BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3483
         (984 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY136301_1581802 Arabidopsis thaliana putative protein (At5g1...    75   2e-12   
gb:ATF2I11_1550487 Arabidopsis thaliana DNA chromosome 5, BAC cl...    75   2e-12   
gb:AP001539_1821273 Oryza sativa (japonica cultivar-group) genom...    53   8e-06   
gb:AC105259_1737870 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
pir|F96713|F96713 unknown protein T6L1.9 [imported] - Arabidopsi...    42   0.019   Arabidopsis thaliana [mouse-ear cress]
gb:BT010582_1640528 Arabidopsis thaliana At4g05190 mRNA, complet...    36   1.0     
pir|C85065|C85065 kinesin-like protein [imported] - Arabidopsis ...    36   1.0     Arabidopsis thaliana [mouse-ear cress]
gb:AP006532_1862322 Oryza sativa (japonica cultivar-group) genom...    35   1.7     
pir|S55785|S55785 nucleolar protein gar2 - fission yeast (Schizo...    35   1.7     Schizosaccharomyces pombe
sp|P41891|GAR2_SCHPO|GAR2_SCHPO Protein gar2.>gb:SPAC140_1716485 S.pombe ch...    35   1.7     Schizosaccharomyces pombe
gb:AE017346_1757424 Cryptococcus neoformans var. neoformans JEC2...    35   2.3     
gb:AC105747_1738158 Oryza sativa chromosome 3 BAC OSJNBb0101N11 ...    35   3.0     
pir|G96510|G96510 hypothetical protein F2G19.5 [imported] - Arab...    35   3.0     Arabidopsis thaliana [mouse-ear cress]
gb:AE014297_1140220 Drosophila melanogaster chromosome 3R, compl...    34   5.0     
gb:CR382134_1667162 Debaryomyces hansenii chromosome B of strain...    33   6.6     
gb:CR382130_1662506 Yarrowia lipolytica chromosome D of strain C...    33   6.6     
gb:AE016951_365573 Enterococcus faecalis V583, section 5 of 11 o...    33   6.6     
gb:CR382131_1664658 Yarrowia lipolytica chromosome E of strain C...    33   8.6     
pir|T22976|T22976 hypothetical protein F59A2.6 - Caenorhabditis ...    33   8.6     Caenorhabditis elegans [roundworm]


>gb:AY136301_1581802 Arabidopsis thaliana putative protein
           (At5g11390) mRNA, complete cds.>gb:BT000394_1634672
           Arabidopsis thaliana putative protein (At5g11390) mRNA,
           complete cds.
          Length = 703

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 55/165 (33%), Positives = 80/165 (48%), Gaps = 10/165 (6%)
 Frame = +1

Query: 517 SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS 696
           ++T  D     D++ S   E  S      + +  +G+ M    S   EV+ K+E+D A  
Sbjct: 3   TETEHDRTVSVDDNDSLVPEPSSTKESFFEDLSLTGQVMNPQLSSAGEVLTKVELDFAFV 62

Query: 697 SEKLANLGVLKMHVETRENEFEAFVAEKEQ-----SSN-----DSVQKAMEFXXXXXXXX 846
           SEKL NL +L M + TREN+FE+FV++KE+     SSN     DS +KA+EF        
Sbjct: 63  SEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEEPSSNVDDDDDSAEKALEFDLLSSILN 122

Query: 847 XXXXXXXXXXXXXQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE 981
                        Q EI  +R +I   +  GE +  +E KLND E
Sbjct: 123 SEVKELESLLGFLQNEIQSARVMISPFQHDGEAFLDLEGKLNDTE 167



>gb:ATF2I11_1550487 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 696

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 55/165 (33%), Positives = 80/165 (48%), Gaps = 10/165 (6%)
 Frame = +1

Query: 517 SKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGS 696
           ++T  D     D++ S   E  S      + +  +G+ M    S   EV+ K+E+D A  
Sbjct: 3   TETEHDRTVSVDDNDSLVPEPSSTKESFFEDLSLTGQVMNPQLSSAGEVLTKVELDFAFV 62

Query: 697 SEKLANLGVLKMHVETRENEFEAFVAEKEQ-----SSN-----DSVQKAMEFXXXXXXXX 846
           SEKL NL +L M + TREN+FE+FV++KE+     SSN     DS +KA+EF        
Sbjct: 63  SEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEEPSSNVDDDDDSAEKALEFDLLSSILN 122

Query: 847 XXXXXXXXXXXXXQMEIGYSRQIIPSCEDAGELYGVIEEKLNDAE 981
                        Q EI  +R +I   +  GE +  +E KLND E
Sbjct: 123 SEVKELESLLGFLQNEIQSARVMISPFQHDGEAFLDLEGKLNDTE 167



>gb:AP001539_1821273 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0708G02.>gb:AP002481_1822166
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, clone:P0702F03.
          Length = 698

 Score = 53.1 bits (126), Expect = 8e-06
 Identities = 38/136 (27%), Positives = 61/136 (44%)
 Frame = +1

Query: 571 LEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRE 750
           L    +  D  D+++S G+  +  GSI E +   +++ +A  SEKL NL +L M +  R 
Sbjct: 39  LPTNQRETDGDDILLSGGDDDRNGGSIAE-IQTTVDLGVAFGSEKLLNLEMLLMEIAHRA 97

Query: 751 NEFEAFVAEKEQSSNDSVQKAMEFXXXXXXXXXXXXXXXXXXXXXQMEIGYSRQIIPSCE 930
            E E  V + E  S +SVQ+  EF                     +++IG   +++ S E
Sbjct: 98  TEIEPLVLDAESISAESVQRVSEFDLLHCILDSEVKELEKLVDSIEVDIGNGGKMMASDE 157

Query: 931 DAGELYGVIEEKLNDA 978
           D       +  KL DA
Sbjct: 158 DP---VSEVNSKLRDA 170



>gb:AC105259_1737870 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1115_B04, complete sequence.
          Length = 669

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 26/81 (32%), Positives = 44/81 (54%)
 Frame = +1

Query: 577 EESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENE 756
           E S + D     + +G+ M   G    E+I ++E++LA +SEKL NL +L M +  +  +
Sbjct: 4   ENSMDDDHFQQNMGNGDGMNVEGG-SMEIITRVELELAFASEKLLNLEMLVMEIARKATD 62

Query: 757 FEAFVAEKEQSSNDSVQKAME 819
           FE    E E  S+++ + A E
Sbjct: 63  FEPPTLEDESVSSETAESAFE 83



>pir|F96713|F96713 unknown protein T6L1.9 [imported] - Arabidopsis
           thaliana>gb:AE005173_894507 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC011665_1537340 Arabidopsis thaliana
           chromosome 1 BAC T6L1 genomic sequence, complete
           sequence.
          Length = 534

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 39/134 (29%), Positives = 58/134 (43%)
 Frame = +1

Query: 577 EESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENE 756
           EE    D  + + S  E  QE+      ++ K+E+D A +SEKL NL VL MH+   +N+
Sbjct: 2   EEIIREDYFEALSSRNEEEQEM----LRMLTKLEIDSAYTSEKLMNLHVLLMHLLAWDND 57

Query: 757 FEAFVAEKEQSSNDSVQKAMEFXXXXXXXXXXXXXXXXXXXXXQMEIGYSRQIIPSCEDA 936
            E        SS  S +KA+ F                     + +I  +   I SC+  
Sbjct: 58  LEGM--GTLDSSPASFEKALTFDLLCGILESEVKEVDEVLDVLEAQIVDTSYKISSCKHG 115

Query: 937 GELYGVIEEKLNDA 978
              Y VIE KL ++
Sbjct: 116 N--YIVIEGKLGES 127



>gb:BT010582_1640528 Arabidopsis thaliana At4g05190 mRNA, complete
           cds.>gb:AK175713_1817701 Arabidopsis thaliana mRNA for
           kinesin - like protein, complete cds, clone:
           RAFL22-25-H17.
          Length = 790

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 23/100 (23%), Positives = 50/100 (50%), Gaps = 4/100 (4%)
 Frame = +1

Query: 532 DANSGKDEHCSGEL----EEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSS 699
           D +  + +  +GE+    E   K+   LD++++   +++E  S+++E I  +E +LA + 
Sbjct: 311 DRHVVQSQKLAGEILMYKESVGKSSHELDILIAKSGSLEETCSLQKERIKMLEQELAFAK 370

Query: 700 EKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAME 819
           EKL  + +   H  T   E +  + E +    D+ ++  E
Sbjct: 371 EKLKMVDLSMSHTMTEFEEQKQCMHELQDRLADTERQLFE 410



>pir|C85065|C85065 kinesin-like protein [imported] - Arabidopsis
           thaliana>gb:ATCHRIV15_1544363 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 15.
          Length = 777

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 23/100 (23%), Positives = 50/100 (50%), Gaps = 4/100 (4%)
 Frame = +1

Query: 532 DANSGKDEHCSGEL----EEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSS 699
           D +  + +  +GE+    E   K+   LD++++   +++E  S+++E I  +E +LA + 
Sbjct: 298 DRHVVQSQKLAGEILMYKESVGKSSHELDILIAKSGSLEETCSLQKERIKMLEQELAFAK 357

Query: 700 EKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAME 819
           EKL  + +   H  T   E +  + E +    D+ ++  E
Sbjct: 358 EKLKMVDLSMSHTMTEFEEQKQCMHELQDRLADTERQLFE 397



>gb:AP006532_1862322 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:B1446H11.
          Length = 545

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 14/108 (12%)
 Frame = +1

Query: 532 DANSGKDEHCSGEL-------EEESKNVDSLDVIVSSGETMQELGSIE-EEVIAKIEVDL 687
           D++ G+D+ C G+        + + K  +S + + ++  +     S+  E V   +E + 
Sbjct: 434 DSDDGEDDPCKGKAPPPANAKKNKKKKSNSKEHVNATSSSAAASASVAVERVTRSVEQEA 493

Query: 688 AGSSEKLANL--GVLKMHVETRENEFEAFVAEKEQS----SNDSVQKA 813
               E++     G+LK+H E  + E +A +A KE++    S+D  +KA
Sbjct: 494 DDEDERIQRAVNGMLKLHDEGSQGEQQALLASKEEAGSKPSSDEEEKA 541



>pir|S55785|S55785 nucleolar protein gar2 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPGAR2GN_1721800 S.pombe
           gar2 gene.
          Length = 500

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 30/96 (31%), Positives = 44/96 (45%)
 Frame = +1

Query: 514 SSKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAG 693
           SS++  +++S + E  S E E  S   +S     SS E+       EEEVI K E     
Sbjct: 84  SSESESESSSSESESSSSESESSSSESESSSSESSSSES-------EEEVIVKTEEKKES 136

Query: 694 SSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDS 801
           SSE  ++           E E    + EK++SS+DS
Sbjct: 137 SSESSSS------SESEEEEEAVVKIEEKKESSSDS 166



>sp|P41891|GAR2_SCHPO Protein gar2.>gb:SPAC140_1716485 S.pombe
           chromosome I cosmid c140.
          Length = 500

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 30/96 (31%), Positives = 44/96 (45%)
 Frame = +1

Query: 514 SSKTIMDANSGKDEHCSGELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAG 693
           SS++  +++S + E  S E E  S   +S     SS E+       EEEVI K E     
Sbjct: 84  SSESESESSSSESESSSSESESSSSESESSSSESSSSES-------EEEVIVKTEEKKES 136

Query: 694 SSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDS 801
           SSE  ++           E E    + EK++SS+DS
Sbjct: 137 SSESSSS------SESEEEEEAVVKIEEKKESSSDS 166



>gb:AE017346_1757424 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 161

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 7/88 (7%)
 Frame = +1

Query: 568 ELEEESKNVDSLDVIVSSGETMQELGS-------IEEEVIAKIEVDLAGSSEKLANLGVL 726
           ELE     V  L      GET +  G        + EE + K E DL  ++EKL  + V 
Sbjct: 56  ELEASESKVKELKAASDEGETHRTTGENLARKVQLLEEELDKAEKDLKETTEKLRQVDVK 115

Query: 727 KMHVETRENEFEAFVAEKEQSSNDSVQK 810
             H E +    E    E E+   ++V+K
Sbjct: 116 AEHFERQVQRLEQERDEWERKHGEAVEK 143



>gb:AC105747_1738158 Oryza sativa chromosome 3 BAC OSJNBb0101N11
           genomic sequence, complete sequence.
          Length = 1515

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = +1

Query: 538 NSGKDEHC-SGELEEESKNV-DSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEKLA 711
           N+ +D HC  GE  EE K + + L   +S  +      S  E  +++IE++L    + + 
Sbjct: 538 NASRDVHCLKGESSEEEKGLHEKLQKALSDLDEAYSAVSERESELSQIEINLHKQKQAME 597

Query: 712 NLGVLKMHVETRENEFEAFVAEKEQSSNDSV 804
           +L  LK+   + ENE + ++ E      D +
Sbjct: 598 HLEELKL---SMENELKGYMDENNVLKRDLI 625



>pir|G96510|G96510 hypothetical protein F2G19.5 [imported] -
           Arabidopsis thaliana>gb:AE005173_892669 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC083835_1733183 Arabidopsis thaliana
           chromosome 1 BAC F2G19 genomic sequence, complete
           sequence.
          Length = 752

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +1

Query: 568 ELEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSE--KLANLGVLKMHVE 741
           E EE+    DS D+     E M++  + E  V AK ++++A +     ++ LG ++  +E
Sbjct: 241 EKEEQQAKQDS-DLAKLRVEEMEQGIAGEVSVAAKSQLEVAKARHLSAVSELGTIREEIE 299

Query: 742 TRENEFEAFVAEKE---QSSNDSVQKAME 819
              NE+E+ + EK+   + + DSV KA +
Sbjct: 300 MVSNEYESLLTEKDLAAKKAEDSVLKAKD 328



>gb:AE014297_1140220 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003722_1222213 Drosophila melanogaster
           chromosome 3R, section 60 of 118 of the complete
           sequence.
          Length = 1194

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = -3

Query: 880 RTTKHLVPLPQSPRVQIKAQTPSPSEQNHLNFAPSQQQKPQ 758
           +T +H  PLP SP+ Q++ Q   P + +HL     QQQ+ Q
Sbjct: 208 KTVQHFPPLPPSPKEQVQQQ--HPQQHHHLLHHQQQQQQQQ 246



>gb:CR382134_1667162 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 716

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 8/72 (11%)
 Frame = +1

Query: 598 SLDVIVSSGET---MQELGSIEEEVIAKIEVD-----LAGSSEKLANLGVLKMHVETREN 753
           SLD +++S ET    +E+  + +E+  K + D     L  + +K A L   K+H   +E 
Sbjct: 140 SLDAVIASSETESLRKEVSKLNDELSKKADYDQLKQRLLRNEQKSAELLSSKLHA--KEE 197

Query: 754 EFEAFVAEKEQS 789
           EF+A + EK+ +
Sbjct: 198 EFKALIDEKQSN 209



>gb:CR382130_1662506 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 751

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = -3

Query: 934 HPHMKV*SGGNTQSPFEERTTKHLVPLPQSPRVQIKAQTPSPSEQNHL---NFAPSQQQK 764
           HPH  + +  +T  P    T   L PLPQ P+ QI+AQ  + S   HL      P+   K
Sbjct: 136 HPHHILHAPPHTPYPPHPHT--QLPPLPQQPQAQIQAQIQAQSHPPHLPPITIHPNHTSK 193

Query: 763 P 761
           P
Sbjct: 194 P 194



>gb:AE016951_365573 Enterococcus faecalis V583, section 5 of 11 of
           the complete genome.>gb:AE016830_992061 Enterococcus
           faecalis V583, complete genome.
          Length = 691

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 23/98 (23%), Positives = 42/98 (42%), Gaps = 2/98 (2%)
 Frame = +1

Query: 532 DANSGKDEHCSGE--LEEESKNVDSLDVIVSSGETMQELGSIEEEVIAKIEVDLAGSSEK 705
           ++N  K E  + +  +  +S++V  L+  +  G + +   S+EE + A  E     + EK
Sbjct: 85  ESNDDKKEESTEDNLIVSDSEDVSGLEASLQEGASEETHDSVEESIPATEETPTHSTEEK 144

Query: 706 LANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQKAME 819
           LA    + +   T E   E    E E +      K+ E
Sbjct: 145 LATDEAVNLEETTEETTEETTTVEAETAEVSETVKSEE 182



>gb:CR382131_1664658 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 499

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 22/81 (27%), Positives = 33/81 (40%)
 Frame = -3

Query: 979 RHHSTFLQSPHKVLLHPHMKV*SGGNTQSPFEERTTKHLVPLPQSPRVQIKAQTPSPSEQ 800
           +H +   Q P  +L HPH +     + QSP    + +    LP  P+ Q +         
Sbjct: 245 QHPAHLSQQPQPLLQHPHQQQQQPPHMQSPHHPSSLQSSPVLPYFPQHQPQ--------- 295

Query: 799 NHLNFAPSQQQKPQIHFPLFP 737
                 P QQQ+ Q H P+ P
Sbjct: 296 ------PQQQQQQQQHHPMSP 310



>pir|T22976|T22976 hypothetical protein F59A2.6 - Caenorhabditis
           elegans>gb:CEF59A2_1364849 Caenorhabditis elegans cosmid
           F59A2, complete sequence.>gb:CEK01A11_1365132
           Caenorhabditis elegans cosmid K01A11, complete sequence.
          Length = 1133

 Score = 33.1 bits (74), Expect = 8.6
 Identities = 21/63 (33%), Positives = 36/63 (57%)
 Frame = +1

Query: 631 MQELGSIEEEVIAKIEVDLAGSSEKLANLGVLKMHVETRENEFEAFVAEKEQSSNDSVQK 810
           + E  ++ EE+ AK + D+   +E++   G L+   +  E+E +AF  EKEQ   + + K
Sbjct: 64  VNEAKALREEIQAKYD-DVTQKAERIQ--GELEESKKVLESEKQAFENEKEQEREEQLAK 120

Query: 811 AME 819
           AME
Sbjct: 121 AME 123


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 935,760,643
Number of Sequences: 1806583
Number of extensions: 18760468
Number of successful extensions: 54504
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 52190
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54423
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 71931210200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)