: 899  GERP------FPCPECGKRFSQRSVLVTHQRTHTGERPYLCSNCGRRFSQSSH------- 945

Query: 490  GLEAAIKLGKHAQKFPGGDELPKVDAPTDASKPLDDP 600
             L   +K  +     P      K  AP  A+ PL  P
Sbjct: 946  -LLTHMKTHRGPGSAPAHTSSTKAQAPAKATPPLPPP 981



>gb:BC043067_2098803 Mus musculus zinc finger protein 422, related
           sequence 1, mRNA (cDNA clone MGC:57971 IMAGE:5709349),
           complete cds.
          Length = 545

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 22/75 (29%), Positives = 29/75 (38%), Gaps = 9/75 (12%)
 Frame = +1

Query: 106 LYS*KMENQDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHK-------KVCG- 261
           LYS  M  ++H+ T    H     + C  CG  F        H + HK       K CG 
Sbjct: 268 LYS--MARRNHEKTHKRDHTREKTYSCRHCGETFLYSKACRDHEKTHKKERSFICKYCGK 325

Query: 262 -TIEGYKLTESEATH 303
             I  Y+L + E  H
Sbjct: 326 ACIHSYQLLQHERRH 340



>gb:AF082568_2053868 Mus musculus zinc finger type transcription
            factor MZF-3 mRNA, complete cds.
          Length = 841

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 38/157 (24%), Positives = 54/157 (34%), Gaps = 10/157 (6%)
 Frame = +1

Query: 160  HASHGVHLCHKCGWPFPNPHPSAKHRRAHK-------KVCGTIEGYKLTESEATHLAISD 318
            HA    H C  CG  F +     +HRR H          CG   G+    + A H     
Sbjct: 666  HAEEKPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCADCG--RGFAQRSNLAKHRRGHT 723

Query: 319  DEHPSDDDPRTPSPKVNNK-SLKEAAASFKSTRSEDE--LFSDAMTEFSDSAHHNPVMDE 489
             E P       P P+   + S +    + + T + +   L S+    FS S+H       
Sbjct: 724  GERP------FPCPECGKRFSQRSVLVTHQRTHTGERPYLCSNCGRRFSQSSH------- 770

Query: 490  GLEAAIKLGKHAQKFPGGDELPKVDAPTDASKPLDDP 600
             L   +K  +     P      K  AP  A+ PL  P
Sbjct: 771  -LLTHMKTHRGPGSAPAHTSSTKAQAPAKATPPLPPP 806



>gb:AF062402_2052912 Rattus norvegicus versican V0 isoform mRNA,
            partial cds.
          Length = 2390

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 36/154 (23%), Positives = 64/154 (41%), Gaps = 7/154 (4%)
 Frame = +1

Query: 187  HKCGWPFPNPHPSAKH-RRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPK 363
            HK   P P    S K    + KKV   IE        AT  ++ +++H ++    +PSP 
Sbjct: 1849 HKSAQPAPTAASSQKLIEGSFKKVRANIE--------ATIKSLGENDHGTESPSMSPSPA 1900

Query: 364  VN---NKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQKF 534
            ++   + S  +     +++ ++ E   D+  + +D     P    G+ A IK  +     
Sbjct: 1901 LDISEDDSKPKLLEDLETSPTKTETSQDSPNKANDQI---PGKTAGILAGIKTTESGPVV 1957

Query: 535  PGGDELPKVDA---PTDASKPLDDPLKTSQLGDP 627
               D++   DA   P  AS P    ++TS +  P
Sbjct: 1958 TAADDMELGDATQRPHSASAPAAFRVETSMVPQP 1991



>gb:BC077728_1989661 Homo sapiens hypothetical protein LOC126208,
           mRNA (cDNA clone MGC:78664 IMAGE:6210543), complete cds.
          Length = 382

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 7/97 (7%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV-------CGTIEGYKLTESEATHLAISD 318
           H     + C  CG  F      AKHRR+H  +       CG   G+   +S A HL +  
Sbjct: 144 HTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCG--RGFSQPKSLARHLRL-- 199

Query: 319 DEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDEL 429
             HP    P   + KV   S++ A    ++  ++ E+
Sbjct: 200 --HPELSGPGV-AAKVLAASVRRAKGPEEAVAADGEI 233



>gb:BC021997_1977642 Homo sapiens hypothetical protein FLJ13479,
           mRNA (cDNA clone MGC:2552 IMAGE:2967121), complete cds.
          Length = 619

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 130 QDHKATVSSGHASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV 255
           Q H+ T    H+     LC +CG  F +P    +H+RAH++V
Sbjct: 268 QSHERT----HSGEKPFLCPRCGRMFSDPSSFRRHQRAHEEV 305



>gb:AF000560_1875711 Homo sapiens TTF-I interacting peptide 20 mRNA,
           partial cds.
          Length = 385

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 26/97 (26%), Positives = 40/97 (41%), Gaps = 7/97 (7%)
 Frame = +1

Query: 160 HASHGVHLCHKCGWPFPNPHPSAKHRRAHKKV-------CGTIEGYKLTESEATHLAISD 318
           H     + C  CG  F      AKHRR+H  +       CG   G+   +S A HL +  
Sbjct: 147 HTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCG--RGFSQPKSLARHLRL-- 202

Query: 319 DEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDEL 429
             HP    P   + KV   S++ A    ++  ++ E+
Sbjct: 203 --HPELSGPGV-AAKVLAASVRRAKGPEEAVAADGEI 236



>gb:AY551436_1613344 Hordeum vulgare subsp. vulgare ent-kaurene
           synthase-like protein 1 (KSL1) mRNA, complete cds.
          Length = 850

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = +1

Query: 265 IEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAASFKSTRSEDELFSDAM 444
           + GY ++  E +HLA +   H S           + KS+ E   + K + SE EL  D +
Sbjct: 400 MNGYDVSSDELSHLAEASSFHNS-----LQGYLNDTKSVLELFKASKVSVSEHELILDNI 454

Query: 445 TEFSDSAHHNPVMDEGLEAAIKLG--KHAQKFPGGDELPKVD 564
             +S S     +  EG++     G  ++A KFP    L ++D
Sbjct: 455 GHWSGSLLSEKLCSEGVQGLPIFGEMEYALKFPFYTTLERLD 496



>gb:AY366084_1429505 Bos taurus Kruppel-like factor 15 mRNA, partial
           cds.
          Length = 303

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 16/56 (28%), Positives = 24/56 (42%)
 Frame = +1

Query: 193 CGWPFPNPHPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSP 360
           CGW F      ++HRR+H  V  T+   +   + + HL+     H      R P P
Sbjct: 248 CGWRFSRSDELSRHRRSHSGVKPTVPRVREEVARSDHLSKHVKVHRFPRSSRLPRP 303



>gb:BX897699_826644 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 257

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 6/117 (5%)
 Frame = -1

Query: 543 APRKFLSMFAQFYSSL-QTFIHDWIMMGTIRKLCHGIREKLIL*SSGF---EASSSLFQT 376
           +P  ++ MFA   + L  +F  + +   T R L  G    + L  S       + S+ QT
Sbjct: 80  SPFSYIIMFAPLVAVLFLSFKINTLSTSTARSLFFGYAALVGLSLSSIILRYTTESIVQT 139

Query: 375 FVVNLRTWGSRIIIGGVFVVRNSQMGGFRFSKLIPLNSS--ADLFMGSPVLSTRVRV 211
           FV++  T+G+  + G       + MG F F  L+ L  S   ++F+GS  L   + V
Sbjct: 140 FVISAATFGALSLYGYTTKRDLTAMGSFFFIGLVGLMLSMIVNIFLGSSALQFAISV 196



>pir|T33879|T33879 hypothetical protein Y14H12B.1 - Caenorhabditis
           elegans>gb:AF125447_1243073 Caenorhabditis elegans
           cosmid Y14H12B, complete sequence.
          Length = 250

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 40/165 (24%), Positives = 65/165 (39%)
 Frame = +1

Query: 37  RIFTLSLSLFPCSSVPALLVFFSLYS*KMENQDHKATVSSGHASHGVHLCHKCGWPFPNP 216
           R+F  S  L   +SV   L    + S +++  D +A  SS   +       K   P P P
Sbjct: 36  RVFYTSRGLQWHTSVAHKLDNSEIPSTRLQLSDDEAPPSSPSLNLSTRSMRKRSVPIPLP 95

Query: 217 HPSAKHRRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPKVNNKSLKEAAA 396
             S +   + K      +  K  E EAT     + E P D    + S +++N+ ++E   
Sbjct: 96  EDSKEMVASRKSTQKKAKKEKTPEKEAT----PEPESPDD----SGSEEIDNEMMEEEKQ 147

Query: 397 SFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQK 531
            +K   +  E      T FS       ++ E L+A + L K   K
Sbjct: 148 EYKFVYNIVERVPPPQTVFSVGEMGKKLLPE-LQAKVSLTKRKHK 191



>sp|Q9ERB4|PGCV_RAT Versican core protein precursor (Large fibroblast
            proteoglycan) (Chondroitin sulfate proteoglycan core
            protein 2) (PG-M) (Glial hyaluronate-binding protein)
            (GHAP) (Fragments).
          Length = 2738

 Score = 32.3 bits (72), Expect = 8.6
 Identities = 36/154 (23%), Positives = 64/154 (41%), Gaps = 7/154 (4%)
 Frame = +1

Query: 187  HKCGWPFPNPHPSAKH-RRAHKKVCGTIEGYKLTESEATHLAISDDEHPSDDDPRTPSPK 363
            HK   P P    S K    + KKV   IE        AT  ++ +++H ++    +PSP 
Sbjct: 2197 HKSAQPAPTAASSQKLIEGSFKKVRANIE--------ATIKSLGENDHGTESPSMSPSPA 2248

Query: 364  VN---NKSLKEAAASFKSTRSEDELFSDAMTEFSDSAHHNPVMDEGLEAAIKLGKHAQKF 534
            ++   + S  +     +++ ++ E   D+  + +D     P    G+ A IK  +     
Sbjct: 2249 LDISEDDSKPKLLEDLETSPTKTETSQDSPNKANDQI---PGKTAGILAGIKTTESGPVV 2305

Query: 535  PGGDELPKVDA---PTDASKPLDDPLKTSQLGDP 627
               D++   DA   P  AS P    ++TS +  P
Sbjct: 2306 TAADDMELGDATQRPHSASAPAAFRVETSMVPQP 2339


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.316    0.132    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 784,243,759
Number of Sequences: 1806583
Number of extensions: 16549856
Number of successful extensions: 62184
Number of sequences better than 10.0: 51
Number of HSP's better than 10.0 without gapping: 50890
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61628
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42145286112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)