BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3477
         (922 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT003850_1636978 Arabidopsis thaliana clone RAFL15-48-D07 (R2...   221   2e-56   
gb:ATAC009918_1543097 Arabidopsis thaliana chromosome III BAC T1...   220   3e-56   
pir|B84775|B84775 probable harpin-induced protein [imported] - A...   209   8e-53   Arabidopsis thaliana [mouse-ear cress]
pir|T08452|T08452 hypothetical protein F22O6.150 - Arabidopsis t...   199   5e-50   Arabidopsis thaliana [mouse-ear cress]
pir|T49138|T49138 hypothetical protein T10D17.10 - Arabidopsis t...   189   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AB006700_1509902 Arabidopsis thaliana genomic DNA, chromosome...   188   1e-46   
pir|C84775|C84775 probable harpin-induced protein [imported] - A...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
pir|A85098|A85098 hypothetical protein AT4g09590 [imported] - Ar...   177   3e-43   Arabidopsis thaliana [mouse-ear cress]
gb:ATT6G21_1556332 Arabidopsis thaliana DNA chromosome 5, BAC cl...   168   1e-40   
gb:AP004753_1844431 Oryza sativa (japonica cultivar-group) genom...   141   2e-32   
gb:AB017066_1513388 Arabidopsis thaliana genomic DNA, chromosome...   140   5e-32   
gb:AP004654_1842725 Oryza sativa (japonica cultivar-group) genom...   138   2e-31   
gb:OSJN00010_1693230 Oryza sativa genomic DNA, chromosome 4, BAC...   137   2e-31   
gb:OSJN00092_1694769 Oryza sativa genomic DNA, chromosome 4, BAC...   128   1e-28   
pir|T01376|T01376 hypothetical protein F3D13.5 - Arabidopsis tha...   110   3e-23   Arabidopsis thaliana [mouse-ear cress]
pir|D85018|D85018 probable hypoersensitive response protein [imp...   110   3e-23   Arabidopsis thaliana [mouse-ear cress]
pir|D84775|D84775 hypothetical protein At2g35980 [imported] - Ar...    79   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB091429_1525042 Nicotiana tabacum mRNA for hin1, complete cd...    77   4e-13   
pir|T03265|T03265 hin1 protein - common tobacco>gb:NTHIN1_169158...    77   4e-13   Nicotiana tabacum [American tobacco]
gb:AB162221_1528622 Capsicum chinense HIN1-Cc mRNA for hin1 like...    76   8e-13   
gb:AB127581_1528337 Nicotiana tabacum hin9 mRNA for harpin induc...    74   3e-12   
gb:AB127582_1528338 Nicotiana tabacum hin18 mRNA for harpin indu...    74   5e-12   
gb:AB005243_1509534 Arabidopsis thaliana genomic DNA, chromosome...    71   3e-11   
gb:AP005873_1859426 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AY155669_1585384 Solanum tuberosum hin1-like protein mRNA, co...    70   6e-11   
gb:AY485992_1608538 Solanum tuberosum hin1-like protein mRNA, pa...    68   2e-10   
pir|D96587|D96587 hypothetical protein F20D21.35 [imported] - Ar...    63   7e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP005314_1850444 Oryza sativa (japonica cultivar-group) genom...    63   9e-09   
gb:AF370332_1792215 Arabidopsis thaliana putative harpin-induced...    62   2e-08   
gb:AB006700_1509901 Arabidopsis thaliana genomic DNA, chromosome...    62   2e-08   
gb:AY086125_1571182 Arabidopsis thaliana clone 21639 mRNA, compl...    60   8e-08   
gb:AE005173_894220 Arabidopsis thaliana chromosome 1, bottom arm...    59   1e-07   
gb:AP004674_1843166 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AF264698_1781871 Arabidopsis thaliana NDR1/HIN1-Like protein ...    58   3e-07   
gb:OSJN00083_1694587 Oryza sativa genomic DNA, chromosome 4, BAC...    57   7e-07   
gb:AY448010S6_1606595 Ipomoea trifida haplotype S1 self-incompat...    57   7e-07   
gb:AF083702_1766933 Arabidopsis thaliana clone sps228 unknown mR...    56   1e-06   
gb:OSJN00092_1694768 Oryza sativa genomic DNA, chromosome 4, BAC...    56   1e-06   
gb:ATAC009918_1543096 Arabidopsis thaliana chromosome III BAC T1...    56   1e-06   
pir|T02662|T02662 hin1 protein homolog - rice>gb:AF039532_176337...    55   2e-06   Oryza sativa [red rice]
gb:AB016877_1512996 Arabidopsis thaliana genomic DNA, chromosome...    55   3e-06   
pir|F85065|F85065 hypothetical protein AT4g05220 [imported] - Ar...    51   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AB083029_1524142 Glycine max mRNA for syringolide-induced pro...    50   8e-05   
pir|H84768|H84768 hypothetical protein At2g35460 [imported] - Ar...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004637_1842395 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
pir|E84668|E84668 hypothetical protein At2g27080 [imported] - Ar...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC136520_1743248 Oryza sativa (japonica cultivar-group) chrom...    47   5e-04   
gb:AP003413_1829097 Oryza sativa (japonica cultivar-group) genom...    47   7e-04   
gb:AY577290_1615974 Petunia integrifolia subsp. inflata clone Pi...    46   9e-04   
gb:AP004139_1838163 Oryza sativa (japonica cultivar-group) genom...    45   0.003   
gb:AC136519_1743240 Oryza sativa (japonica cultivar-group) chrom...    45   0.003   
gb:AP005066_1847477 Oryza sativa (japonica cultivar-group) genom...    44   0.003   
gb:BT002004_1635607 Arabidopsis thaliana non-race specific disea...    43   0.008   
gb:AY735684_1625726 Arabidopsis thaliana hypothetical protein AT...    43   0.008   
gb:AP005829_1858625 Oryza sativa (japonica cultivar-group) genom...    43   0.010   
gb:AY775036_1180011 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    43   0.010   
pir|D96643|D96643 hypothetical protein T13M11.12 [imported] - Ar...    43   0.010   Arabidopsis thaliana [mouse-ear cress]
gb:AP003270_1826851 Oryza sativa (japonica cultivar-group) genom...    42   0.013   
gb:AY059166_1564529 Arabidopsis thaliana At2g01080/F23H14.5 mRNA...    42   0.013   
gb:AC006837_1534625 Arabidopsis thaliana chromosome 2 BAC F23H14...    42   0.013   
gb:AB020744_1514590 Arabidopsis thaliana genomic DNA, chromosome...    42   0.013   
pir|D84420|D84420 hypothetical protein At2g01080 [imported] - Ar...    42   0.013   Arabidopsis thaliana [mouse-ear cress]
pir|T08453|T08453 hypothetical protein F22O6.160 - Arabidopsis t...    42   0.017   Arabidopsis thaliana [mouse-ear cress]
gb:AF325013_1786467 Arabidopsis thaliana At1g17620 (At1g17620/F1...    41   0.037   
gb:AC022492_1539061 Genomic sequence for Arabidopsis thaliana BA...    41   0.037   
gb:AP000410_1820024 Arabidopsis thaliana genomic DNA, chromosome...    40   0.049   
gb:AB026295_1516948 Oryza sativa (japonica cultivar-group) genom...    38   0.24    
pir|H84670|H84670 hypothetical protein At2g27270 [imported] - Ar...    38   0.24    Arabidopsis thaliana [mouse-ear cress]
gb:AP005605_1854747 Oryza sativa (japonica cultivar-group) genom...    37   0.41    
gb:AC092557_1735476 Oryza sativa chromosome 3 BAC OSJNBa0096I06 ...    37   0.41    
gb:AC084110_1733347 Arabidopsis thaliana chromosome 1 BAC F27G20...    37   0.41    
pir|C86447|C86447 F5D14.3 protein - Arabidopsis thaliana>gb:AE00...    37   0.41    Arabidopsis thaliana [mouse-ear cress]
gb:AB020746_1514629 Arabidopsis thaliana genomic DNA, chromosome...    37   0.54    
gb:AY085665_1570733 Arabidopsis thaliana clone 1678 mRNA, comple...    36   1.2     
pir|T47579|T47579 hypothetical protein F24B22.160 - Arabidopsis ...    36   1.2     Arabidopsis thaliana [mouse-ear cress]
pir|A95938|A95938 probable glycosyltransferase protein redB [imp...    35   1.6     Sinorhizobium meliloti
gb:CP000046_90239 Staphylococcus aureus subsp. aureus COL, compl...    35   2.7     
gb:AB033763_5281 Staphylococcus aureus DNA, type-I staphylococcc...    35   2.7     
sp|P80544|PLS_STAAU|PLS_STAAU Surface protein precursor (Plasmin-sensitive...    35   2.7     Staphylococcus aureus
gb:CP000010_864713 Burkholderia mallei ATCC 23344 chromosome 1, ...    34   3.5     
gb:AE017283_432009 Propionibacterium acnes KPA171202, complete g...    34   3.5     
pir|T44601|T44601 probable glycosyltransferase [imported] - Rhiz...    34   3.5     Sinorhizobium meliloti
gb:AP002537_1822503 Oryza sativa (japonica cultivar-group) genom...    34   4.6     
gb:BT012175_1641382 Arabidopsis thaliana At4g26490 gene, complet...    34   4.6     
gb:AJ849884_1284900 Drosophila madeirensis partial CG5961 locus ...    34   4.6     
gb:AJ849866_1284864 Drosophila subobscura partial CG5961 locus a...    34   4.6     
gb:AJ849860_1284852 Drosophila subobscura partial CG5961 locus a...    34   4.6     
gb:AJ849857_1284846 Drosophila subobscura partial CG5961 gene an...    34   4.6     
gb:AJ849856_1284844 Drosophila subobscura partial CG5961 gene an...    34   4.6     
gb:AK048638_1168452 Mus musculus 16 days embryo head cDNA, RIKEN...    34   4.6     
pir|T05055|T05055 hypothetical protein M3E9.80 - Arabidopsis tha...    34   4.6     Arabidopsis thaliana [mouse-ear cress]
gb:AF231125_2060043 Mus musculus paraxial protocadherin (Papc) m...    33   6.0     
gb:BC036025_1981802 Homo sapiens protocadherin 8, transcript var...    33   6.0     
gb:AY013873_1934292 Homo sapiens protocadherin ARCADLIN (PCDH8) ...    33   6.0     
gb:AL139085_1920229 Human DNA sequence from clone RP11-431O22 on...    33   6.0     
gb:AJ849882_1284896 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849881_1284894 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849880_1284892 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849878_1284888 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849876_1284884 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849875_1284882 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849871_1284874 Drosophila subobscura partial CG5961 locus a...    33   6.0     
gb:AJ849870_1284872 Drosophila subobscura partial CG5961 locus a...    33   6.0     
pir|H69086|H69086 ABC transporter - Methanobacterium thermoautot...    33   6.0     Methanothermobacter thermautotrophicus str. Delta H
pir|S24213|S24213 reaction center protein chain M - Rhodobacter ...    33   6.0     Rhodobacter sphaeroides
pir|T50761|T50761 reaction center protein chain M [imported] - R...    33   6.0     Rhodobacter sphaeroides 2.4.1
pir|A03456|WNRFMS reaction center protein chain M - Rhodobacter ...    33   6.0     
sp|P02953|RCEM_RHOSH|RCEM_RHOSH Reaction center protein M chain (Photosynth...    33   6.0     Rhodobacter sphaeroides
sp|O95206|PCH8_HUMAN|PCH8_HUMAN Protocadherin 8 precursor (Arcadlin).>gb:AF...    33   6.0     Homo sapiens [man]
gb:BC053008_2101380 Mus musculus protocadherin 8, mRNA (cDNA clo...    33   7.8     
gb:AB026154_2044404 Rattus norvegicus mRNA for arcadlin, complet...    33   7.8     
gb:SME591791_186568 Sinorhizobium meliloti 1021 complete chromos...    33   7.8     


>gb:BT003850_1636978 Arabidopsis thaliana clone RAFL15-48-D07
           (R20842) putative VAMP protein SEC22 (At3g11660) mRNA,
           complete cds.
          Length = 209

 Score =  221 bits (562), Expect = 2e-56
 Identities = 104/165 (63%), Positives = 129/165 (78%), Gaps = 3/165 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSA--PNILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           WA+LQP KP F+LQDAT++ FNVS   PNIL++  QIT++SRNPN+KIGIYYDRL  +AT
Sbjct: 37  WAILQPSKPRFILQDATVYAFNVSGNPPNILTSNFQITLSSRNPNNKIGIYYDRLDVYAT 96

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
           +R QQIT+ T+IPP YQGHKD ++WSPFVYG  VPIAPF G  L   + +G V LI R D
Sbjct: 97  YRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRAD 156

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           GR+RWKVGT +T +YH+HV CPAYI FG+  +  G++VG NAVKY
Sbjct: 157 GRVRWKVGTFITGKYHLHVKCPAYINFGN--KANGVIVGDNAVKY 199



>gb:ATAC009918_1543097 Arabidopsis thaliana chromosome III BAC
           T19F11 genomic sequence, complete
           sequence.>gb:AY088586_1573603 Arabidopsis thaliana clone
           8166 mRNA, complete sequence.>gb:BT020319_1642714
           Arabidopsis thaliana At3g11660 gene, complete
           cds.>gb:BT020551_1642945 Arabidopsis thaliana At3g11660
           gene, complete cds.>gb:AF264697_1781870 Arabidopsis
           thaliana NDR1/HIN1-Like protein 1 (NHL1) mRNA, complete
           cds.
          Length = 209

 Score =  220 bits (560), Expect = 3e-56
 Identities = 103/165 (62%), Positives = 129/165 (78%), Gaps = 3/165 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSA--PNILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           WA+LQP KP F+LQDAT++ FNVS   PN+L++  QIT++SRNPN+KIGIYYDRL  +AT
Sbjct: 37  WAILQPSKPRFILQDATVYAFNVSGNPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYAT 96

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
           +R QQIT+ T+IPP YQGHKD ++WSPFVYG  VPIAPF G  L   + +G V LI R D
Sbjct: 97  YRSQQITFPTSIPPTYQGHKDVDIWSPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRAD 156

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           GR+RWKVGT +T +YH+HV CPAYI FG+  +  G++VG NAVKY
Sbjct: 157 GRVRWKVGTFITGKYHLHVKCPAYINFGN--KANGVIVGDNAVKY 199



>pir|B84775|B84775 probable harpin-induced protein [imported] -
           Arabidopsis thaliana>gb:AC007017_1534957 Arabidopsis
           thaliana chromosome 2 clone F11F19 map g6825, complete
           sequence.>gb:AY085897_1570960 Arabidopsis thaliana clone
           19481 mRNA, complete sequence.>gb:AK175879_1817867
           Arabidopsis thaliana mRNA for putative harpin-induced
           protein, complete cds, clone: RAFL22-51-L02.
          Length = 210

 Score =  209 bits (531), Expect = 8e-53
 Identities = 100/163 (61%), Positives = 120/163 (73%), Gaps = 1/163 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W +LQP KP F+LQDAT++ FN+S PN+L++  QIT+ SRN N +IGIYYDRL  +AT+R
Sbjct: 40  WIILQPTKPRFILQDATVYAFNLSQPNLLTSNFQITIASRNRNSRIGIYYDRLHVYATYR 99

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            QQIT  TAIPP YQGHK+ NVWSPFVYGN VPIAPF    L   Q  G V LI R DGR
Sbjct: 100 NQQITLRTAIPPTYQGHKEDNVWSPFVYGNSVPIAPFNAVALGDEQNRGFVTLIIRADGR 159

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           +RWKVGTL+T +YH+HV C A+I   D  +  G+ VG NAVKY
Sbjct: 160 VRWKVGTLITGKYHLHVRCQAFINLAD--KAAGVHVGENAVKY 200



>pir|T08452|T08452 hypothetical protein F22O6.150 - Arabidopsis
           thaliana>gb:ATF22O6_1549704 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F22O6.>gb:AY080785_1568488
           Arabidopsis thaliana unknown protein (At3g52470) mRNA,
           complete cds.>gb:AY088695_1573710 Arabidopsis thaliana
           clone 92178 mRNA, complete sequence.>gb:AY114041_1578452
           Arabidopsis thaliana unknown protein (At3g52470) mRNA,
           complete cds.
          Length = 208

 Score =  199 bits (507), Expect = 5e-50
 Identities = 94/163 (57%), Positives = 119/163 (73%), Gaps = 1/163 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W +L+P KP F+LQDAT++ FN+S PN+L++  Q+T+ SRNPN KIGIYYDRL  +AT+ 
Sbjct: 38  WVILRPTKPRFVLQDATVYAFNLSQPNLLTSNFQVTIASRNPNSKIGIYYDRLHVYATYM 97

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            QQIT  TAIPP YQGHK+ NVWSPFVYG  VPIAP+    L   +  G V L+ R DG 
Sbjct: 98  NQQITLRTAIPPTYQGHKEVNVWSPFVYGTAVPIAPYNSVALGEEKDRGFVGLMIRADGT 157

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           +RWKV TL+T +YHIHV C A+I  G+  +  G++VG NAVKY
Sbjct: 158 VRWKVRTLITGKYHIHVRCQAFINLGN--KAAGVLVGDNAVKY 198



>pir|T49138|T49138 hypothetical protein T10D17.10 - Arabidopsis
           thaliana>gb:ATT10D17_1554213 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T10D17.>gb:BT014806_1641796
           Arabidopsis thaliana At3g44220 gene, complete
           cds.>gb:BT015025_1641995 Arabidopsis thaliana At3g44220
           mRNA, complete cds.
          Length = 206

 Score =  189 bits (479), Expect = 8e-47
 Identities = 90/168 (53%), Positives = 115/168 (68%), Gaps = 5/168 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           WA+L P  P F+LQDATI+ FNVS PN L++ +Q+T++SRNPNDKIGI+YDRL  +A++R
Sbjct: 39  WAILHPHGPRFVLQDATIYAFNVSQPNYLTSNLQVTLSSRNPNDKIGIFYDRLDIYASYR 98

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            QQ+T +T +P  YQGH D  +WSPF+YG  VP+AP+F P LS     G V L  ++DG 
Sbjct: 99  NQQVTLATLLPATYQGHLDVTIWSPFLYGTTVPVAPYFSPALSQDLTAGMVLLNIKIDGW 158

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPF-----GDTPRPGGIVVGNAVKYQ 663
           +RWKVGT V+ RY +HV CPAYI       GD P         AVKYQ
Sbjct: 159 VRWKVGTWVSGRYRLHVNCPAYITLAGHFSGDGP---------AVKYQ 197



>gb:AB006700_1509902 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHF15.>gb:BT010935_1640881 Arabidopsis thaliana
           At5g06330 gene, complete cds.>gb:BT011644_1641166
           Arabidopsis thaliana At5g06330 mRNA, complete cds.
          Length = 207

 Score =  188 bits (477), Expect = 1e-46
 Identities = 87/159 (54%), Positives = 114/159 (71%), Gaps = 2/159 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSA--PNILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           WA+LQP KP F+LQDAT+FNFNVS   PN+L++  Q T++SRNPNDKIGIYYDRL  +A+
Sbjct: 39  WAILQPSKPRFVLQDATVFNFNVSGNPPNLLTSNFQFTLSSRNPNDKIGIYYDRLDVYAS 98

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
           +R QQIT  + +   YQGHK+ NVWSPFV G  VP+AP+    L    + G + L+  LD
Sbjct: 99  YRSQQITLPSPMLTTYQGHKEVNVWSPFVGGYSVPVAPYNAFYLDQDHSSGAIMLMLHLD 158

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG 645
           GR+RWKVG+ +T +YH+HV C A I FG +    G++VG
Sbjct: 159 GRVRWKVGSFITGKYHLHVRCHALINFGSS--AAGVIVG 195



>pir|C84775|C84775 probable harpin-induced protein [imported] -
           Arabidopsis thaliana>gb:AC007017_1534956 Arabidopsis
           thaliana chromosome 2 clone F11F19 map g6825, complete
           sequence.
          Length = 211

 Score =  177 bits (449), Expect = 3e-43
 Identities = 85/161 (52%), Positives = 109/161 (67%), Gaps = 1/161 (0%)
 Frame = +1

Query: 181 VLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQ 360
           +LQPKKP F+LQD T++ FN+S PN+L++  QIT+ SRN N  IGIYYD L  +A++R Q
Sbjct: 43  ILQPKKPEFILQDTTVYAFNLSQPNLLTSKFQITIASRNRNSNIGIYYDHLHAYASYRNQ 102

Query: 361 QITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGRIR 540
           QIT ++ +PP YQ HK+ +VWSP +YGN VPIAPF    L   Q  G   L   +DGR+R
Sbjct: 103 QITLASDLPPTYQRHKENSVWSPLLYGNQVPIAPFNAVALGDEQNSGVFTLTICVDGRVR 162

Query: 541 WKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           WKVGTL    YH+HV C A+I   D  +  G+ VG N VKY
Sbjct: 163 WKVGTLTIGNYHLHVRCQAFINQAD--KAAGVHVGENTVKY 201



>pir|A85098|A85098 hypothetical protein AT4g09590 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV27_1544673 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           27.>gb:ATT25P22_1555463 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T25P22 (ESSA project).
          Length = 211

 Score =  177 bits (448), Expect = 3e-43
 Identities = 84/163 (51%), Positives = 109/163 (66%), Gaps = 1/163 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W +LQPK P F+LQD T++ FN+S PN+L++  QIT+ SRN N  IGIYYD L  +A++R
Sbjct: 41  WIILQPKNPEFILQDTTVYAFNLSQPNLLTSKFQITIASRNRNSNIGIYYDHLHAYASYR 100

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            QQIT ++ +PP YQ HK+ +VWSP +YGN VPIAPF    L   Q  G   L   +DG+
Sbjct: 101 NQQITLASDLPPTYQRHKEDSVWSPLLYGNQVPIAPFNAVALGDEQNSGVFTLTICVDGQ 160

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVG-NAVKY 660
           +RWKVGTL    YH+HV C A+I   D  +  G+ VG N VKY
Sbjct: 161 VRWKVGTLTIGNYHLHVRCQAFINQAD--KAAGVHVGENTVKY 201



>gb:ATT6G21_1556332 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T6G21 (ESSA project).
          Length = 210

 Score =  168 bits (426), Expect = 1e-40
 Identities = 81/163 (49%), Positives = 110/163 (67%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           WA+L P  P F+LQD TI +FNVS PN LS+ +Q+TV+SRNPNDKIGI+YDRL  + T+R
Sbjct: 43  WAILHPHGPRFVLQDVTINDFNVSQPNFLSSNLQVTVSSRNPNDKIGIFYDRLDIYVTYR 102

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            Q++T +  +P  YQGH +  VWSPF+ G+ VP+AP+    L+     G V L  ++DG 
Sbjct: 103 NQEVTLARLLPSTYQGHLEVTVWSPFLIGSAVPVAPYLSSALNEDLFAGLVLLNIKIDGW 162

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVGNAVKYQ 663
           +RWKVG+ V+  Y +HV CPA+I    T +  G   G A+KYQ
Sbjct: 163 VRWKVGSWVSGSYRLHVNCPAFITV--TGKLTG--TGPAIKYQ 201



>gb:AP004753_1844431 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0508B05.>gb:AP005609_1854844 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0014M17.
          Length = 224

 Score =  141 bits (355), Expect = 2e-32
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 4/157 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           +  L+P KP+F LQD  + + ++  P+ LSAT Q+T+ SRNPND +G++Y RL  F T+R
Sbjct: 39  YLALRPSKPSFYLQDLQLRSVDLGDPS-LSATAQVTLASRNPNDHVGVHYRRLDVFVTYR 97

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            + +T   ++PP YQGH+D  +WSP + G  VP+A F    L    A G V L  ++DGR
Sbjct: 98  DEPVTVPVSLPPTYQGHRDVTIWSPVLSGESVPVAGFVADALRQDVAAGYVALQVKVDGR 157

Query: 535 IRWKVGTLVTSRYHIHVTCPAYI----PFGDTPRPGG 633
           ++WKVG+ V+  YH+ V+CPA +    P G  P P G
Sbjct: 158 VKWKVGSWVSGSYHLFVSCPAMLASAGPGGVGPMPLG 194



>gb:AB017066_1513388 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MGN6.>gb:BT010854_1640800 Arabidopsis thaliana
           At5g53730 mRNA, complete cds.>gb:BT011320_1641070
           Arabidopsis thaliana At5g53730 gene, complete cds.
          Length = 213

 Score =  140 bits (352), Expect = 5e-32
 Identities = 59/148 (39%), Positives = 103/148 (69%), Gaps = 2/148 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNV--SAPNILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           W +L P++P F L +A I++ N+  S+ ++L++++Q+T+ S+NPN K+GIYYD+L  +A 
Sbjct: 46  WLILHPERPEFSLTEADIYSLNLTTSSTHLLNSSVQLTLFSKNPNKKVGIYYDKLLVYAA 105

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
           +RGQQIT   ++PP YQ H++ N+ + F+ G ++P+A  FG  +S  ++ G + +  ++D
Sbjct: 106 YRGQQITSEASLPPFYQSHEEINLLTAFLQGTELPVAQSFGYQISRERSTGKIIIGMKMD 165

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFG 612
           G++RWK+GT V+  Y  +V C A + FG
Sbjct: 166 GKLRWKIGTWVSGAYRFNVNCLAIVAFG 193



>gb:AP004654_1842725 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0015C07.
          Length = 227

 Score =  138 bits (347), Expect = 2e-31
 Identities = 65/180 (36%), Positives = 98/180 (54%), Gaps = 13/180 (7%)
 Frame = +1

Query: 115 QCCAGXXXXXXXXXXXXXXXWAVLQPKKPTFLLQDATIFNFNVSAP-------------N 255
           +CCA                W +L+P KP F L D T+   NV+               +
Sbjct: 20  RCCAAIFGILLLLLLIVLIVWLILRPTKPRFYLNDLTVVCLNVTTGGSYAGATASSGYFS 79

Query: 256 ILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFV 435
            L+ T+Q T+ +RN N+++GIYYDR   +A ++G +IT  T++PPVYQGH D  VWSPF+
Sbjct: 80  FLTVTMQTTLAARNGNERVGIYYDRADVYAEYKGLRITVPTSLPPVYQGHPDLTVWSPFL 139

Query: 436 YGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGRIRWKVGTLVTSRYHIHVTCPAYIPFGD 615
            GN+V + P+    ++  +  G + +  R+DG IR+K G  +T  YH+ V CPA +   D
Sbjct: 140 SGNNVQLPPYLAVSITQDETAGYLLVTIRVDGWIRYKAGAFITGHYHLRVRCPALLIVND 199



>gb:OSJN00010_1693230 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991214_12, complete
           sequence.>gb:OSJN00036_1693688 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0033G16, complete
           sequence.
          Length = 220

 Score =  137 bits (346), Expect = 2e-31
 Identities = 68/168 (40%), Positives = 98/168 (58%), Gaps = 9/168 (5%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           +  + P KP+F LQD  + N ++S P I S  +Q+T+ SRNPND++G+YY  L  F T+R
Sbjct: 38  YLAIHPSKPSFYLQDVQLRNIDLSDPAI-SLNLQVTIASRNPNDRVGVYYKTLHVFTTYR 96

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            + IT    +P +YQGHKD +VWSP + G  VP+  +    +    A G V L  ++DGR
Sbjct: 97  EEPITVPVELPAIYQGHKDVSVWSPVMSGESVPVGQYVADAMRQDIAAGYVLLHVKVDGR 156

Query: 535 IRWKVGTLVTSRYHIHVTCPAYI---------PFGDTPRPGGIVVGNA 651
           ++WKVG+ V+  YH+ VTCPA +          F  +   GG   GNA
Sbjct: 157 VKWKVGSWVSGGYHLFVTCPALLAASGGNVGGAFAMSATAGGGAGGNA 204



>gb:OSJN00092_1694769 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088H09, complete sequence.
          Length = 220

 Score =  128 bits (322), Expect = 1e-28
 Identities = 65/165 (39%), Positives = 93/165 (56%), Gaps = 3/165 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN--ILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           W  L+P KP F LQD ++   NV+ P    L  T+Q TV +RN N ++G+YYD++  +A 
Sbjct: 43  WLALRPHKPRFYLQDLSVLCLNVTPPASAYLFTTMQATVAARNDNGRVGVYYDKVDVYAQ 102

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGND-VPIAPFFGPMLSAAQADGGVWLIFRL 525
           ++   IT  T +P  YQGH D++VWSPF+   D V + P     L+  +  G V +  RL
Sbjct: 103 YKDVAITVPTRLPVEYQGHYDQSVWSPFLQSLDHVVLPPNLAVALAQDETAGYVLVDIRL 162

Query: 526 DGRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGGIVVGNAVKY 660
           DG +RWKVGT ++  YH+ V CPA +   D     G+  G    Y
Sbjct: 163 DGWVRWKVGTWISGHYHLRVNCPALLTVNDGKGSYGVNYGGGDGY 207



>pir|T01376|T01376 hypothetical protein F3D13.5 - Arabidopsis
           thaliana>gb:F3D13_1678222 Arabidopsis thaliana BAC
           F3D13.
          Length = 202

 Score =  110 bits (276), Expect = 3e-23
 Identities = 51/145 (35%), Positives = 84/145 (57%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W V +P KP   +  A I++ N +AP ++S ++Q +V +RNPN ++ I+YD+L  + T++
Sbjct: 38  WLVYRPHKPRLTVVGAAIYDLNFTAPPLISTSVQFSVLARNPNRRVSIHYDKLSMYVTYK 97

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            Q IT    +PP+  GHK   V +P + GN +P++P     L   +A G V +   + GR
Sbjct: 98  DQIITPPLPLPPLRLGHKSTVVIAPVMGGNGIPVSPEVANGLKNDEAYGVVLMRVVIFGR 157

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPF 609
           +RWK G + T RY  +  C  ++ F
Sbjct: 158 LRWKAGAIKTGRYGFYARCDVWLRF 182



>pir|D85018|D85018 probable hypoersensitive response protein
           [imported] - Arabidopsis thaliana>gb:ATCHRIV3_1544827
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 3.>gb:AY086897_1571937 Arabidopsis thaliana clone
           29200 mRNA, complete sequence.>gb:BT006216_1639108
           Arabidopsis thaliana At4g01410 gene, complete
           cds.>gb:AK118416_1816394 Arabidopsis thaliana At4g01410
           mRNA for putative hypoersensitive response protein,
           complete cds, clone: RAFL19-67-B11.
          Length = 227

 Score =  110 bits (276), Expect = 3e-23
 Identities = 51/145 (35%), Positives = 84/145 (57%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W V +P KP   +  A I++ N +AP ++S ++Q +V +RNPN ++ I+YD+L  + T++
Sbjct: 63  WLVYRPHKPRLTVVGAAIYDLNFTAPPLISTSVQFSVLARNPNRRVSIHYDKLSMYVTYK 122

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            Q IT    +PP+  GHK   V +P + GN +P++P     L   +A G V +   + GR
Sbjct: 123 DQIITPPLPLPPLRLGHKSTVVIAPVMGGNGIPVSPEVANGLKNDEAYGVVLMRVVIFGR 182

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPF 609
           +RWK G + T RY  +  C  ++ F
Sbjct: 183 LRWKAGAIKTGRYGFYARCDVWLRF 207



>pir|D84775|D84775 hypothetical protein At2g35980 [imported] -
           Arabidopsis thaliana>gb:AB047812_1520672 Arabidopsis
           thaliana YLS9 mRNA for hin1 homolog, complete
           cds.>gb:AC007017_1534955 Arabidopsis thaliana chromosome
           2 clone F11F19 map g6825, complete
           sequence.>gb:AY086633_1571678 Arabidopsis thaliana clone
           26418 mRNA, complete sequence.>gb:BT002875_1636466
           Arabidopsis thaliana clone RAFL14-86-K03 (R20397)
           putative harpin-induced protein hin1 (At2g35980) mRNA,
           complete cds.>gb:BT004400_1637472 Arabidopsis thaliana
           clone U20397 putative harpin-induced protein hin1
           (At2g35980) mRNA, complete cds.
          Length = 227

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 50/143 (34%), Positives = 79/143 (55%), Gaps = 4/143 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAP-NILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W +++P+   F + DA++  F+ ++P NIL   + +TV  RNPN +IG+YYDR+   A +
Sbjct: 60  WLIVRPRAIKFHVTDASLTRFDHTSPDNILRYNLALTVPVRNPNKRIGLYYDRIEAHAYY 119

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLI---FR 522
            G++ +  T + P YQGHK+  V +P   G ++ I          A+   GV+ I   FR
Sbjct: 120 EGKRFSTIT-LTPFYQGHKNTTVLTPTFQGQNLVIFNAGQSRTLNAERISGVYNIEIKFR 178

Query: 523 LDGRIRWKVGTLVTSRYHIHVTC 591
           L  R+R+K+G L   R    V C
Sbjct: 179 L--RVRFKLGDLKFRRIKPKVDC 199



>gb:AB091429_1525042 Nicotiana tabacum mRNA for hin1, complete
           cds.>gb:AF212183_1777426 Nicotiana tabacum harpin
           inducing protein (hin1) gene, complete cds.
          Length = 229

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S  N  +   + + +T RNPN +IGIYYD +   A +
Sbjct: 64  WLVLRPNKVKFYVTDATLTQFDLSTTNNTIFYDLALNMTIRNPNKRIGIYYDSIEARALY 123

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW-LIFRLD 528
           +G++   ST + P YQGHK+ +   P   G  + +           + + GV+ +  +L 
Sbjct: 124 QGERFD-STNLEPFYQGHKNTSSLRPVFKGQSLVLLGDREKSNYNNEKNLGVYEMEVKLY 182

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR KVG + T +    + C   +P G   R
Sbjct: 183 MRIRLKVGWIKTHKIKPKIECDFKVPLGSNGR 214



>pir|T03265|T03265 hin1 protein - common tobacco>gb:NTHIN1_1691580
           N.tabacum mRNA for hin1 gene.
          Length = 221

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S  N  +   + + +T RNPN +IGIYYD +   A +
Sbjct: 56  WLVLRPNKVKFYVTDATLTQFDLSTTNNTIFYDLALNMTIRNPNKRIGIYYDSIEARALY 115

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW-LIFRLD 528
           +G++   ST + P YQGHK+ +   P   G  + +           + + GV+ +  +L 
Sbjct: 116 QGERFD-STNLEPFYQGHKNTSSLRPVFKGQSLVLLGDREKSNYNNEKNLGVYEMEVKLY 174

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR KVG + T +    + C   +P G   R
Sbjct: 175 MRIRLKVGWIKTHKIKPKIECDFKVPLGSNGR 206



>gb:AB162221_1528622 Capsicum chinense HIN1-Cc mRNA for hin1 like
           protein, complete cds.
          Length = 228

 Score = 76.3 bits (186), Expect = 8e-13
 Identities = 48/152 (31%), Positives = 77/152 (50%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVS-APNILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S A N L   + + +T RNPN +IGIYYD +     +
Sbjct: 64  WLVLRPNKVKFYVTDATLTQFDLSTANNTLYYDLALNMTIRNPNKRIGIYYDSIEARGMY 123

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLI-FRLD 528
           +G++   S  + P YQGHK+ +   P + G  + +           + + GV+ I  +L 
Sbjct: 124 KGERFA-SQNLEPFYQGHKNTSSLHPVLKGQSLVLLGDREKSNYNNEKNSGVYDIEMKLY 182

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR K+G + T +    + C   +P     R
Sbjct: 183 MRIRLKIGWIKTHKIKPKIECDIKVPLESNGR 214



>gb:AB127581_1528337 Nicotiana tabacum hin9 mRNA for harpin inducing
           protein 9, complete cds.
          Length = 229

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S  N  ++  + + +T RNPN +IGIYYD +   A +
Sbjct: 64  WLVLRPNKVKFYVTDATLTQFDLSTTNNTINYDLALNMTIRNPNKRIGIYYDSIEARAMY 123

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW-LIFRLD 528
           +G++   S  + P YQGHK+ +   P   G  + +           + + GV+ +  +L 
Sbjct: 124 QGERFA-SQNLEPFYQGHKNTSSLHPVFKGQSLVLLGDREKTNYNNEKNAGVYEMEVKLS 182

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR K G + T +    + C   +P     R
Sbjct: 183 MRIRLKFGWIKTRKIKPKIECDFKVPLESNGR 214



>gb:AB127582_1528338 Nicotiana tabacum hin18 mRNA for harpin
           inducing protein 18, complete cds.
          Length = 229

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 47/152 (30%), Positives = 77/152 (50%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVS-APNILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S   N +   + + +T RNPN +IGIYYD +   A +
Sbjct: 64  WLVLRPNKVKFYVTDATLTQFDLSNTNNTIFYDLALNMTIRNPNKRIGIYYDSIEARAMY 123

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW-LIFRLD 528
           +G++  +ST + P YQGHK+ +   P   G  + +           + + GV+ +  +L 
Sbjct: 124 QGERF-HSTNLKPFYQGHKNTSSLHPVFKGQSLVLLGDREKSNYNNEKNLGVYEMEVKLY 182

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR K G + T +    + C   +P     R
Sbjct: 183 MRIRLKAGWIKTHKIKPKIECDFKVPLESNGR 214



>gb:AB005243_1509534 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRN17.
          Length = 207

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 38/139 (27%), Positives = 70/139 (50%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W   +PKK  + +++A++ NFN++  N +SAT Q T+ S NPN +I +YY  +  F  F+
Sbjct: 48  WLETKPKKLRYTVENASVQNFNLTNDNHMSATFQFTIQSHNPNHRISVYYSSVEIFVKFK 107

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            Q + + T + P +Q   +       +   +V ++   G  L +  + G +     +  R
Sbjct: 108 DQTLAFDT-VEPFHQPRMNVKQIDETLIAENVAVSKSNGKDLRSQNSLGKIGFEVFVKAR 166

Query: 535 IRWKVGTLVTSRYHIHVTC 591
           +R+KVG   +S     + C
Sbjct: 167 VRFKVGIWKSSHRTAKIKC 185



>gb:AP005873_1859426 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:B1370C05.>gb:AP006851_1863108 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2,
           fosmid clone:OSJNOa183H18.
          Length = 214

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 48/151 (31%), Positives = 70/151 (46%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W VL+P  P F L  AT    N SA  +    I     +RNPN    + YDRL   A++ 
Sbjct: 52  WLVLRPSPPRFSLLAATT-TANDSASVV---AINAAFAARNPNSHTAVLYDRLQASASYA 107

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           G  +T  + + P +   + +        G+ +  A    P  +AA A G   L  R++G+
Sbjct: 108 GLPLTAPSPLIPPFLPQQGQ--------GDAMLSASLTSPPAAAAVAGGRALLRLRVEGQ 159

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGDTPRP 627
           +RWKV   VT R+ + V C A +    TP P
Sbjct: 160 LRWKVAAWVTGRHALTVDCIAVVELQPTPTP 190



>gb:AY155669_1585384 Solanum tuberosum hin1-like protein mRNA,
           complete cds.
          Length = 225

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 45/152 (29%), Positives = 75/152 (49%), Gaps = 2/152 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F+ S  N  L   + + +T RNPN +IGIYYD +     +
Sbjct: 62  WLVLRPNKVNFYVTDATLTQFDYSTTNNTLYYDLALNMTIRNPNKRIGIYYDSIEARGMY 121

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW-LIFRLD 528
           +GQ+   S  +   YQGHK+ +   P   G ++ +           + + G++ +  +L 
Sbjct: 122 QGQRFA-SQNLERFYQGHKNTSYLHPVFKGQNLVLLGDREKTNYNNEKNLGIYEMEMKLY 180

Query: 529 GRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
            RIR K+G + T +    + C   +P   + R
Sbjct: 181 MRIRLKIGWIKTHKIKPRIECDFKVPLESSGR 212



>gb:AY485992_1608538 Solanum tuberosum hin1-like protein mRNA,
           partial cds.
          Length = 187

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 36/93 (38%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVS-APNILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W VL+P K  F + DAT+  F++S A N L   + + +T RNPN ++GIYYD +   A +
Sbjct: 64  WLVLRPNKVKFYVTDATLTQFDLSTANNTLYYDLALNMTIRNPNKRVGIYYDSIEARAMY 123

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDV 450
           +GQ+   S  + P YQGHK+ +   P   G  +
Sbjct: 124 QGQRFA-SHNLEPFYQGHKNTSNLHPVFKGQSL 155



>pir|D96587|D96587 hypothetical protein F20D21.35 [imported] -
           Arabidopsis thaliana>gb:AE005173_893352 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005287_1532408 Arabidopsis thaliana
           chromosome I BAC F20D21 genomic sequence, complete
           sequence.>gb:AY600530_1617292 Arabidopsis thaliana
           hypothetical protein (At1g54540) mRNA, complete
           cds.>gb:AY649288_1620088 Arabidopsis thaliana
           hypothetical protein (At1g54540) gene, complete cds.
          Length = 239

 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 45/144 (31%), Positives = 67/144 (46%), Gaps = 7/144 (4%)
 Frame = +1

Query: 181 VLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQ 360
           V  PK P++ +    + N  ++    LSA  ++ +T+RNPN+KIGIYY++ G    +  +
Sbjct: 78  VFHPKLPSYEVNSLRVTNLGINLDLSLSAEFKVEITARNPNEKIGIYYEKGGHIGVWYDK 137

Query: 361 QITYSTAIPPVYQGHKDRNVWSPFV-------YGNDVPIAPFFGPMLSAAQADGGVWLIF 519
                  IP  YQGH  RNV    V       YGN V  A      L   Q  G V L  
Sbjct: 138 TKLCEGPIPRFYQGH--RNVTKLNVALTGRAQYGNTVLAA------LQQQQQTGRVPLDL 189

Query: 520 RLDGRIRWKVGTLVTSRYHIHVTC 591
           +++  +  K+G L   +  I  +C
Sbjct: 190 KVNAPVAIKLGNLKMKKIRILGSC 213



>gb:AP005314_1850444 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0515E01.>gb:AP005567_1854166 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1254_E07.
          Length = 218

 Score = 62.8 bits (151), Expect = 9e-09
 Identities = 38/143 (26%), Positives = 71/143 (49%), Gaps = 4/143 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNV----SAPNILSATIQITVTSRNPNDKIGIYYDRLGTF 342
           + V +P  P   +  A ++   +    S+ + L+A++Q T+   NP+D+  + YD L  +
Sbjct: 43  YLVYRPVMPQASVPRAAVYRLALANASSSAHALAASVQFTLVLHNPSDRASLLYDGLVAY 102

Query: 343 ATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFR 522
           A++RG+ +     +PPV Q        SP + G  VP++P     L+A  A   V L   
Sbjct: 103 ASYRGEPVMPPAPLPPVAQDRGADVAMSPLLGGAAVPVSPDAARALAADCAARRVQLRLV 162

Query: 523 LDGRIRWKVGTLVTSRYHIHVTC 591
           + GR++++ G   +    ++V C
Sbjct: 163 VMGRVKYRSGPFRSGWRDLYVRC 185



>gb:AF370332_1792215 Arabidopsis thaliana putative harpin-induced
           protein (At5g06320) mRNA, partial cds.
          Length = 223

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 4/156 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W + +P    F + DA +  F +   N L   + +  T RNPN +IG+YYD +     + 
Sbjct: 59  WLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYDEIEVRGYYG 118

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG- 531
            Q+   S  I   YQGHK+  V    + G  + +    G        D     I+R+D  
Sbjct: 119 DQRFGMSNNISKFYQGHKNTTVVGTKLVGQQLVLLD--GGERKDLNEDVNS-QIYRIDAK 175

Query: 532 ---RIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPG 630
              +IR+K G + + R+   + C   +P       G
Sbjct: 176 LRLKIRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSG 211



>gb:AB006700_1509901 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MHF15.>gb:BT000871_1635126 Arabidopsis thaliana
           clone C104930 putative harpin-induced protein
           (At5g06320) mRNA, complete cds.
          Length = 231

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 4/156 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W + +P    F + DA +  F +   N L   + +  T RNPN +IG+YYD +     + 
Sbjct: 67  WLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYDEIEVRGYYG 126

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG- 531
            Q+   S  I   YQGHK+  V    + G  + +    G        D     I+R+D  
Sbjct: 127 DQRFGMSNNISKFYQGHKNTTVVGTKLVGQQLVLLD--GGERKDLNEDVNS-QIYRIDAK 183

Query: 532 ---RIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPG 630
              +IR+K G + + R+   + C   +P       G
Sbjct: 184 LRLKIRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSG 219



>gb:AY086125_1571182 Arabidopsis thaliana clone 21639 mRNA, complete
           sequence.
          Length = 252

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/143 (23%), Positives = 65/143 (45%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + V +PK P + +    +  F ++  + L+    +T+T++NPN+KIGIYY+       + 
Sbjct: 88  YLVFKPKLPDYSIDRLQLTRFALNQDSSLTTAFNVTITAKNPNEKIGIYYEDGSKITVWY 147

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            +    + ++P  YQGH++  V    + G     +     +    Q  G + L  R++  
Sbjct: 148 MEHQLSNGSLPKFYQGHENTTVIYVEMTGQTQNASGLRTTLEEQQQRTGNIPLRIRVNQP 207

Query: 535 IRWKVGTLVTSRYHIHVTCPAYI 603
           +R K G L        V C  ++
Sbjct: 208 VRVKFGKLKLFEVRFLVRCGVFV 230



>gb:AE005173_894220 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007234_1535634 Genomic sequence
           for Arabidopsis thaliana BAC F1E22, complete sequence.
          Length = 260

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 36/151 (23%), Positives = 67/151 (44%), Gaps = 8/151 (5%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + V +PK P + +    +  F ++  + L+    +T+T++NPN+KIGIYY+       + 
Sbjct: 88  YLVFKPKLPDYSIDRLQLTRFALNQDSSLTTAFNVTITAKNPNEKIGIYYEDGSKITVWY 147

Query: 355 GQQ--------ITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW 510
            +         + YS ++P  YQGH++  V    + G     +     +    Q  G + 
Sbjct: 148 MEHQLSNGTSLLVYSGSLPKFYQGHENTTVIYVEMTGQTQNASGLRTTLEEQQQRTGNIP 207

Query: 511 LIFRLDGRIRWKVGTLVTSRYHIHVTCPAYI 603
           L  R++  +R K G L        V C  ++
Sbjct: 208 LRIRVNQPVRVKFGKLKLFEVRFLVRCGVFV 238



>gb:AP004674_1843166 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0681F05.
          Length = 200

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 41/140 (29%), Positives = 61/140 (43%), Gaps = 1/140 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W  L+P +P F L D TI N N  +   ++  ++ TV  RNPN KIGI+Y  +     + 
Sbjct: 40  WLSLRPHRPRFFLDDFTIPNLNRQS-GAVNLPVRFTVDERNPNQKIGIHYGTIFGSVYYN 98

Query: 355 GQQITYSTAIPPVYQGHK-DRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG 531
              +     + P YQ  K D  +          P  P +      A A G V L   L+ 
Sbjct: 99  DLLVASGPVVQPFYQQPKGDTPLAGELTASGPTPGDPAWQRFAGDAAA-GSVALRLLLNS 157

Query: 532 RIRWKVGTLVTSRYHIHVTC 591
            +R++V    T  +H+ V C
Sbjct: 158 TVRFQVQMWDTREHHMKVDC 177



>gb:AF264698_1781871 Arabidopsis thaliana NDR1/HIN1-Like protein 2
           (NHL2) mRNA, complete cds.
          Length = 240

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 34/125 (27%), Positives = 58/125 (46%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W + +P    F + DA +  F+    N L  ++ +  T RNPN ++G+YYD   + + + 
Sbjct: 74  WLIFRPNAVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVGVYYDEF-SVSGYY 132

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           G Q   S  +   YQGHK+  V    + G ++ +    G        D     I+R+D +
Sbjct: 133 GDQRFGSANVSSFYQGHKNTTVILTKIEGQNLVV---LGDGARTDLKDDEKSGIYRIDAK 189

Query: 535 IRWKV 549
           +R  V
Sbjct: 190 LRLSV 194



>gb:OSJN00083_1694587 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064G10, complete sequence.
          Length = 255

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNI-LSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           +AV +PK P F +   T+  F+V+A    +S   ++ VTS NPN +IGIYYD     A+F
Sbjct: 92  YAVFKPKIPDFHVDRLTVTRFDVNATAATVSDAFEVEVTSTNPNRRIGIYYDGGEVTASF 151

Query: 352 RGQQITYSTAIPPVYQGHK 408
            G ++      P +YQGH+
Sbjct: 152 NGTELCRG-GFPALYQGHR 169



>gb:AY448010S6_1606595 Ipomoea trifida haplotype S1
           self-incompatibility (S-) locus, contig SR6.
          Length = 181

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 32/126 (25%), Positives = 61/126 (48%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W V++P++  + +++ATI N+ +++ N L+AT   T+ + NPN    +YYD +     F 
Sbjct: 41  WLVIRPRRLVYAVENATIQNYTLTSNNRLTATFNFTLEAFNPNTHAAVYYDAIEA-QLFY 99

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
             Q+       P +Q  ++       +   DV ++          + +G V L  R+  +
Sbjct: 100 DDQLIADHGAEPFFQPRQNVTHLDLSLPAKDVAVSANVARDFKVERTNGNVELELRVYSK 159

Query: 535 IRWKVG 552
           +R KVG
Sbjct: 160 VRLKVG 165



>gb:AF083702_1766933 Arabidopsis thaliana clone sps228 unknown
           mRNA.>gb:AF264699_1781872 Arabidopsis thaliana
           NDR1/HIN1-like protein 3 (NHL3) mRNA, complete cds.
          Length = 230

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 40/156 (25%), Positives = 66/156 (42%), Gaps = 4/156 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W + +P    F + DA +  F +   N L   + +  T RNPN +IG+YY+ +     + 
Sbjct: 67  WLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYE-IEVRGYYG 125

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG- 531
            Q+   S  I   YQGHK+  V    + G  + +    G        D     I+R+D  
Sbjct: 126 DQRFGMSNNISKFYQGHKNTTVVGTKLVGQQLVLLD--GGERKDLNEDVNS-QIYRIDAK 182

Query: 532 ---RIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPG 630
              +IR+K G + + R+   + C   +P       G
Sbjct: 183 LRLKIRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSG 218



>gb:OSJN00092_1694768 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088H09, complete sequence.
          Length = 205

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/144 (22%), Positives = 63/144 (43%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + + +P      +  A +  F +S  + L+ ++ + +T RNPN ++G+YYD + + A F 
Sbjct: 45  YLIFRPHMIAATVDSAALTQFTLSTNSALAYSLTVDLTVRNPNKRVGLYYDNVESLALFD 104

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           GQ+  Y+  +   YQ  +     SP   G              + Q  G   +  +L+ +
Sbjct: 105 GQRFGYA-PLDSFYQSTEASTKLSPAFKGQQPLQGDITAANFRSQQTAGKFDIEVKLNAK 163

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIP 606
           +R KV           ++CP  +P
Sbjct: 164 LRVKVWAFKVPGPKAKISCPITVP 187



>gb:ATAC009918_1543096 Arabidopsis thaliana chromosome III BAC
           T19F11 genomic sequence, complete sequence.
          Length = 240

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 33/125 (26%), Positives = 58/125 (46%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W + +P    F + DA +  F+    N L  ++ +  T RNPN ++G+YYD   + + + 
Sbjct: 74  WLIFRPNAVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVGVYYDEF-SVSGYY 132

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           G Q   S  +   YQGHK+  V    + G ++ +    G        D     I+R++ +
Sbjct: 133 GDQRFGSANVSSFYQGHKNTTVILTKIEGQNLVV---LGDGARTDLKDDEKSGIYRINAK 189

Query: 535 IRWKV 549
           +R  V
Sbjct: 190 LRLSV 194



>pir|T02662|T02662 hin1 protein homolog - rice>gb:AF039532_1763374
           Oryza sativa harpin induced gene 1 homolog (Hin1) mRNA,
           complete cds.
          Length = 205

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 33/144 (22%), Positives = 63/144 (43%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + + +P      +  A +  F +S  + L+ ++ + +T RNPN ++G+YYD + + A F 
Sbjct: 45  YLIFRPHMIAATVDSAALTQFTLSTNSALAYSLTVDLTVRNPNKRVGLYYDNVESLALFD 104

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           GQ+  Y+  +   YQ  +     SP   G              + Q  G   +  +L+ +
Sbjct: 105 GQRFGYA-PLDSFYQSTEASTKLSPAFKGQQPLQGDITAANFRSQQTAGKFDIEVKLNAK 163

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIP 606
           +R KV           ++CP  +P
Sbjct: 164 LRVKVWAFKVPGPKPKISCPITVP 187



>gb:AB016877_1512996 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MLF18.
          Length = 256

 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 8/147 (5%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATF- 351
           + V +PK P + +    +  F ++    LS    +T+T++NPN+KIGIYY+     +   
Sbjct: 84  YLVFRPKFPDYNIDRLQLTRFQLNQDLSLSTAFNVTITAKNPNEKIGIYYEDGSKISVLY 143

Query: 352 ------RGQQITYST-AIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVW 510
                  G     ST ++P  YQGH++  +    + G           +    +  G + 
Sbjct: 144 MQTRISNGTDFVISTGSLPKFYQGHENTTIILVEMTGFTQNATSLMTTLQEQQRLTGSIP 203

Query: 511 LIFRLDGRIRWKVGTLVTSRYHIHVTC 591
           L  R+   +R K+G L   +    V C
Sbjct: 204 LRIRVTQPVRIKLGKLKLMKVRFLVRC 230



>pir|F85065|F85065 hypothetical protein AT4g05220 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV15_1544366 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 15.
          Length = 226

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 34/141 (24%), Positives = 64/141 (45%), Gaps = 2/141 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           W  L+P +P F +QD  +   +     + +A I   VT  NPN  +G+Y+D +     ++
Sbjct: 65  WLSLRPHRPRFHIQDFVVQGLD-QPTGVENARIAFNVTILNPNQHMGVYFDSMEGSIYYK 123

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD-- 528
            Q++     + P +Q   +  + +  + G  + +        S  +A G V   FRLD  
Sbjct: 124 DQRVGLIPLLNPFFQQPTNTTIVTGTLTGASLTVNSNRWTEFSNDRAQGTVG--FRLDIV 181

Query: 529 GRIRWKVGTLVTSRYHIHVTC 591
             IR+K+   ++  + +H  C
Sbjct: 182 STIRFKLHRWISKHHRMHANC 202



>gb:AB083029_1524142 Glycine max mRNA for syringolide-induced
           protein B13-1-9, complete cds.
          Length = 203

 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 40/157 (25%), Positives = 69/157 (43%), Gaps = 12/157 (7%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W V+QP+   F + +A +  F+    N  L   + +  T+RNPN K+ IYYD++   A +
Sbjct: 36  WLVVQPRSFKFQVTEADLTQFDYYTNNHTLHYNMVLNFTARNPNKKLSIYYDKVEALAFY 95

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGP---MLSAAQ--------AD 498
              +      I  +    + +   SP         A F G    ML++ Q        +D
Sbjct: 96  EDARFANYDVITHMNSFRQYKKSTSPM-------SAVFSGKKVLMLNSEQVSKLNQDKSD 148

Query: 499 GGVWLIFRLDGRIRWKVGTLVTSRYHIHVTCPAYIPF 609
           G   +  +L+ RIR+++G  ++      V C   +PF
Sbjct: 149 GVYDIYVKLNFRIRFRLGDSISGNLKPKVKCHLKVPF 185



>pir|H84768|H84768 hypothetical protein At2g35460 [imported] -
           Arabidopsis thaliana>gb:AC005314_1532573 Arabidopsis
           thaliana chromosome 2 clone T32F12 map ve016, complete
           sequence.
          Length = 238

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 40/147 (27%), Positives = 67/147 (45%), Gaps = 3/147 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDA--TIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFAT 348
           W +L+P    F + +A  T F F+  + N L   I +  + RNPN ++GI+YD+L     
Sbjct: 73  WFILRPNVVKFQVTEADLTRFEFDPRSHN-LHYNISLNFSIRNPNQRLGIHYDQL-EVRG 130

Query: 349 FRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLI-FRL 525
           + G Q   +  +   YQGHK+  V    + G  + +    G          GV+ I  +L
Sbjct: 131 YYGDQRFSAANMTSFYQGHKNTTVVGTELNGQKLVLLGAGGRRDFREDRRSGVYRIDVKL 190

Query: 526 DGRIRWKVGTLVTSRYHIHVTCPAYIP 606
             ++R+K G L +      + C   +P
Sbjct: 191 RFKLRFKFGFLNSWAVRPKIKCHLKVP 217



>gb:AP004637_1842395 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0703C03.>gb:AP005493_1852820 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0078D03.
          Length = 242

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 6/175 (3%)
 Frame = +1

Query: 118 CCAGXXXXXXXXXXXXXXXWAVLQPKKPTFLLQDATIFNFNVSAPNI-LSATIQITVTSR 294
           CC                     +PK P++ + D ++  F+VS+ ++ + A +  +V + 
Sbjct: 59  CCCFLLLLVVAVAATSAYLLYACRPKAPSYSVSDMSVARFDVSSSDLTVYAKLVASVRAE 118

Query: 295 NPNDKIGIYYDRLGTFA-TFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFG 471
           NPND +GI Y      A ++RG  +  S  +P  YQGH++  V    + G        FG
Sbjct: 119 NPNDMVGIGYGAGSRAAVSYRGTTLC-SGRLPAFYQGHRNTTVVRVAMEGRH-----GFG 172

Query: 472 PMLSAA----QADGGVWLIFRLDGRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPR 624
           P L  A    +  G V L   +   +  ++G +      ++V C A +  G +P+
Sbjct: 173 PGLQGALEESEEAGNVPLDVYVSAPVTLRLGDVDLREVTVNVHC-ALVVDGLSPK 226



>pir|E84668|E84668 hypothetical protein At2g27080 [imported] -
           Arabidopsis thaliana>gb:AC005623_1532856 Arabidopsis
           thaliana chromosome 2 clone T20P8 map B68, complete
           sequence.>gb:AY052291_1562664 Arabidopsis thaliana
           At2g27080/T20P8.13 mRNA, complete
           cds.>gb:AY061921_1564940 Arabidopsis thaliana
           At2g27080/T20P8.13 mRNA, complete
           cds.>gb:AF370591_1792374 Arabidopsis thaliana Unknown
           protein (At2g27080; T20P8.13) mRNA, complete cds.
          Length = 260

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/139 (19%), Positives = 65/139 (46%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + + +P+ P + ++  ++   N+++ + +S +  +TV SRN N KIG+YY++  +   + 
Sbjct: 97  YLIYRPEAPKYSIEGFSVSGINLNSTSPISPSFNVTVRSRNGNGKIGVYYEKESSVDVYY 156

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
                 +  +P  YQ  K+  V    + G+ + +       +    +   V    ++   
Sbjct: 157 NDVDISNGVMPVFYQPAKNVTVVKLVLSGSKIQLTSGMRKEMRNEVSKKTVPFKLKIKAP 216

Query: 535 IRWKVGTLVTSRYHIHVTC 591
           ++ K G++ T    ++V C
Sbjct: 217 VKIKFGSVKTWTMIVNVDC 235



>gb:AC136520_1743248 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0017O06, complete sequence.
          Length = 291

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 2/141 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           + + +P +P+F +   T  N + S  +  L+ +IQ+TVT++NPN K+   YD     A+ 
Sbjct: 87  YLLYRPHRPSFTVSSLTALNLSSSPTSPSLTDSIQLTVTAKNPNKKVVYLYDDFSFSAST 146

Query: 352 RGQQITYSTAIPPVY-QGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
               +    A  P +     +  V++  +  N V + P      S  +  G   +    +
Sbjct: 147 AANAVPLGAATSPGFTHDAGNTTVFTATIAANAVAVDP--AAAASDIKKSGAFSVAVDAE 204

Query: 529 GRIRWKVGTLVTSRYHIHVTC 591
            R   +VG+L T +  I V C
Sbjct: 205 TRAGVRVGSLKTKKIGIQVHC 225



>gb:AP003413_1829097 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1151A10.
          Length = 291

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 36/161 (22%), Positives = 66/161 (40%), Gaps = 2/161 (1%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           +    P+ PTF +    +   NVS  + +++ I+ TVT+RNPNDKI   Y  +       
Sbjct: 102 YVAYHPQLPTFAVTSLRLAALNVSDSDAVTSRIEFTVTARNPNDKIAFAYGDIAAAFAAD 161

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
           G  +   T +P       +  V           + P     L + ++     +   +D +
Sbjct: 162 GADVGDGT-VPGFVHPAGNTTVIKGDASAAAATVDPLVANGLRSRKSHA---MSVEMDSK 217

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIP--FGDTPRPGGIVVGNA 651
           + +++G   + R ++ V C  +      +TP    IVV  A
Sbjct: 218 VGFQIGRFKSKRINVRVLCAGFTAALAKNTPSAPPIVVAAA 258



>gb:AY577290_1615974 Petunia integrifolia subsp. inflata clone
           Pi071603a unknown pollen protein mRNA, complete cds.
          Length = 234

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 36/156 (23%), Positives = 63/156 (40%), Gaps = 4/156 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + + QPK PT+  Q   +  F       L+  I +T+ + NPN  I + Y +  +     
Sbjct: 71  YTMYQPKLPTYKFQSLEVKEFGYQPDFSLTTDIIVTIRAENPNKAISLIYGKESSVNVTY 130

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQAD----GGVWLIFR 522
                 S  +P  +QGHK+  +    + G        FG  L  A  D    G + L+ +
Sbjct: 131 TDSTICSGTLPSFHQGHKNVTMMQIELKGKSQ-----FGSGLYEAMQDNEKNGKIPLLVK 185

Query: 523 LDGRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPG 630
           L   ++  VG     ++++   C   +   D  +PG
Sbjct: 186 LKVPVQVYVGEYPLRQFNVLANCSLVV---DNLKPG 218



>gb:AP004139_1838163 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847988 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 197

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 34/151 (22%), Positives = 69/151 (45%), Gaps = 6/151 (3%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQD-ATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATF 351
           W  ++P KP  +  D A +  FN ++   L+ T  IT+ + N N +  ++Y  +     +
Sbjct: 37  WLTVRPAKPLLVYVDHAAVTGFNFTSGGSLNGTFDITLRAYNQNKRAAVWYKSVEVGVWY 96

Query: 352 RGQQITYSTA----IPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIF 519
            G  +  + A    +PP+    K  +V +P V      +       +   ++DG + +  
Sbjct: 97  GGTYLAGAVAPGFDLPPL--NVKRIDVAAPAV---RAALPRGVEATVKKDRSDGKLPVDV 151

Query: 520 RLDGRIRWKVGTLVTSRYHIHVTC-PAYIPF 609
            + G++R++ G + T RY +  +C P  + F
Sbjct: 152 HIKGKVRFRYGLVRTRRYKLRASCSPVVVDF 182



>gb:AC136519_1743240 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0007C23, complete sequence.
          Length = 293

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 34/143 (23%), Positives = 63/143 (44%), Gaps = 4/143 (2%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNI---LSATIQITVTSRNPNDKIGIYYDRLGTFA 345
           + + +P +P+F +    +   N+S+      L+ +IQ+TVT++NPN K+   YD     A
Sbjct: 87  YLLYRPHRPSFTVSSVKLTALNLSSSPTSPSLTDSIQLTVTAKNPNKKVVYLYDDFSFSA 146

Query: 346 TFRGQQITYSTAIPPVY-QGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFR 522
           +     +    A  P +     +  V++  +  N V + P      S  +  G   +   
Sbjct: 147 STAANAVPLGAATSPGFTHDAGNTTVFTATIAANAVAVDP--AAAASDIKKSGAFSVAVD 204

Query: 523 LDGRIRWKVGTLVTSRYHIHVTC 591
            + R   +VG+L T +  I V C
Sbjct: 205 AETRAGVRVGSLKTKKIGIQVHC 227



>gb:AP005066_1847477 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0047E05.>gb:AP005841_1858887 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0052M16.
          Length = 250

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 37/152 (24%), Positives = 61/152 (40%), Gaps = 13/152 (8%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSA-----------PNILS-ATIQITVTSRNPNDKIGI 318
           +  L P+ P + ++  T+  F++             P + + A+    V   NPN  I I
Sbjct: 74  YLALDPRLPRYAIESLTVQAFDMDYDGHGGEYGYGDPQLTARASFDAAVRFENPNRAIDI 133

Query: 319 YYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQAD 498
            Y+   + A F G       A+P  YQGH D  V    +    +  A      +      
Sbjct: 134 SYEEGSSLAVFYGGHRLSEGALPAFYQGHGDAGVVHVAMGDATLEGAGAVAEAMQQVVGG 193

Query: 499 GG-VWLIFRLDGRIRWKVGTLVTSRYHIHVTC 591
           GG + L+FR +  +R KVG + T +    + C
Sbjct: 194 GGELPLVFRGEVPVRVKVGPITTGKLTPTIRC 225



>gb:BT002004_1635607 Arabidopsis thaliana non-race specific disease
           resistance protein (NDR1) (At3g20600) mRNA, complete
           cds.>gb:BT006267_1639159 Arabidopsis thaliana At3g20600
           mRNA, complete cds.>gb:AF021346_1761730 Arabidopsis
           thaliana non-race specific disease resistance protein
           (NDR1) gene, complete cds.>gb:AP000410_1820025
           Arabidopsis thaliana genomic DNA, chromosome 3, TAC
           clone: K10D20.
          Length = 219

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 43/167 (25%), Positives = 63/167 (37%), Gaps = 11/167 (6%)
 Frame = +1

Query: 118 CCAGXXXXXXXXXXXXXXXWAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRN 297
           CC                 W  L+  KP   +Q+  I        +  + T+   V   N
Sbjct: 14  CCTCCLSFIFTAGLTSLFLWLSLRADKPKCSIQNFFIPALGKDPNSRDNTTLNFMVRCDN 73

Query: 298 PNDKIGIYYDRLG-TFATFRGQQITYST-------AIPPVYQGHKDR-NVWSPFVYGNDV 450
           PN   GIYYD +   F+T    +I  S         +P  YQGHK +   W      N+ 
Sbjct: 74  PNKDKGIYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQ 133

Query: 451 PIAPFFGPMLSAAQADGGVWLIFRLD--GRIRWKVGTLVTSRYHIHV 585
            +       L A   +G    +FRLD   ++R+K+    T RY + V
Sbjct: 134 TV-------LRAVLPNGSA--VFRLDLKTQVRFKIVFWKTKRYGVEV 171



>gb:AY735684_1625726 Arabidopsis thaliana hypothetical protein
           AT5G21130 mRNA, complete cds.>gb:AC140977_1744077
           Arabidopsis thaliana chromosome 5 BAC F13M11 genomic
           sequence, complete sequence.
          Length = 281

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 32/139 (23%), Positives = 60/139 (43%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + V QP KP F +   ++   N+++ +  S  I+I + S+N   K+G+ Y++      F 
Sbjct: 118 YLVYQPHKPQFSVSGVSVTGINLTSSSPFSPVIRIKLRSQNVKGKLGLIYEKGNEADVFF 177

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
                 +       Q   +  V    + G+ V +       L+ +Q  G V    R+   
Sbjct: 178 NGTKLGNGEFTAFKQPAGNVTVIVTVLKGSSVKLKSSSRKELTESQKKGKVPFGLRIKAP 237

Query: 535 IRWKVGTLVTSRYHIHVTC 591
           +++KVG++ T    I V C
Sbjct: 238 VKFKVGSVTTWTMTITVDC 256



>gb:AP005829_1858625 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1008E06.
          Length = 210

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 38/164 (23%), Positives = 69/164 (42%), Gaps = 6/164 (3%)
 Frame = +1

Query: 118 CCAGXXXXXXXXXXXXXXXWAVLQPKKPTFLLQDATIFNFNVSAPNI-LSATIQITVTSR 294
           CC                   + +PK P++ + + ++  F+ ++ ++ L   +  TV + 
Sbjct: 27  CCCFLFLIVAALAGAAAYALFLYKPKAPSYSVSNMSVSQFDFNSNDLTLYTKLVATVRAE 86

Query: 295 NPNDKIGIYY-DRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFG 471
           NPN+ IGI Y D   T  ++RG  +  S  +P  YQG K+  V    + G        FG
Sbjct: 87  NPNEMIGIIYGDGSRTVVSYRGTPLC-SGHLPTFYQGFKNVTVMEISMEGRH-----GFG 140

Query: 472 PMLSAA----QADGGVWLIFRLDGRIRWKVGTLVTSRYHIHVTC 591
             L +A    + +G V L   +   +  + G+       ++V C
Sbjct: 141 SGLQSALEESEKEGNVPLDVFVSVPVSLRFGSFDVREVRVNVHC 184



>gb:AY775036_1180011 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 76 (ACRE76) mRNA, partial cds.
          Length = 134

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 1/129 (0%)
 Frame = +1

Query: 277 ITVTSRNPNDKIGIYYDRLGTFATFRGQQITYSTA-IPPVYQGHKDRNVWSPFVYGNDVP 453
           +TV + NPN+KIGIYY R G+  T     +  S    P  YQ   +  V+   + G++V 
Sbjct: 5   VTVRAENPNNKIGIYY-RKGSSVTVLYSDVNLSNGEFPAFYQPTNNVTVFKTPLKGSNVL 63

Query: 454 IAPFFGPMLSAAQADGGVWLIFRLDGRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRPGG 633
           +       L   Q  G V     +   ++ KVG + T    + V C   +   DT     
Sbjct: 64  LGSAVRTALRNEQKQGKVPFRVDIKAPVKIKVGAVKTWEITVKVKCDITV---DTLTEKS 120

Query: 634 IVVGNAVKY 660
            +V    KY
Sbjct: 121 KIVSKHCKY 129



>pir|D96643|D96643 hypothetical protein T13M11.12 [imported] -
           Arabidopsis thaliana>gb:AE005173_893846 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC005882_1533133 Arabidopsis thaliana
           chromosome I BAC T13M11 genomic sequence, complete
           sequence.
          Length = 224

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 33/147 (22%), Positives = 65/147 (44%), Gaps = 1/147 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSAT-IQITVTSRNPNDKIGIYYDRLGTFATF 351
           W  LQP +P   ++  +I    +S P+    + I   +T+ NPN  +GIYYD +     +
Sbjct: 63  WISLQPHRPRVHIRGFSISG--LSRPDGFETSHISFKITAHNPNQNVGIYYDSMEGSVYY 120

Query: 352 RGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG 531
           + ++I  +    P YQ  K+ +     +    + +       +   +  G +    ++  
Sbjct: 121 KEKRIGSTKLTNPFYQDPKNTSSIDGALSRPAMAVNKDRWMEMERDRNQGKIMFRLKVRS 180

Query: 532 RIRWKVGTLVTSRYHIHVTCPAYIPFG 612
            IR+KV T  +  + ++ +C  YI  G
Sbjct: 181 MIRFKVYTWHSKSHKMYASC--YIEIG 205



>gb:AP003270_1826851 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0505D12.>gb:AP003611_1831349 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0423B08.
          Length = 224

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 8/148 (5%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPN----ILSATIQITVTSRNPNDKIGIYYDRLGTF 342
           W + +P+     +  AT+  F ++       +LS  +   +T RNP+ +  +YYD L   
Sbjct: 60  WLIYRPRAIQVAVDAATLSRFALNTTANPRPVLSFNLTAGLTIRNPSRRTAVYYDVLSAD 119

Query: 343 ATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPI---APFFGPMLSAAQADGGVWL 513
             +RG +   + A+P  YQG +  +     + G+   +   A  FG           +W+
Sbjct: 120 GFYRGLRFG-AAALPLSYQGGRRADAVRAVLVGSSGVVSWDAGAFGEDNHTGVFPVTLWV 178

Query: 514 IFRLDGRIRWKVGTLV-TSRYHIHVTCP 594
           +    G +R+K G L+ TS   +   CP
Sbjct: 179 L----GAVRYKYGGLMTTSATMLSARCP 202



>gb:AY059166_1564529 Arabidopsis thaliana At2g01080/F23H14.5 mRNA,
           complete cds.>gb:AF378858_1793443 Arabidopsis thaliana
           At2g01080/F23H14.5 mRNA, complete cds.
          Length = 231

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 9/88 (10%)
 Frame = +1

Query: 184 LQPKKPTFLLQDATIFNFNVSAPNI--------LSATIQITVTSRNPNDKIGIYYDRLGT 339
           ++PKKP F LQ   +    +S P+         LS TI++  T+ NPN K+GI Y     
Sbjct: 66  VKPKKPQFDLQQVAVVYMGISNPSAVLDPTTASLSLTIRMLFTAVNPN-KVGIRYGESSF 124

Query: 340 FATFRGQQITYSTAIPPVYQ-GHKDRNV 420
              ++G  +  +T +P  YQ  H  +NV
Sbjct: 125 TVMYKGMPLGRAT-VPGFYQDAHSTKNV 151



>gb:AC006837_1534625 Arabidopsis thaliana chromosome 2 BAC F23H14
           genomic sequence, complete sequence.
          Length = 231

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 9/88 (10%)
 Frame = +1

Query: 184 LQPKKPTFLLQDATIFNFNVSAPNI--------LSATIQITVTSRNPNDKIGIYYDRLGT 339
           ++PKKP F LQ   +    +S P+         LS TI++  T+ NPN K+GI Y     
Sbjct: 66  VKPKKPQFDLQQVAVVYMGISNPSAVLDPTTASLSLTIRMLFTAVNPN-KVGIRYGESSF 124

Query: 340 FATFRGQQITYSTAIPPVYQ-GHKDRNV 420
              ++G  +  +T +P  YQ  H  +NV
Sbjct: 125 TVMYKGMPLGRAT-VPGFYQDAHSTKNV 151



>gb:AB020744_1514590 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9E15.>gb:AY800650_1628598 Arabidopsis
           thaliana clone H0000001198 hypothetical protein
           (AT5G45320) mRNA, complete cds.
          Length = 198

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 28/140 (20%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           + V+ P+ P   + DA +         +L   + I +   N N K    +D      ++ 
Sbjct: 39  YLVIHPRVPIISVADAHLDFLKYDIVGVLQTQLTIVIRVENDNAKAHALFDETEFKLSYE 98

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPF-VYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDG 531
           G+ I    A  P ++  K+++++ P+ V    +P+ P     +  A     +    +   
Sbjct: 99  GKPIAILKA--PEFEVVKEKSMFLPYLVQSYPIPLNPTMMQAVDYAVKKDVITFELKGGS 156

Query: 532 RIRWKVGTLVTSRYHIHVTC 591
           R RW+VG L + ++  +++C
Sbjct: 157 RTRWRVGPLGSVKFECNLSC 176



>pir|D84420|D84420 hypothetical protein At2g01080 [imported] -
           Arabidopsis thaliana
          Length = 220

 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 9/88 (10%)
 Frame = +1

Query: 184 LQPKKPTFLLQDATIFNFNVSAPNI--------LSATIQITVTSRNPNDKIGIYYDRLGT 339
           ++PKKP F LQ   +    +S P+         LS TI++  T+ NPN K+GI Y     
Sbjct: 66  VKPKKPQFDLQQVAVVYMGISNPSAVLDPTTASLSLTIRMLFTAVNPN-KVGIRYGESSF 124

Query: 340 FATFRGQQITYSTAIPPVYQ-GHKDRNV 420
              ++G  +  +T +P  YQ  H  +NV
Sbjct: 125 TVMYKGMPLGRAT-VPGFYQDAHSTKNV 151



>pir|T08453|T08453 hypothetical protein F22O6.160 - Arabidopsis
           thaliana>gb:ATF22O6_1549703 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F22O6.
          Length = 300

 Score = 42.0 bits (97), Expect = 0.017
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRL 333
           W VL+P+ P F + + ++ NFNV+ P + SA     +T  N N K+  Y+DR+
Sbjct: 128 WLVLRPQIPLFSVNNFSVSNFNVTGP-VFSAQWTANLTIENQNTKLKGYFDRI 179



>gb:AF325013_1786467 Arabidopsis thaliana At1g17620
           (At1g17620/F11A6_23) mRNA, complete cds.
          Length = 265

 Score = 40.8 bits (94), Expect = 0.037
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 6/145 (4%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYD----RLGTF 342
           + + +P++P+F + +  I   N ++   L+  I ++V +RNPN  +G  YD     L   
Sbjct: 85  YLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKA 144

Query: 343 ATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGN--DVPIAPFFGPMLSAAQADGGVWLI 516
           +T     +         +   K          G+  D       G +    +A   V + 
Sbjct: 145 STGGDDDVVIGKGTIAAFSHGKKNTTTLRSTIGSPPDELDEISAGKLKGDLKAKKAVAIK 204

Query: 517 FRLDGRIRWKVGTLVTSRYHIHVTC 591
             L+ +++ K+G L T +  I VTC
Sbjct: 205 IVLNSKVKVKMGALKTPKSGIRVTC 229



>gb:AC022492_1539061 Genomic sequence for Arabidopsis thaliana BAC
           F1L3 from chromosome I, complete
           sequence.>gb:AY052685_1562845 Arabidopsis thaliana
           At1g17620/F11A6_23 mRNA, complete
           cds.>gb:AF446896_1800537 Arabidopsis thaliana
           At1g17620/F11A6_23 mRNA, complete cds.
          Length = 264

 Score = 40.8 bits (94), Expect = 0.037
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 6/145 (4%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYD----RLGTF 342
           + + +P++P+F + +  I   N ++   L+  I ++V +RNPN  +G  YD     L   
Sbjct: 84  YLIYRPQRPSFTVSELKISTLNFTSAVRLTTAISLSVIARNPNKNVGFIYDVTDITLYKA 143

Query: 343 ATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGN--DVPIAPFFGPMLSAAQADGGVWLI 516
           +T     +         +   K          G+  D       G +    +A   V + 
Sbjct: 144 STGGDDDVVIGKGTIAAFSHGKKNTTTLRSTIGSPPDELDEISAGKLKGDLKAKKAVAIK 203

Query: 517 FRLDGRIRWKVGTLVTSRYHIHVTC 591
             L+ +++ K+G L T +  I VTC
Sbjct: 204 IVLNSKVKVKMGALKTPKSGIRVTC 228



>gb:AP000410_1820024 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone: K10D20.
          Length = 255

 Score = 40.4 bits (93), Expect = 0.049
 Identities = 29/108 (26%), Positives = 42/108 (38%), Gaps = 8/108 (7%)
 Frame = +1

Query: 115 QCCAGXXXXXXXXXXXXXXXWAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSR 294
           +CC                 W  L+ KKP   +Q+  I   + +  +  + T+   V   
Sbjct: 13  KCCTCFFKFIFTTRLGALILWLSLRAKKPKCSIQNFYIPALSKNLSSRDNTTLNFMVRCD 72

Query: 295 NPNDKIGIYYDRLG-TFATFRGQQITYST-------AIPPVYQGHKDR 414
           NPN   GIYYD +  TF+T        S         +P  YQGHK +
Sbjct: 73  NPNKDKGIYYDDVHLTFSTINTTTTNSSDLVLVANYTVPKFYQGHKKK 120



>gb:AB026295_1516948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0681F10.
          Length = 322

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 12/155 (7%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSA--------PNILSATIQITVTSRNPNDKIGIYYDR 330
           W   +P +P  +++  T+ +F              +++    + +   NP    GI+   
Sbjct: 153 WGAARPYEPDVVVKSLTMDDFYAGEGTDHSGVPTKLVTLNCSLHIAVYNPASMFGIHV-- 210

Query: 331 LGTFATFRGQQITYSTAIPPV---YQGHKDRNVWSPFVYGNDVPI-APFFGPMLSAAQAD 498
             T    R      S  +  V   YQ  K   + +  V+GN VP+     G MLS++   
Sbjct: 211 --TTGPIRLLYSEISIGVGQVRRYYQPRKSHRLVTAVVHGNKVPLYGAGGGLMLSSSGGA 268

Query: 499 GGVWLIFRLDGRIRWKVGTLVTSRYHIHVTCPAYI 603
             + L F L  R  + +G LV   + +HVTCP  +
Sbjct: 269 VPLTLDFDLTSR-GYVIGKLVRVTHKVHVTCPIVV 302



>pir|H84670|H84670 hypothetical protein At2g27270 [imported] -
           Arabidopsis thaliana>gb:AC006233_1533784 Arabidopsis
           thaliana chromosome 2 clone F12K2 map B68, complete
           sequence.>gb:AY168988_1586420 Arabidopsis thaliana
           hypothetical protein (F12K2.15) mRNA, complete
           cds.>gb:AY649262_1620062 Arabidopsis thaliana
           hypothetical protein (At2g27270) mRNA, complete cds.
          Length = 231

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 29/147 (19%), Positives = 59/147 (40%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFR 354
           +  +QP+ P F+L+D  +         + + ++ + ++S NP+ K  +YY ++       
Sbjct: 78  YIAIQPRVPRFMLEDLYV-------DPLSNTSVIVKLSSTNPSYKSSVYYRKISLHVLVG 130

Query: 355 GQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGR 534
            +  T S  +    Q  +   +W+  +  N+    P    ++      G V      D  
Sbjct: 131 EKFETESVFLQSRRQEPRTVRLWTAVIANNNDNGKPTGAFLVRHGMYYGHVIA----DIV 186

Query: 535 IRWKVGTLVTSRYHIHVTCPAYIPFGD 615
            +WK G      + +HV CP  +   D
Sbjct: 187 FQWKSGIFSFKEFGLHVRCPVLLRLED 213



>gb:AP005605_1854747 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1449_C01.>gb:AP005847_1859015 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ9990_A01.
          Length = 311

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 34/141 (24%), Positives = 52/141 (36%), Gaps = 4/141 (2%)
 Frame = +1

Query: 181 VLQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQ 360
           +LQP+ P   ++ A + +        L A + + V + N N + G  +        F   
Sbjct: 151 LLQPRAPYLAIRSARLDDLVYDQQGALEAALSLGVAAENGNARSGATFSDFELRLVFHRV 210

Query: 361 QITYSTA----IPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIFRLD 528
            I    A    +PP     K        V  + +P+       + AA ADG V       
Sbjct: 211 VIAILRADPFDVPP-----KGSLPLGYVVRSSGIPLDSSGMAAMEAALADGVVPFTVSGQ 265

Query: 529 GRIRWKVGTLVTSRYHIHVTC 591
              RWKVG LV  +Y   + C
Sbjct: 266 ASTRWKVGGLVPFKYWTRLRC 286



>gb:AC092557_1735476 Oryza sativa chromosome 3 BAC OSJNBa0096I06
           genomic sequence, complete sequence.
          Length = 212

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 37/155 (23%), Positives = 66/155 (42%), Gaps = 8/155 (5%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVS-----APNILSATIQITVTSRNPNDKIGIYYDRLGT 339
           +A++ P K T    DA +    +S     + + +S    +T++ RNPN   GI YD +  
Sbjct: 40  FALVFPPKAT--ADDAVLLRLALSPGSPPSNSTVSYNATVTLSLRNPNLYRGISYDPVAV 97

Query: 340 FATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQAD---GGVW 510
             +F G +   S  +P  Y   +    +   V G   P+       ++A +A+   G   
Sbjct: 98  AFSFNGTRFDESATVPAFYHRPRKTATFHVTVGGAGKPVPKLTAAGVAAFRAENATGRFE 157

Query: 511 LIFRLDGRIRWKVGTLVTSRYHIHVTCPAYIPFGD 615
           +  RLD  +++K      +R  + V CP  +   D
Sbjct: 158 VEVRLDTVMQYKAR---KARCPLAVICPLQLQLVD 189



>gb:AC084110_1733347 Arabidopsis thaliana chromosome 1 BAC F27G20
           genomic sequence, complete sequence.
          Length = 416

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = +1

Query: 205 FLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQITYSTAI 384
           F + DA + +F++ + N L  ++ + ++ RN    IGI+YDR      +  Q++  +  +
Sbjct: 9   FQVYDAELTHFDLESNNNLQYSLSLNLSIRNSKSSIGIHYDRFEATVYYMNQRLG-AVPM 67

Query: 385 PPVYQGHKD 411
           P  Y G K+
Sbjct: 68  PLFYLGSKN 76



>pir|C86447|C86447 F5D14.3 protein - Arabidopsis
           thaliana>gb:AE005172_892064 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F5D14_1678303 Sequence of BAC F5D14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 448

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 19/69 (27%), Positives = 37/69 (53%)
 Frame = +1

Query: 205 FLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQITYSTAI 384
           F + DA + +F++ + N L  ++ + ++ RN    IGI+YDR      +  Q++  +  +
Sbjct: 9   FQVYDAELTHFDLESNNNLQYSLSLNLSIRNSKSSIGIHYDRFEATVYYMNQRLG-AVPM 67

Query: 385 PPVYQGHKD 411
           P  Y G K+
Sbjct: 68  PLFYLGSKN 76



>gb:AB020746_1514629 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOB24.
          Length = 298

 Score = 37.0 bits (84), Expect = 0.54
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 3/125 (2%)
 Frame = +1

Query: 238 NVSAPN-ILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQITYSTAIPPVYQGHKDR 414
           N   P  I++    + +T+ NP+   GI+         +  +Q T + A    Y   K  
Sbjct: 159 NTGVPTKIMNVKCSVVITTHNPSTLFGIHVSSTAVSLIY-SRQFTLANARLKSYHQPKQS 217

Query: 415 NVWSPF-VYGNDVPIAPFFGPMLSAAQADGGVWLIFRLDGRIRWK-VGTLVTSRYHIHVT 588
           N  S   + G+ VP+    G  L A+   GGV +    + R R   VG LV SR+  H++
Sbjct: 218 NHTSRINLIGSKVPLYG-AGAELVASDNSGGVPVKLEFEIRSRANIVGNLVKSRHRKHLS 276

Query: 589 CPAYI 603
           C  +I
Sbjct: 277 CFFFI 281



>gb:AY085665_1570733 Arabidopsis thaliana clone 1678 mRNA, complete
           sequence.
          Length = 235

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNIL-----SATIQITVTSRNPNDKIGIYYDRLGT 339
           + + +PK+PT  +   T+     S   +L     + T+ + ++ +NPN +IG  YD    
Sbjct: 74  FTLFKPKRPTTTIDSVTVDRLQASVNPLLLKVLLNLTLNVDLSLKNPN-RIGFSYDSSSA 132

Query: 340 FATFRGQQI 366
              +RGQ I
Sbjct: 133 LLNYRGQVI 141



>pir|T47579|T47579 hypothetical protein F24B22.160 - Arabidopsis
           thaliana>gb:ATF24B22_1549829 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.
          Length = 235

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 5/69 (7%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVSAPNIL-----SATIQITVTSRNPNDKIGIYYDRLGT 339
           + + +PK+PT  +   T+     S   +L     + T+ + ++ +NPN +IG  YD    
Sbjct: 74  FTLFKPKRPTTTIDSVTVDRLQASVNPLLLKVLLNLTLNVDLSLKNPN-RIGFSYDSSSA 132

Query: 340 FATFRGQQI 366
              +RGQ I
Sbjct: 133 LLNYRGQVI 141



>pir|A95938|A95938 probable glycosyltransferase protein redB
           [imported] - Sinorhizobium meliloti (strain 1021)
           magaplasmid pSymB>gb:RME591985_165417 Sinorhizobium
           meliloti 1021 complete pSymB.
          Length = 415

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 11/121 (9%)
 Frame = -2

Query: 693 LKANVAARDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVA-----ASDQGPDFPPNAS 529
           L A +   D + +HG  D             +GR    D+ A     A+D   D  PN  
Sbjct: 276 LAAKLGIEDRIRWHGALDQKDV---------LGRYRGADIFALACRVAADGDRDGLPNVL 326

Query: 528 VEAEDEPDAAVG--LGGAEHRAEEGRNGDVVAVDERRPDVAVLVALV----YRRDSGGIG 367
           VEA  +  A +   + G     E+G+NG VV  +   P  A L  L+     RR  G  G
Sbjct: 327 VEASSQRLACISTAVSGIPELLEDGKNGLVVPPESPEPLAAALERLIRDPELRRRLGAAG 386

Query: 366 D 364
           +
Sbjct: 387 E 387



>gb:CP000046_90239 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 1548

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = -2

Query: 672  RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDA 502
            +DE++ HG  DD  A S S ++ +    SD D  + SD   D   ++  +++ + DA
Sbjct: 1175 QDEVIIHGAKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDA 1231



>gb:AB033763_5281 Staphylococcus aureus DNA, type-I staphylococccal
            cassette chromosome mec, strain:NCTC10442.
          Length = 1698

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = -2

Query: 672  RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDA 502
            +DE++ HG  DD  A S S ++ +    SD D  + SD   D   ++  +++ + DA
Sbjct: 1431 QDEVIIHGAKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDA 1487



>sp|P80544|PLS_STAAU Surface protein precursor (Plasmin-sensitive
            surface protein) (230 kDa cell-wall
            protein).>gb:AF115379_480115 Staphylococcus aureus
            surface protein Pls (pls) gene, complete cds.
          Length = 1637

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 17/57 (29%), Positives = 30/57 (52%)
 Frame = -2

Query: 672  RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDA 502
            +DE++ HG  DD  A S S ++ +    SD D  + SD   D   ++  +++ + DA
Sbjct: 1290 QDEVIIHGAKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDA 1346



>gb:CP000010_864713 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 327

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 32/101 (31%), Positives = 42/101 (41%), Gaps = 14/101 (13%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMV-----AASDQGPDFPPNASVEAED--EPDAAVGLGGAE-- 478
           +G G  S R   R SD  +V     AA + G  F P+ S +A D   P A+ G GGAE  
Sbjct: 36  SGEGRPSGRPATRASDDALVSFRRSAACEAGEPFDPDESFDAHDAARPRASAGGGGAEGV 95

Query: 477 -----HRAEEGRNGDVVAVDERRPDVAVLVALVYRRDSGGI 370
                  A  GR GD  A +  R    +  A      +G +
Sbjct: 96  RGVRDAGAGGGRAGDARAANRLRAPAGLSSAAKREETAGDV 136



>gb:AE017283_432009 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 498

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 34/107 (31%), Positives = 42/107 (39%), Gaps = 2/107 (1%)
 Frame = -2

Query: 642 DDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVGLGGAEHRAEE 463
           DD   GSG ++ R I    D     AS  G  F PNA   A           G   R   
Sbjct: 397 DDSVKGSGRIAGRCIASFYDEPQTTAS--GEQFNPNAMTAANKTLPL-----GTRIRVTN 449

Query: 462 GRNG--DVVAVDERRPDVAVLVALVYRRDSGGIGDLLAAEGGEGTEP 328
            RNG   VV +++R P VA     + R     I D+     G+GT P
Sbjct: 450 VRNGRSTVVRINDRGPYVAGRCVDLSRASFARIADI-----GQGTAP 491



>pir|T44601|T44601 probable glycosyltransferase [imported] -
           Rhizobium meliloti megaplasmid 2>gb:AF148072_483387
           Sinorhizobium meliloti megaplasmid 2 oligopeptide
           transport system permease protein (oppC) gene, partial
           cds; and RedA (redA) and putative glycosyltransferase
           (redB) genes, complete cds.
          Length = 415

 Score = 34.3 bits (77), Expect = 3.5
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 7/107 (6%)
 Frame = -2

Query: 693 LKANVAARDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVA-----ASDQGPDFPPNAS 529
           L A +   D + +HG  D             +GR    D+ A     A+D   D  PN  
Sbjct: 276 LAAKLGIEDRIRWHGALDQKDV---------LGRYRGADIFALACRVAADGDRDGLPNVL 326

Query: 528 VEAEDEPDAAVG--LGGAEHRAEEGRNGDVVAVDERRPDVAVLVALV 394
           VEA  +  A +   + G     E+G+NG VV  +   P  A L  L+
Sbjct: 327 VEASSQRLACISTAVSGIPELLEDGKNGLVVPPESPEPLAAALERLI 373



>gb:AP002537_1822503 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0001B06.>gb:AP003417_1829191 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0498B01.
          Length = 288

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 5/156 (3%)
 Frame = +1

Query: 175 WAVLQPKKPTFLLQDATIFNFNVS----APNILSATIQITVTSRNPNDKIGIYYDRLGTF 342
           + + +P +P F L  A +   ++S    AP  L+ +I +T+T++NPN K+   YD     
Sbjct: 82  YLLYRPHRPAFTLSVARVDKLSLSSSATAPT-LTDSIDVTLTAKNPNKKLVYLYDDFAVT 140

Query: 343 ATFRGQQITYST-AIPPVYQGHKDRNVWSPFVYGNDVPIAPFFGPMLSAAQADGGVWLIF 519
           A      +     ++P       +  V    V  + + + P      +  +  G   +  
Sbjct: 141 AATAANAVPLGEGSVPGFVHDAGNITVIKATVSASALGVDP--TTAATDIKKSGEFTITL 198

Query: 520 RLDGRIRWKVGTLVTSRYHIHVTCPAYIPFGDTPRP 627
            L+ +   KVG L T +  + V C         P P
Sbjct: 199 DLETKAGVKVGGLKTKKIGVLVHCEGIKVAAPAPPP 234



>gb:BT012175_1641382 Arabidopsis thaliana At4g26490 gene, complete
           cds.
          Length = 219

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 17/77 (22%), Positives = 34/77 (44%)
 Frame = +1

Query: 184 LQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQ 363
           ++P+ P F + +A +       P   +  + + V   NPN KI + +++L     F  + 
Sbjct: 65  IRPRIPVFDIPNANLHTIYFDTPEFFNGDLSMLVNFTNPNKKIEVKFEKLRIELFFFNRL 124

Query: 364 ITYSTAIPPVYQGHKDR 414
           I      P + + H+ R
Sbjct: 125 IAAQVVQPFLQKKHETR 141



>gb:AJ849884_1284900 Drosophila madeirensis partial CG5961 locus and
           CG5333 locus, line P154-MAD.
          Length = 384

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDEEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849866_1284864 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-Ost-11.
          Length = 384

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDEEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849860_1284852 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-Ost-05.
          Length = 384

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDEEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849857_1284846 Drosophila subobscura partial CG5961 gene and
           partial CG5333 gene, line P154-Ost-02.
          Length = 384

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVNIGDEEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849856_1284844 Drosophila subobscura partial CG5961 gene and
           partial CG5333 gene, line
           P154-Ost-01.>gb:AJ849858_1284848 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-03.>gb:AJ849859_1284850 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-04.>gb:AJ849861_1284854 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-06.>gb:AJ849862_1284856 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-07.>gb:AJ849863_1284858 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-08.>gb:AJ849864_1284860 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-09.>gb:AJ849865_1284862 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-10.>gb:AJ849867_1284866 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-12.>gb:AJ849868_1284868 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-Ost-13.>gb:AJ849869_1284870 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line P154-Ost-14.
          Length = 384

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDEEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AK048638_1168452 Mus musculus 16 days embryo head cDNA, RIKEN
           full-length enriched library, clone:C130091B14
           product:protocadherin 8, full insert sequence.
          Length = 973

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 5/68 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLGANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV 442
           EG NGDVV
Sbjct: 275 EGPNGDVV 282



>pir|T05055|T05055 hypothetical protein M3E9.80 - Arabidopsis
           thaliana>gb:ATCHRIV65_1546530 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 65.>gb:ATM3E9_1553621
           Arabidopsis thaliana DNA chromosome 4, P1 clone M3E9
           (ESSA project).
          Length = 200

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 17/77 (22%), Positives = 34/77 (44%)
 Frame = +1

Query: 184 LQPKKPTFLLQDATIFNFNVSAPNILSATIQITVTSRNPNDKIGIYYDRLGTFATFRGQQ 363
           ++P+ P F + +A +       P   +  + + V   NPN KI + +++L     F  + 
Sbjct: 46  IRPRIPVFDIPNANLHTIYFDTPEFFNGDLSMLVNFTNPNKKIEVKFEKLRIELFFFNRL 105

Query: 364 ITYSTAIPPVYQGHKDR 414
           I      P + + H+ R
Sbjct: 106 IAAQVVQPFLQKKHETR 122



>gb:AF231125_2060043 Mus musculus paraxial protocadherin (Papc)
           mRNA, complete cds.
          Length = 1071

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/69 (36%), Positives = 32/69 (46%), Gaps = 5/69 (7%)
 Frame = -2

Query: 633 AAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRA 469
           A   G+   R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   
Sbjct: 217 AQDGGTGPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--P 274

Query: 468 EEGRNGDVV 442
           +EG NGDVV
Sbjct: 275 DEGPNGDVV 283



>gb:BC036025_1981802 Homo sapiens protocadherin 8, transcript
           variant 1, mRNA (cDNA clone MGC:33061 IMAGE:5278690),
           complete cds.
          Length = 1070

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 29/79 (36%), Positives = 35/79 (44%), Gaps = 6/79 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV-AVDERRPDVA 412
           EG NGDVV A   R P  A
Sbjct: 275 EGPNGDVVFAFGARTPPEA 293



>gb:AY013873_1934292 Homo sapiens protocadherin ARCADLIN (PCDH8)
           mRNA, complete cds, alternatively spliced.
          Length = 973

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 29/79 (36%), Positives = 35/79 (44%), Gaps = 6/79 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV-AVDERRPDVA 412
           EG NGDVV A   R P  A
Sbjct: 275 EGPNGDVVFAFGARTPPEA 293



>gb:AL139085_1920229 Human DNA sequence from clone RP11-431O22 on
           chromosome 13 Contains the 5' end of the gene for
           chondromodulin I precursor (CHM-I), a novel gene, the
           PCDH8 gene for protocadherin 8 and 4 CpG islands,
           complete sequence.
          Length = 973

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 29/79 (36%), Positives = 35/79 (44%), Gaps = 6/79 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV-AVDERRPDVA 412
           EG NGDVV A   R P  A
Sbjct: 275 EGPNGDVVFAFGARTPPEA 293



>gb:AJ849882_1284896 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-33.
          Length = 386

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849881_1284894 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-32.
          Length = 386

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849880_1284892 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-31.
          Length = 384

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849878_1284888 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-29.
          Length = 384

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849876_1284884 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-27.
          Length = 384

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849875_1284882 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-26.>gb:AJ849877_1284886
           Drosophila subobscura partial CG5961 locus and CG5333
           locus, line P154-O3+4-28.
          Length = 386

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849871_1284874 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-22.
          Length = 384

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>gb:AJ849870_1284872 Drosophila subobscura partial CG5961 locus and
           CG5333 locus, line P154-O3+4-21.>gb:AJ849873_1284878
           Drosophila subobscura partial CG5961 locus and CG5333
           locus, line P154-O3+4-24.>gb:AJ849874_1284880 Drosophila
           subobscura partial CG5961 locus and CG5333 locus, line
           P154-O3+4-25.>gb:AJ849879_1284890 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-O3+4-30.>gb:AJ849883_1284898 Drosophila subobscura
           partial CG5961 locus and CG5333 locus, line
           P154-O3+4-36.
          Length = 384

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 33/96 (34%), Positives = 42/96 (43%), Gaps = 3/96 (3%)
 Frame = -2

Query: 672 RDELVFHGVADDDAAGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG 493
           + E V  G  +DD   S SV    +   + +DM   S Q  D  PNA+  A   P   V 
Sbjct: 93  KQEQVKIGDDEDDEDESTSVENELVCGFNQIDM--NSPQNADEDPNANCAAAAAPSVDVA 150

Query: 492 LGGAEHR--AE-EGRNGDVVAVDERRPDVAVLVALV 394
             GA     AE EG   DVV VD  +     L+AL+
Sbjct: 151 GAGATATICAEIEGPENDVVLVDTPKKPERDLIALL 186



>pir|H69086|H69086 ABC transporter - Methanobacterium
           thermoautotrophicum  (strain Delta H)>gb:AE000923_29314
           Methanobacterium thermoautotrophicum from bases 1503413
           to 1515108 (section 129 of 148) of the complete
           genome.>gb:AE000666_926396 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 561

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 27/79 (34%), Positives = 36/79 (45%), Gaps = 16/79 (20%)
 Frame = -2

Query: 600 IGRTSDVDMVAASDQGPDFP--------------PNASVEAE--DEPDAAVGLGGAEHRA 469
           +GR    ++    D+ P FP              P   V AE  +EP A+  +G   HRA
Sbjct: 90  VGREVAEELAKLQDEAPPFPFEDVKRVLESELGVPMEEVFAEFQEEPVASASIGQV-HRA 148

Query: 468 EEGRNGDVVAVDERRPDVA 412
              RNGD VAV  +RP +A
Sbjct: 149 RL-RNGDAVAVKVQRPGIA 166



>pir|S24213|S24213 reaction center protein chain M - Rhodobacter
           sphaeroides>gb:RSPUFM_168221 R.sphaeroides Y pufM gene
           for polypeptide M of reaction centre.
          Length = 308

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +1

Query: 301 NDKIG-IYYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDV------PIA 459
           N ++G IY   LG  + F G    ++  I   YQ       W+P V+  D+      P A
Sbjct: 45  NAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAG-----WNPAVFLRDLFFFSLEPPA 99

Query: 460 PFFGPMLSAAQADGGVWLI 516
           P +G   +A   +GG+WLI
Sbjct: 100 PEYGLSFAAPLKEGGLWLI 118



>pir|T50761|T50761 reaction center protein chain M [imported] -
           Rhodobacter sphaeroides>gb:AF195122_487209 Rhodobacter
           sphaeroides photosynthetic gene cluster, partial
           sequence.
          Length = 308

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +1

Query: 301 NDKIG-IYYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDV------PIA 459
           N ++G IY   LG  + F G    ++  I   YQ       W+P V+  D+      P A
Sbjct: 45  NAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAG-----WNPAVFLRDLFFFSLEPPA 99

Query: 460 PFFGPMLSAAQADGGVWLI 516
           P +G   +A   +GG+WLI
Sbjct: 100 PEYGLSFAAPLKEGGLWLI 118



>pir|A03456|WNRFMS reaction center protein chain M - Rhodobacter
           sphaeroides>gb:RCARCM_162566 R.sphaeroides reaction
           center protein m subunit gene and 5'
           flank.>gb:RSP010302_168025 Rhodobacter sphaeroides
           photosynthetic gene cluster.
          Length = 308

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +1

Query: 301 NDKIG-IYYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDV------PIA 459
           N ++G IY   LG  + F G    ++  I   YQ       W+P V+  D+      P A
Sbjct: 45  NAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAG-----WNPAVFLRDLFFFSLEPPA 99

Query: 460 PFFGPMLSAAQADGGVWLI 516
           P +G   +A   +GG+WLI
Sbjct: 100 PEYGLSFAAPLKEGGLWLI 118



>sp|P02953|RCEM_RHOSH Reaction center protein M chain
           (Photosynthetic reaction center M subunit).
          Length = 307

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 7/79 (8%)
 Frame = +1

Query: 301 NDKIG-IYYDRLGTFATFRGQQITYSTAIPPVYQGHKDRNVWSPFVYGNDV------PIA 459
           N ++G IY   LG  + F G    ++  I   YQ       W+P V+  D+      P A
Sbjct: 44  NAQLGPIYLGSLGVLSLFSGLMWFFTIGIWFWYQAG-----WNPAVFLRDLFFFSLEPPA 98

Query: 460 PFFGPMLSAAQADGGVWLI 516
           P +G   +A   +GG+WLI
Sbjct: 99  PEYGLSFAAPLKEGGLWLI 117



>sp|O95206|PCH8_HUMAN Protocadherin 8 precursor
           (Arcadlin).>gb:AF061573_1879901 Homo sapiens
           protocadherin (PCDH8) mRNA, complete
           cds.>gb:AL139085_1920230 Human DNA sequence from clone
           RP11-431O22 on chromosome 13 Contains the 5' end of the
           gene for chondromodulin I precursor (CHM-I), a novel
           gene, the PCDH8 gene for protocadherin 8 and 4 CpG
           islands, complete sequence.
          Length = 1070

 Score = 33.5 bits (75), Expect = 6.0
 Identities = 29/79 (36%), Positives = 35/79 (44%), Gaps = 6/79 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV-AVDERRPDVA 412
           EG NGDVV A   R P  A
Sbjct: 275 EGPNGDVVFAFGARTPPEA 293



>gb:BC053008_2101380 Mus musculus protocadherin 8, mRNA (cDNA clone
           MGC:62192 IMAGE:5698009), complete cds.
          Length = 1070

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 5/68 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV 442
           EG NGDVV
Sbjct: 275 EGPNGDVV 282



>gb:AB026154_2044404 Rattus norvegicus mRNA for arcadlin, complete
           cds.
          Length = 972

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 5/68 (7%)
 Frame = -2

Query: 630 AGSGSVSERNIGRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVG-----LGGAEHRAE 466
           A  G    R+      V ++ A+D  P FP  A  E E   DA VG     L  A+   +
Sbjct: 217 AQDGGRPPRSATAALSVRVLDANDHSPAFPQGAVAEVELAEDAPVGSLLLDLDAAD--PD 274

Query: 465 EGRNGDVV 442
           EG NGDVV
Sbjct: 275 EGPNGDVV 282



>gb:SME591791_186568 Sinorhizobium meliloti 1021 complete
           chromosome; segment 10/12.
          Length = 364

 Score = 33.1 bits (74), Expect = 7.8
 Identities = 26/86 (30%), Positives = 38/86 (44%), Gaps = 5/86 (5%)
 Frame = -2

Query: 597 GRTSDVDMVAASDQGPDFPPNASVEAEDEPDAAVGLGGAEHRAEE-----GRNGDVVAVD 433
           G+T+D   + A D G       ++ + D P +A+ +   EH   E      RN D V VD
Sbjct: 93  GKTADTAKIVAIDTGARIVIAPTIASTDAPCSAIAVRYTEHGVYEEALRLPRNPDAVVVD 152

Query: 432 ERRPDVAVLVALVYRRDSGGIGDLLA 355
                 A++ A   R    GIGD L+
Sbjct: 153 S-----ALVAAAPARFLVAGIGDALS 173


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 710,940,813
Number of Sequences: 1806583
Number of extensions: 13704028
Number of successful extensions: 47401
Number of sequences better than 10.0: 112
Number of HSP's better than 10.0 without gapping: 45195
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47313
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 65138106306
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)