BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3400
         (904 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:FSY298828_1679412 Fagus sylvatica partial mRNA for protein ph...   216   4e-55   
pir|T01385|T01385 probable phosphoprotein phosphatase (EC 3.1.3....   206   6e-52   Arabidopsis thaliana [mouse-ear cress]
gb:FSY298985_1679419 Fagus sylvatica partial mRNA for protein ph...   204   2e-51   
sp|Q8L7U5|BSL1_ARATH|BSL1_ARATH Serine/threonine protein phosphatase BSL1 (...   203   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AC104283_1737487 Oryza sativa (japonica cultivar-group) chrom...   203   4e-51   
sp|Q9SHS7|BSL3_ARATH|BSL3_ARATH Serine/threonine protein phosphatase BSL3 (...   181   2e-44   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SJF0|BSL2_ARATH|BSL2_ARATH Serine/threonine protein phosphatase BSL2 (...   181   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_889366 Arabidopsis thaliana chromosome 1, top arm co...   133   5e-30   
pir|T00913|T00913 probable phosphoprotein phosphatase (EC 3.1.3....   133   5e-30   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LR78|BSU1_ARATH|BSU1_ARATH Serine/threonine protein phosphatase BSU1 (...   133   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb:PFU88869_1395152 Plasmodium falciparum protein serine/threoni...   109   6e-23   
gb:AE014187_939096 Plasmodium falciparum 3D7 chromosome 14 compl...   109   6e-23   
sp|P48480|PP11_ACECL|PP11_ACECL Serine/threonine protein phosphatase PP1 is...    82   1e-14   Acetabularia peniculus
sp|P48481|PP12_ACECL|PP12_ACECL Serine/threonine protein phosphatase PP1 is...    80   4e-14   Acetabularia peniculus
gb:AF383877_1794138 Oryza sativa protein phosphatase mRNA, compl...    80   5e-14   
gb:AY042840_1560905 Arabidopsis thaliana protein phosphatase (MN...    80   5e-14   
pir|S24264|S24264 phosphoprotein phosphatase (EC 3.1.3.16) 1A ca...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
sp|P48482|PP12_ARATH|PP12_ARATH Serine/threonine protein phosphatase PP1 is...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP004662_1842869 Oryza sativa (japonica cultivar-group) genom...    80   7e-14   
pir|T09995|T09995 phosphoprotein phosphatase (EC 3.1.3.16) 1a ca...    80   7e-14   Catharanthus roseus [chatas]
gb:ATU80920_1557299 Arabidopsis thaliana serine/threonine protei...    79   9e-14   
gb:AB000094_1508282 Arabidopsis thaliana gene for inorganic phos...    79   9e-14   
sp|O82733|PP17_ARATH|PP17_ARATH Serine/threonine protein phosphatase PP1 is...    79   9e-14   Arabidopsis thaliana [mouse-ear cress]
sp|O04858|PP13_TOBAC|PP13_TOBAC Serine/threonine protein phosphatase PP1 is...    79   9e-14   Nicotiana tabacum [American tobacco]
sp|P22198|PP1_MAIZE|PP1_MAIZE Serine/threonine protein phosphatase PP1 (EC...    79   2e-13   Zea mays [maize]
pir|T09547|T09547 phosphoprotein phosphatase (EC 3.1.3.16) 1, ca...    78   2e-13   Medicago sativa [alfalfa]
pir|T09550|T09550 phosphoprotein phosphatase (EC 3.1.3.16) 1, ca...    78   2e-13   Medicago sativa [alfalfa]
sp|P48484|PP14_ARATH|PP14_ARATH Serine/threonine protein phosphatase PP1 is...    78   2e-13   Arabidopsis thaliana [mouse-ear cress]
sp|O04856|PP11_TOBAC|PP11_TOBAC Serine/threonine protein phosphatase PP1 is...    78   2e-13   Nicotiana tabacum [American tobacco]
pir|T09544|T09544 phosphoprotein phosphatase (EC 3.1.3.16), cata...    78   3e-13   Medicago sativa [alfalfa]
gb:AB038648_1519261 Vicia faba guard cell protoplasts mRNA for t...    77   3e-13   
gb:AP003764_1833151 Oryza sativa (japonica cultivar-group) genom...    77   5e-13   
gb:AF156101_1773017 Chlamydomonas reinhardtii phosphatase PP1 ge...    77   5e-13   
gb:AE017342_1754860 Cryptococcus neoformans var. neoformans JEC2...    77   5e-13   
gb:AE017342_1754859 Cryptococcus neoformans var. neoformans JEC2...    77   5e-13   
gb:AY087200_1572234 Arabidopsis thaliana clone 32787 mRNA, compl...    77   5e-13   
pir|T09548|T09548 phosphoprotein phosphatase (EC 3.1.3.16) 1 cat...    77   5e-13   Medicago sativa [alfalfa]
pir|T21553|T21553 phosphoprotein phosphatase (EC 3.1.3.16) 1-bet...    77   5e-13   Caenorhabditis elegans [roundworm]
sp|P48489|PP1_ORYSA|PP1_ORYSA Serine/threonine protein phosphatase PP1 (EC...    77   5e-13   Oryza sativa [red rice]
sp|P48485|PP15_ARATH|PP15_ARATH Serine/threonine protein phosphatase PP1 is...    77   5e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP002536_1822462 Oryza sativa (japonica cultivar-group) genom...    77   6e-13   
gb:AY879341_1354920 Schistosoma japonicum unknown protein mRNA, ...    77   6e-13   
gb:AY095072_1298222 Drosophila melanogaster RE17877 full insert ...    77   6e-13   
gb:AE014298_1125065 Drosophila melanogaster chromosome X, comple...    77   6e-13   
sp|P48462|PP1B_DROME|PP1B_DROME Serine/threonine protein phosphatase beta i...    77   6e-13   Drosophila melanogaster
sp|P48483|PP13_ARATH|PP13_ARATH Serine/threonine protein phosphatase PP1 is...    77   6e-13   Arabidopsis thaliana [mouse-ear cress]
gb:CNS07EGH_1374242 chromosome XI of strain GB-M1 of Encephalito...    76   8e-13   
gb:AF049853_1764099 Neurospora crassa serine/threonine protein p...    76   1e-12   
gb:CR382137_1669692 Debaryomyces hansenii chromosome E of strain...    76   1e-12   
gb:CR382126_1658909 Kluyveromyces lactis strain NRRL Y-1140 chro...    76   1e-12   
sp|Q9UW86|PP1_NEUCR|PP1_NEUCR Serine/threonine protein phosphatase PP1 (EC...    76   1e-12   
sp|P20654|PP1_EMENI|PP1_EMENI Serine/threonine protein phosphatase PP1 (EC...    76   1e-12   
gb:BC072730_2556660 Xenopus laevis MGC79074 protein, mRNA (cDNA ...    75   1e-12   
gb:BC053296_2550686 Danio rerio protein phosphatase 1, catalytic...    75   1e-12   
gb:AL929207_2504814 Zebrafish DNA sequence from clone CH211-214P...    75   1e-12   
gb:BT019743_2151518 Synthetic construct Homo sapiens protein pho...    75   1e-12   
gb:BT019744_1991211 Homo sapiens protein phosphatase 1, catalyti...    75   1e-12   
gb:CR380957_1652602 Candida glabrata strain CBS138 chromosome K ...    75   1e-12   
gb:AJ781055_1284025 Drosophila melanogaster Pp1Y2 gene.                75   1e-12   
gb:AF427494_1270018 Drosophila melanogaster protein phosphatase ...    75   1e-12   
gb:AK089067_1175784 Mus musculus 2 days neonate thymus thymic ce...    75   1e-12   
gb:AE014187_938607 Plasmodium falciparum 3D7 chromosome 14 compl...    75   1e-12   
sp|P48487|PP1_BRAOL|PP1_BRAOL Serine/threonine protein phosphatase PP1 (EC...    75   1e-12   Brassica oleracea
sp|P62207|PP1B_CHICK|PP1B_CHICK Serine/threonine protein phosphatase PP1-be...    75   1e-12   Gallus gallus [bantam]
sp|P32598|PP12_YEAST|PP12_YEAST Serine/threonine protein phosphatase PP1-2 ...    75   1e-12   Saccharomyces cerevisiae [brewer's yeast]
gb:AY741676_1349131 Aedes aegypti protein phosphatase 1 alpha (P...    75   2e-12   
sp|P48727|YME1_CAEEL|YME1_CAEEL Putative serine/threonine protein phosphata...    75   2e-12   Caenorhabditis elegans [roundworm]
sp|O04857|PP12_TOBAC|PP12_TOBAC Serine/threonine protein phosphatase PP1 is...    75   2e-12   Nicotiana tabacum [American tobacco]
gb:AF178530_1774713 Malus domestica serine/threonine protein pho...    75   2e-12   
gb:AE016819_1749001 Ashbya gossypii (= Eremothecium gossypii) AT...    75   2e-12   
gb:GPU52691_1680852 Gonyaulax polyedra putative type-1 serine/th...    75   2e-12   
gb:AY086060_1571120 Arabidopsis thaliana clone 20905 mRNA, compl...    75   2e-12   
pir|T13015|T13015 phosphoprotein phosphatase (EC 3.1.3.16) PP1BG...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
sp|P48488|PP1_MEDVA|PP1_MEDVA Serine/threonine protein phosphatase PP1 (EC...    74   3e-12   Medicago sativa subsp. x varia
gb:AY220096_1590428 Phaseolus acutifolius serine threonine prote...    74   4e-12   
gb:AF525131_1422111 Canis familiaris protein phosphatase type 1 ...    74   4e-12   
gb:DME17355_1378796 Drosophila melanogaster PPN 58A gene.              74   4e-12   
gb:AE013599_1133205 Drosophila melanogaster chromosome 2R, compl...    74   4e-12   
sp|P48490|PP1_PHAVU|PP1_PHAVU Serine/threonine protein phosphatase PP1 (EC...    74   4e-12   Phaseolus vulgaris [French bean]
gb:HUMPPPIA_2035835 Human protein phosphatase I alpha subunit (P...    74   5e-12   
gb:AC135208_1742066 Oryza sativa (japonica cultivar-group) chrom...    74   5e-12   
gb:CR382127_1659861 Yarrowia lipolytica chromosome A of strain C...    74   5e-12   
gb:OCPP1_1442267 Rabbit mRNA for protein phosphatase-1 catalytic...    74   5e-12   
gb:OCCPP1A_1442137 Rabbit mRNA for type-1 protein phosphatase 1-...    74   5e-12   
gb:AY062037_1424534 Canis familiaris protein phosphatase type 1 ...    74   5e-12   
gb:AY094722_1297896 Drosophila melanogaster GH20565 full insert ...    74   5e-12   
pir|A46240|A46240 phosphoprotein phosphatase (EC 3.1.3.16) 1-alp...    74   5e-12   Homo sapiens [man]
sp|P62137|PP1A_MOUSE|PP1A_MOUSE Serine/threonine protein phosphatase PP1-al...    74   5e-12   Mus musculus [mouse]
sp|P62136|PP1A_HUMAN|PP1A_HUMAN Serine/threonine protein phosphatase PP1-al...    74   5e-12   Homo sapiens [man]
sp|P13681|PP11_SCHPO|PP11_SCHPO Serine/threonine protein phosphatase PP1-1 ...    74   5e-12   Schizosaccharomyces pombe
gb:AF525129_1422109 Canis familiaris protein phosphatase type 1 ...    73   7e-12   
gb:AC114258_1205575 Dictyostelium discoideum chromosome 2 map co...    73   7e-12   
gb:AK004686_1152510 Mus musculus adult male lung cDNA, RIKEN ful...    73   7e-12   
pir|T21288|T21288 phosphoprotein phosphatase (EC 3.1.3.16) F23B1...    73   9e-12   Caenorhabditis elegans [roundworm]
gb:AY449458_1327275 Oikopleura dioica clone BACOIKO002 4xj18, co...    72   1e-11   
gb:AE013599_1132532 Drosophila melanogaster chromosome 2R, compl...    72   1e-11   
sp|P11612|PPY_DROME|PPY_DROME Serine/threonine protein phosphatase PP-Y (E...    72   1e-11   Drosophila melanogaster
sp|P30366|PP11_ARATH|PP11_ARATH Serine/threonine protein phosphatase PP1 is...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BC041730_2548015 Xenopus laevis Protein phosphatase type 1 al...    72   1e-11   
gb:YSCDIS2S1A_1728817 Saccharomyces cerevisiae protein phosphata...    72   1e-11   
sp|P48486|PP16_ARATH|PP16_ARATH Serine/threonine protein phosphatase PP1 is...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|Q05547|PP13_DROME|PP13_DROME Serine/threonine protein phosphatase alpha-...    72   1e-11   Drosophila melanogaster
gb:BC067911_2554897 Xenopus tropicalis hypothetical protein MGC6...    72   2e-11   
gb:BC054188_2550842 Xenopus laevis protein phosphatase 1, cataly...    72   2e-11   
gb:BC045444_2549281 Danio rerio zgc:76940, mRNA (cDNA clone MGC:...    72   2e-11   
gb:AJ719895_2502082 Gallus gallus mRNA for hypothetical protein,...    72   2e-11   
gb:MMPPICG6_2117040 Mus musculus protein phosphatase 1cgamma (PP...    72   2e-11   
gb:HUMPP1G1X_2035797 Human protein phosphatase-1 gamma 1 mRNA, p...    72   2e-11   
gb:AB030258S5_1865954 Homo sapiens PPP1CC gene for serine/threon...    72   2e-11   
gb:AF427493_1270017 Drosophila melanogaster protein phosphatase ...    72   2e-11   
pir|S29310|S29310 phosphoprotein phosphatase (EC 3.1.3.16) - Par...    72   2e-11   Paramecium tetraurelia
pir|S35700|S35700 phosphoprotein phosphatase (EC 3.1.3.16) 1-gam...    72   2e-11   Homo sapiens [man]
pir|C32550|C32550 phosphoprotein phosphatase (EC 3.1.3.16) 1-gam...    72   2e-11   Mus musculus [mouse]
pir|I76573|I76573 phosphoprotein phosphatase (EC 3.1.3.16) 1-gam...    72   2e-11   Rattus norvegicus [brown rat]
sp|P36873|PP1G_HUMAN|PP1G_HUMAN Serine/threonine protein phosphatase PP1-ga...    72   2e-11   Homo sapiens [man]
sp|P61287|PP1G_BOVIN|PP1G_BOVIN Serine/threonine protein phosphatase PP1-ga...    72   2e-11   Bos taurus [bovine]
gb:BC070008_2555487 Danio rerio zgc:85729, mRNA (cDNA clone MGC:...    71   2e-11   
gb:AY087823_1572850 Arabidopsis thaliana clone 38656 mRNA, compl...    71   2e-11   
gb:AY042854_1560919 Arabidopsis thaliana serine/threonine protei...    71   2e-11   
pir|S12985|S12985 phosphoprotein phosphatase (EC 3.1.3.16) 1 cat...    71   2e-11   Brassica napus [oilseed rape]
pir|T27314|T27314 phosphoprotein phosphatase (EC 3.1.3.16) Y69E1...    71   2e-11   Caenorhabditis elegans [roundworm]
pir|T25259|T25259 phosphoprotein phosphatase (EC 3.1.3.16) T25B9...    71   2e-11   Caenorhabditis elegans [roundworm]
sp|P23777|PP1_BRANA|PP1_BRANA Serine/threonine protein phosphatase PP1 (EC...    71   2e-11   Brassica napus [oilseed rape]
sp|P36874|PP1G_XENLA|PP1G_XENLA Serine/threonine protein phosphatase PP1-ga...    71   2e-11   Xenopus laevis [clawed frog]
sp|O82734|PP18_ARATH|PP18_ARATH Serine/threonine protein phosphatase PP1 is...    71   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:PARPP1B_1391636 Paramecium tetraurelia macronuclear phosphopr...    70   4e-11   
gb:ATAC011620_1543307 Arabidopsis thaliana chromosome III BAC F1...    70   6e-11   
pir|S20882|S20882 phosphoprotein phosphatase (EC 3.1.3.16) 1 cat...    70   6e-11   Arabidopsis thaliana [mouse-ear cress]
gb:S78217_2139537 protein phosphatase 1 gamma 1 [rats, striatum,...    70   7e-11   
gb:U58755_1405375 Caenorhabditis elegans cosmid C34D4, complete ...    70   7e-11   
gb:AF195248_1249803 Plasmodium falciparum PP1-like protein serin...    70   7e-11   
gb:AE013599_1133224 Drosophila melanogaster chromosome 2R, compl...    70   7e-11   
gb:AE014187_938690 Plasmodium falciparum 3D7 chromosome 14 compl...    70   7e-11   
pir|I73629|I73629 phosphoprotein phosphatase (EC 3.1.3.16) 1-gam...    70   7e-11   Rattus sp. [rats]
pir|T29290|T29290 phosphoprotein phosphatase (EC 3.1.3.16) C34D4...    70   7e-11   Caenorhabditis elegans [roundworm]
pir|T25993|T25993 phosphoprotein phosphatase (EC 3.1.3.16) 1 ZK3...    70   7e-11   Caenorhabditis elegans [roundworm]
pir|T21322|T21322 phosphoprotein phosphatase (EC 3.1.3.16) 1 F25...    70   7e-11   Caenorhabditis elegans [roundworm]
sp|P48461|PP11_DROME|PP11_DROME Serine/threonine protein phosphatase alpha-...    70   7e-11   Drosophila melanogaster
gb:CR382136_1669321 Debaryomyces hansenii chromosome D of strain...    69   9e-11   
gb:AF525130_1422110 Canis familiaris protein phosphatase type 1 ...    69   9e-11   
gb:AE014185_937754 Plasmodium falciparum 3D7 chromosome 10 compl...    69   9e-11   
sp|P23880|PP12_SCHPO|PP12_SCHPO Serine/threonine protein phosphatase PP1-2 ...    69   9e-11   Schizosaccharomyces pombe
gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain C...    69   1e-10   
gb:AF001363_1230646 Herdmania curvata protein phosphatase-1 mRNA...    69   1e-10   
pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1...    69   1e-10   Neurospora crassa
pir|C96665|C96665 phosphoprotein phosphatase (EC 3.1.3.16) 1 F22...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:CEC05A2_1360023 Caenorhabditis elegans cosmid C05A2, complete...    69   2e-10   
pir|T18936|T18936 phosphoprotein phosphatase (EC 3.1.3.16) 1-bet...    69   2e-10   Caenorhabditis elegans [roundworm]
sp|P12982|PP12_DROME|PP12_DROME Serine/threonine protein phosphatase alpha-...    69   2e-10   Drosophila melanogaster
gb:ATU80922_1557301 Arabidopsis thaliana serine/threonine protei...    68   2e-10   
gb:CEF22D6_1362832 Caenorhabditis elegans cosmid F22D6, complete...    68   2e-10   
pir|T21256|T21256 hypothetical protein F22D6.9 - Caenorhabditis ...    68   2e-10   Caenorhabditis elegans [roundworm]
pir|T34462|T34462 phosphoprotein phosphatase (EC 3.1.3.16) 1 W09...    68   3e-10   Caenorhabditis elegans [roundworm]
pir|T29191|T29191 phosphoprotein phosphatase (EC 3.1.3.16) 1 T03...    68   3e-10   Caenorhabditis elegans [roundworm]
gb:CR382122_1655259 Kluyveromyces lactis strain NRRL Y-1140 chro...    67   4e-10   
gb:LMFL232_1387844 Leishmania major Friedlin chromosome 14 cosmi...    67   4e-10   
gb:AF190457_1249485 Trypanosoma cruzi type 1 serine/threonine ph...    67   4e-10   
gb:AE016819_1748785 Ashbya gossypii (= Eremothecium gossypii) AT...    67   5e-10   
gb:TBBCHR1A4_1398856 Trypanosoma brucei DNA chromosome 1, segmen...    67   5e-10   
sp|P49576|PPX1_PARTE|PPX1_PARTE Serine/threonine protein phosphatase PP-X h...    67   5e-10   Paramecium tetraurelia
gb:PFU89025_1395153 Plasmodium falciparum protein phosphatase-be...    67   6e-10   
gb:PFA929358_1393473 Plasmodium falciparum strain 3D7, chromosom...    67   6e-10   
gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete ...    67   6e-10   
pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16) Y39B6...    67   6e-10   Caenorhabditis elegans [roundworm]
gb:AE016814_1745912 Ashbya gossypii (= Eremothecium gossypii) AT...    66   8e-10   
gb:FRNINE1_2572048 Fugu rubripes U2 small nuclear ribonucleoprot...    66   1e-09   
gb:CR380949_1649472 Candida glabrata strain CBS138 chromosome C ...    66   1e-09   
gb:AC137988_1208192 Trypanosoma cruzi strain Brener chromosome 3...    66   1e-09   
pir|T14614|T14614 hypothetical protein - Trypanosoma cruzi             66   1e-09   Trypanosoma cruzi
gb:AY054983_1291088 Plasmodium falciparum Dd2 serine/threonine p...    65   1e-09   
gb:AF404815_1268581 Plasmodium falciparum serine/threonine prote...    65   1e-09   
gb:PFMAL13_1191603 Plasmodium falciparum 3D7 chromosome 13, *** ...    65   1e-09   
gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, compl...    65   1e-09   
sp|P32945|PPQ1_YEAST|PPQ1_YEAST Serine/threonine protein phosphatase PPQ (E...    65   1e-09   Saccharomyces cerevisiae [brewer's yeast]
pir|T22522|T22522 phosphoprotein phosphatase (EC 3.1.3.16) 1 F52...    65   2e-09   Caenorhabditis elegans [roundworm]
gb:CR380950_1649867 Candida glabrata strain CBS138 chromosome D ...    64   4e-09   
gb:AF496634_1277092 Oesophagostomum dentatum putative serine/thr...    64   4e-09   
pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16) SPBC3...    64   4e-09   Schizosaccharomyces pombe
pir|T27138|T27138 phosphoprotein phosphatase (EC 3.1.3.16) 1 ZK9...    64   4e-09   Caenorhabditis elegans [roundworm]
gb:BT011200_1357807 Drosophila melanogaster AT31252 full insert ...    64   5e-09   
gb:AF016433_1232316 Caenorhabditis elegans cosmid C09H5, complet...    64   5e-09   
gb:AE014134_1127309 Drosophila melanogaster chromosome 2L, compl...    64   5e-09   
pir|T31766|T31766 phosphoprotein phosphatase (EC 3.1.3.16) 1 C09...    64   5e-09   Caenorhabditis elegans [roundworm]
gb:CEC47A4_1361305 Caenorhabditis elegans cosmid C47A4, complete...    63   7e-09   
gb:AC024135_1204204 Caenorhabditis elegans cosmid C25A6, complet...    63   7e-09   
gb:AF305085_1260700 Trypanosoma brucei serine/threonine protein ...    63   9e-09   
sp|P53043|PPT1_YEAST|PPT1_YEAST Serine/threonine protein phosphatase T (EC ...    62   1e-08   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382131_1664667 Yarrowia lipolytica chromosome E of strain C...    62   2e-08   
gb:EUP515296_1384966 Euplotes octocarinatus macronuclear partial...    62   2e-08   
gb:AE016820_1750090 Ashbya gossypii (= Eremothecium gossypii) AT...    61   3e-08   
gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140 chro...    61   3e-08   
gb:U39851_1403139 Caenorhabditis elegans cosmid C23G10, complete...    61   3e-08   
gb:TCR312136_1399782 Trypanosoma cruzi PP1 gene for putative ser...    61   3e-08   
gb:AC006679_1203699 Caenorhabditis elegans cosmid R13A5, complet...    61   3e-08   
sp|P48459|YSD1_CAEEL|YSD1_CAEEL Putative serine/threonine protein phosphata...    61   3e-08   Caenorhabditis elegans [roundworm]
gb:AC135918_1742825 Oryza sativa (japonica cultivar-group) chrom...    60   4e-08   
gb:AF190456_1249484 Trypanosoma cruzi type 1 serine/threonine ph...    60   4e-08   
gb:AB070573_1197345 Caenorhabditis elegans pph-4.1 mRNA for Ser/...    60   4e-08   
pir|T27390|T27390 phosphoprotein phosphatase (EC 3.1.3.16) Y75B8...    60   4e-08   Caenorhabditis elegans [roundworm]
sp|O35385|PPE2_MOUSE|PPE2_MOUSE Serine/threonine protein phosphatase with E...    60   4e-08   Mus musculus [mouse]
gb:AY182777_1587883 Lycopersicon esculentum type 5 protein serin...    60   6e-08   
gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threon...    60   6e-08   
pir|A99987|A99987 phosphoprotein phosphatase (EC 3.1.3.16) 1 cat...    60   6e-08   Guillardia theta
gb:SCPPH3_1709179 S.cerevisiae PPH3 gene for type 2A-related pro...    60   8e-08   
gb:CR382133_1666444 Debaryomyces hansenii chromosome A of strain...    60   8e-08   
gb:AY182779_1587886 Arabidopsis thaliana type 5 protein serine/t...    60   8e-08   
gb:AY080674_1568404 Arabidopsis thaliana putative phosphoprotein...    60   8e-08   
gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D1...    60   8e-08   
gb:BT015959_1358404 Drosophila melanogaster RH46370 full insert ...    60   8e-08   
gb:AE014296_1137139 Drosophila melanogaster chromosome 3L, compl...    60   8e-08   
pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16) At2g4...    60   8e-08   Arabidopsis thaliana [mouse-ear cress]
sp|P40421|RDGC_DROME|RDGC_DROME Serine/threonine protein phosphatase rdgC (...    60   8e-08   Drosophila melanogaster
sp|O04951|P2A5_ARATH|P2A5_ARATH Serine/threonine protein phosphatase PP2A-5...    60   8e-08   Arabidopsis thaliana [mouse-ear cress]
sp|P32345|P2A3_YEAST|P2A3_YEAST Serine/threonine protein phosphatase PPH3 (...    60   8e-08   Saccharomyces cerevisiae [brewer's yeast]
sp|P34350|YK84_CAEEL|YK84_CAEEL Hypothetical protein C30A5.4 in chromosome ...    59   1e-07   Caenorhabditis elegans [roundworm]
gb:CR380957_1652952 Candida glabrata strain CBS138 chromosome K ...    59   1e-07   
gb:AY087557_1572587 Arabidopsis thaliana clone 36621 mRNA, compl...    59   1e-07   
sp|P48577|P2A_ACECL|P2A_ACECL Serine/threonine protein phosphatase PP2A-1 ...    59   1e-07   Acetabularia peniculus
sp|Q07099|P2A2_ARATH|P2A2_ARATH Serine/threonine protein phosphatase PP2A-2...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:TRBPHOAT1B_1400759 Trypansoma brucei protein phosphatase 1 ca...    59   2e-07   
gb:TCR311369_1399781 Trypanosoma cruzi PP2A gene for putative se...    59   2e-07   
sp|P23734|PP12_TRYBB|PP12_TRYBB Serine/threonine protein phosphatase PP1(5....    59   2e-07   Trypanosoma brucei brucei
sp|P23733|PP11_TRYBB|PP11_TRYBB Serine/threonine protein phosphatase PP1(4....    59   2e-07   Trypanosoma brucei brucei
gb:AF321467_1785940 Yarrowia lipolytica serine/threonine phospha...    58   2e-07   
gb:CR382127_1659626 Yarrowia lipolytica chromosome A of strain C...    58   2e-07   
gb:CR382125_1657666 Kluyveromyces lactis strain NRRL Y-1140 chro...    58   2e-07   
gb:CR548612_1375297 Paramecium tetraurelia macronuclear largest ...    58   2e-07   
gb:CEF58G1_1364797 Caenorhabditis elegans cosmid F58G1, complete...    58   2e-07   
gb:AY902477_1355020 Schistosoma japonicum serine/threonine speci...    58   2e-07   
gb:AC024817_1204822 Caenorhabditis elegans cosmid Y54G2A, comple...    58   2e-07   
pir|S42843|S42843 phosphoprotein phosphatase (EC 3.1.3.16) 1 - C...    58   2e-07   Caenorhabditis elegans [roundworm]
pir|G88572|G88572 protein T16G12.7 [imported] - Caenorhabditis e...    58   2e-07   Caenorhabditis elegans [roundworm]
pir|T27049|T27049 phosphoprotein phosphatase (EC 3.1.3.16) Y49E1...    58   2e-07   Caenorhabditis elegans [roundworm]
sp|P48458|YT91_CAEEL|YT91_CAEEL Putative serine/threonine protein phosphata...    58   2e-07   Caenorhabditis elegans [roundworm]
sp|P48528|PPX2_ARATH|PPX2_ARATH Serine/threonine protein phosphatase PP-X i...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P48579|P2A_HELAN|P2A_HELAN Serine/threonine protein phosphatase PP2A ca...    58   2e-07   Helianthus annuus
gb:AP005562_1854084 Oryza sativa (japonica cultivar-group) genom...    58   3e-07   
gb:AF030978_1234496 Paramecium tetraurelia serine-threonine phos...    58   3e-07   
pir|S42559|S42559 phosphoprotein phosphatase (EC 3.1.3.16) X-2 (...    58   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AF071751_1765806 Neurospora crassa protein phosphatase-Z-like...    57   4e-07   
gb:AF032879_1762665 Arabidopsis thaliana protein phosphatase U (...    57   4e-07   
gb:AC115607_1205912 Dictyostelium discoideum chromosome 2 map 45...    57   4e-07   
sp|Q07098|P2A1_ARATH|P2A1_ARATH Serine/threonine protein phosphatase PP2A-1...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:HSPPEF_2019670 H.sapiens mRNA for serine/threonine protein ph...    57   5e-07   
gb:AE016817_1747483 Ashbya gossypii (= Eremothecium gossypii) AT...    57   5e-07   
gb:YSCPPZ2A_1730343 Saccharomyces cerevisiae type 1-related prot...    57   5e-07   
gb:AY325818_1599646 Lycopersicon esculentum protein phosphatase ...    57   5e-07   
gb:AY099880_1576905 Arabidopsis thaliana phosphoprotein phosphat...    57   5e-07   
gb:AY087612_1572642 Arabidopsis thaliana clone 37057 mRNA, compl...    57   5e-07   
gb:ATPPHOS6_1553879 A.thaliana mRNA encoding protein phosphatase...    57   5e-07   
gb:AB039918_1519377 Vicia faba vfPP2Ac-3 mRNA for type 2A protei...    57   5e-07   
gb:AB039917_1519376 Vicia faba vfPP2Ac-2 mRNA for type 2A protei...    57   5e-07   
gb:PTU29141_1396015 Paramecium tetraurelia protein phosphatase P...    57   5e-07   
gb:CR548612_1375568 Paramecium tetraurelia macronuclear largest ...    57   5e-07   
gb:AF317121_1261827 Trypanosoma cruzi protein phosphatase 1 beta...    57   5e-07   
pir|S35674|S35674 phosphoprotein phosphatase (EC 3.1.3.16) PPZ2 ...    57   5e-07   Saccharomyces cerevisiae [brewer's yeast]
pir|S25532|S25532 phosphoprotein phosphatase (EC 3.1.3.16) 1A ca...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T45670|T45670 phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 ...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P33329|PPZ2_YEAST|PPZ2_YEAST Serine/threonine protein phosphatase PP-Z2 ...    57   5e-07   Saccharomyces cerevisiae [brewer's yeast]
sp|P48529|PPX1_ARATH|PPX1_ARATH Serine/threonine protein phosphatase PP-X i...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P48726|P2A_PARTE|P2A_PARTE Serine/threonine protein phosphatase PP2A ca...    57   5e-07   Paramecium tetraurelia
sp|Q06009|P2A_MEDSA|P2A_MEDSA Serine/threonine protein phosphatase PP2A ca...    57   5e-07   Medicago sativa [alfalfa]
sp|P48578|P2A4_ARATH|P2A4_ARATH Serine/threonine protein phosphatase PP2A-4...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P23635|P2A1_SCHPO|P2A1_SCHPO Minor serine/threonine protein phosphatase ...    57   5e-07   Schizosaccharomyces pombe
gb:AP004996_1846967 Oryza sativa (japonica cultivar-group) genom...    57   6e-07   
gb:AE017341_1754217 Cryptococcus neoformans var. neoformans JEC2...    57   6e-07   
gb:FSY298829_1679413 Fagus sylvatica mRNA for protein phosphatas...    57   6e-07   
gb:AB039916_1519375 Vicia faba vfPP2Ac-1 mRNA for type 2A protei...    57   6e-07   
gb:CNS07EGB_1373140 chromosome IV of strain GB-M1 of Encephalito...    57   6e-07   
pir|T29658|T29658 phosphoprotein phosphatase homolog R08C7.8 - C...    57   6e-07   Caenorhabditis elegans [roundworm]
pir|T03599|T03599 phosphoprotein phosphatase (EC 3.1.3.16) 2A, n...    57   6e-07   Nicotiana tabacum [American tobacco]
sp|O14829|PPE1_HUMAN|PPE1_HUMAN Serine/threonine protein phosphatase with E...    57   6e-07   Homo sapiens [man]
sp|Q9XGT7|P2A3_ORYSA|P2A3_ORYSA Serine/threonine protein phosphatase PP2A-3...    57   6e-07   Oryza sativa [red rice]
gb:AP004729_1843902 Oryza sativa (japonica cultivar-group) genom...    56   8e-07   
gb:AF003389_1231008 Caenorhabditis elegans cosmid F23H11, comple...    56   8e-07   
gb:AE013230_290432 Methanosarcina mazei strain Goe1, section 12 ...    56   8e-07   
pir|T34072|T34072 hypothetical protein F23H11.8 - Caenorhabditis...    56   8e-07   Caenorhabditis elegans [roundworm]
pir|T42239|T42239 probable phosphoprotein phosphatase (EC 3.1.3....    56   8e-07   Caenorhabditis elegans [roundworm]
sp|P78968|PPZ_SCHPO|PPZ_SCHPO Serine/threonine protein phosphatase PP-Z (E...    56   8e-07   Schizosaccharomyces pombe
sp|O04860|P2A5_TOBAC|P2A5_TOBAC Serine/threonine protein phosphatase PP2A-5...    56   8e-07   
sp|Q9ZSS3|P2A1_ORYSA|P2A1_ORYSA Serine/threonine protein phosphatase PP2A-1...    56   8e-07   
gb:AF023457_1877144 Homo sapiens protein phosphatase with EF-han...    56   1e-06   
gb:AE016818_1748478 Ashbya gossypii (= Eremothecium gossypii) AT...    56   1e-06   
gb:YSCPPZ1X_1730342 Saccharomyces cerevisiae Ser/Thr protein pho...    56   1e-06   
gb:CR382136_1669308 Debaryomyces hansenii chromosome D of strain...    56   1e-06   
gb:CR382122_1654842 Kluyveromyces lactis strain NRRL Y-1140 chro...    56   1e-06   
gb:CR380952_1650360 Candida glabrata strain CBS138 chromosome F ...    56   1e-06   
pir|S31163|S31163 phosphoprotein phosphatase (EC 3.1.3.16) 2A-al...    56   1e-06   
pir|S55103|PABY12 phosphoprotein phosphatase (EC 3.1.3.16) PPZ1 ...    56   1e-06   
pir|T32635|T32635 phosphoprotein phosphatase (EC 3.1.3.16) F42G8...    56   1e-06   
sp|P26570|PPZ1_YEAST|PPZ1_YEAST Serine/threonine protein phosphatase PP-Z1 ...    56   1e-06   
sp|O14830|PPE2_HUMAN|PPE2_HUMAN Serine/threonine protein phosphatase with E...    56   1e-06   
sp|Q07100|P2A3_ARATH|P2A3_ARATH Serine/threonine protein phosphatase PP2A-3...    56   1e-06   
sp|P23595|P2A2_YEAST|P2A2_YEAST Serine/threonine protein phosphatase PP2A-2...    56   1e-06   
gb:CR382132_1665529 Yarrowia lipolytica chromosome F of strain C...    55   1e-06   
gb:CR382126_1658587 Kluyveromyces lactis strain NRRL Y-1140 chro...    55   1e-06   
pir|T15581|T15581 phosphoprotein phosphatase (EC 3.1.3.16) C23G1...    55   1e-06   
sp|Q9XF94|P2A2_ORYSA|P2A2_ORYSA Serine/threonine protein phosphatase PP2A-2...    55   1e-06   
sp|P23594|P2A1_YEAST|P2A1_YEAST Serine/threonine protein phosphatase PP2A-1...    55   1e-06   
gb:AE017343_1755930 Cryptococcus neoformans var. neoformans JEC2...    55   2e-06   
gb:CR382132_1665379 Yarrowia lipolytica chromosome F of strain C...    55   2e-06   
gb:CR380955_1651683 Candida glabrata strain CBS138 chromosome I ...    55   2e-06   
gb:AY325817_1599645 Lycopersicon esculentum protein phosphatase ...    55   2e-06   
gb:AC024817_1204821 Caenorhabditis elegans cosmid Y54G2A, comple...    55   2e-06   
gb:AE014298_1126594 Drosophila melanogaster chromosome X, comple...    55   2e-06   
gb:AE011029_268566 Methanosarcina acetivorans str. C2A, section ...    55   2e-06   
pir|B45640|B45640 phosphoprotein phosphatase (EC 3.1.3.16) 1A ca...    55   2e-06   
pir|T22930|T22930 phosphoprotein phosphatase (EC 3.1.3.16) F58G1...    55   2e-06   
sp|P23636|P2A2_SCHPO|P2A2_SCHPO Major serine/threonine protein phosphatase ...    55   2e-06   
gb:AY538590_1612467 Ustilago maydis protein phosphatase 2A gene,...    55   2e-06   
gb:PFA929358_1393496 Plasmodium falciparum strain 3D7, chromosom...    55   2e-06   
gb:AB070574_1197346 Caenorhabditis elegans pph-4.2 mRNA for Ser/...    55   2e-06   
pir|T19427|T19427 phosphoprotein phosphatase (EC 3.1.3.16) C24H1...    55   2e-06   
pir|T19423|T19423 phosphoprotein phosphatase (EC 3.1.3.16) C24H1...    55   2e-06   
sp|Q9XGH7|P2A_TOBAC|P2A_TOBAC Serine/threonine protein phosphatase PP2A ca...    55   2e-06   
gb:CR382137_1669803 Debaryomyces hansenii chromosome E of strain...    54   3e-06   
pir|T22434|T22434 phosphoprotein phosphatase (EC 3.1.3.16) F49E1...    54   3e-06   
gb:BC073033_2556946 Xenopus laevis protein phosphatase 5, mRNA (...    54   4e-06   
gb:BC054321_2550967 Xenopus laevis cDNA clone IMAGE:6873203, par...    54   4e-06   
gb:AF018263_2468871 Xenopus laevis protein phosphatase 5 (PP5) m...    54   4e-06   
gb:AF283668_1783064 Oryza sativa subsp. indica serine/threonine ...    54   4e-06   
gb:AE017345_1756966 Cryptococcus neoformans var. neoformans JEC2...    54   4e-06   
gb:AE017342_1754829 Cryptococcus neoformans var. neoformans JEC2...    54   4e-06   
gb:AC073556_1541131 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...    54   4e-06   
gb:PFMAL3P5_1394516 Plasmodium falciparum MAL3P5, complete seque...    54   4e-06   
gb:AE014296_1135912 Drosophila melanogaster chromosome 3L, compl...    54   4e-06   
gb:AE016959_1022537 Oryza sativa (japonica cultivar-group) chrom...    54   4e-06   
pir|A45640|A45640 phosphoprotein phosphatase (EC 3.1.3.16) 2A ca...    54   4e-06   
sp|Q9SBW3|P2A4_ORYSA|P2A4_ORYSA Serine/threonine protein phosphatase PP2A-4...    54   4e-06   
gb:BC080162_2561592 Xenopus tropicalis ppp5c-prov protein, mRNA ...    54   5e-06   
gb:CR380954_1651265 Candida glabrata strain CBS138 chromosome H ...    54   5e-06   
gb:AF316034_1261795 Trypanosoma cruzi protein phosphatase 1 alph...    54   5e-06   
gb:AF005882_2468220 Fugu rubripes serine/threonine phosphatase (...    53   7e-06   
gb:CR380957_1652569 Candida glabrata strain CBS138 chromosome K ...    53   7e-06   
gb:CER08A2_1366636 Caenorhabditis elegans cosmid R08A2, complete...    53   7e-06   
gb:AY158228_1305123 Trypanosoma cruzi protein phosphatase 2A mRN...    53   7e-06   
gb:AY119179_1300901 Drosophila melanogaster SD01279 full insert ...    53   7e-06   
gb:AF538728_1280203 Trypanosoma cruzi protein phosphatase 2A cat...    53   7e-06   
sp|Q27884|PPV_DROME|PPV_DROME Serine/threonine protein phosphatase PP-V (E...    53   7e-06   
sp|P36614|PPE1_SCHPO|PPE1_SCHPO Serine/threonine protein phosphatase ppe1 (...    53   7e-06   
sp|P20604|PP11_YEAST|PP11_YEAST Serine/threonine protein phosphatase PP1-1 ...    53   7e-06   
gb:RATPP1A_2133495 Rat protein serine-threonine phosphatase cata...    53   9e-06   
gb:PTE567906_1395951 Paramecium tetraurelia macronuclear caN-A2 ...    53   9e-06   
gb:AF176121_1247712 Dictyostelium discoideum protein phosphatase...    53   9e-06   
gb:AF138278_1244118 Dictyostelium discoideum protein phosphatase...    53   9e-06   
gb:AC116963_1206877 Dictyostelium discoideum chromosome 2 map 46...    53   9e-06   
gb:MTU96772_151656 Methanosarcina thermophila protein-serine/thr...    53   9e-06   
pir|T03389|T03389 probable phosphoprotein phosphatase (EC 3.1.3....    53   9e-06   
sp|Q9ZSE4|P2A_HEVBR|P2A_HEVBR Serine/threonine protein phosphatase PP2A ca...    53   9e-06   
gb:BC061369_2553144 Xenopus tropicalis hypothetical protein MGC7...    52   1e-05   
gb:BC049430_2550239 Danio rerio zgc:56413, mRNA (cDNA clone MGC:...    52   1e-05   
gb:CR382124_1656490 Kluyveromyces lactis strain NRRL Y-1140 chro...    52   1e-05   
gb:AF510320_1278377 Trypanosoma cruzi protein phosphatase 2A cat...    52   1e-05   
pir|T19701|T19701 phosphoprotein phosphatase (EC 3.1.3.16) C34C1...    52   1e-05   
sp|Q09496|YQF3_CAEEL|YQF3_CAEEL Putative serine/threonine protein phosphata...    52   1e-05   
gb:AF005884_2468222 Fugu rubripes serine/threonine phosphatase (...    52   2e-05   
gb:MMU79747_2123569 Mus musculus protein phosphatase X homolog (...    52   2e-05   
gb:BT019746_1991212 Homo sapiens protein phosphatase 4 (formerly...    52   2e-05   
gb:AE017344_1756507 Cryptococcus neoformans var. neoformans JEC2...    52   2e-05   
gb:CR382131_1664732 Yarrowia lipolytica chromosome E of strain C...    52   2e-05   
gb:OCPPX_1442273 Rabbit mRNA for protein phosphatase X catalytic...    52   2e-05   
pir|S12986|S12986 phosphoprotein phosphatase (EC 3.1.3.16) 2A ca...    52   2e-05   
pir|S28173|S28173 phosphoprotein phosphatase (EC 3.1.3.16) X cat...    52   2e-05   
sp|P11084|PP4C_RABIT|PP4C_RABIT Serine/threonine protein phosphatase 4 cata...    52   2e-05   
sp|P60510|PP4C_HUMAN|PP4C_HUMAN Serine/threonine protein phosphatase 4 cata...    52   2e-05   
sp|P23778|P2A_BRANA|P2A_BRANA Serine/threonine protein phosphatase PP2A ca...    52   2e-05   
gb:AE016818_1748347 Ashbya gossypii (= Eremothecium gossypii) AT...    52   2e-05   
pir|S60471|S60471 phosphoprotein phosphatase (EC 3.1.3.16) type ...    52   2e-05   
sp|P48580|P2A1_NEUCR|P2A1_NEUCR Serine/threonine protein phosphatase PP2A c...    52   2e-05   
gb:AF424650_1798985 Phytophthora infestans clone MY-06-G-03 seri...    51   3e-05   
gb:CR382135_1668132 Debaryomyces hansenii chromosome C of strain...    51   3e-05   
gb:AF014922_1231917 Paramecium tetraurelia protein phosphatase 2...    51   3e-05   
sp|Q8X178|P2A2_ERYGR|P2A2_ERYGR Serine/threonine protein phosphatase PP2A-2...    51   3e-05   
sp|Q9HFQ2|P2A1_EMENI|P2A1_EMENI Serine/threonine protein phosphatase PP2A c...    51   3e-05   
gb:BC064168_2553721 Xenopus tropicalis protein phosphatase 2A, c...    51   3e-05   
gb:BC045892_2549409 Danio rerio zgc:56064, mRNA (cDNA clone MGC:...    51   3e-05   
gb:BC044495_2548798 Danio rerio zgc:77172, mRNA (cDNA clone MGC:...    51   3e-05   
gb:AJ719537_2501724 Gallus gallus mRNA for hypothetical protein,...    51   3e-05   
gb:BT007581_2150513 Synthetic construct Homo sapiens protein pho...    51   3e-05   
gb:BC019161_2092819 Mus musculus protein phosphatase 2a, catalyt...    51   3e-05   
gb:AF076192_2053568 Mus musculus protein phosphatase type 2A cat...    51   3e-05   
gb:HUMALPHLB_2029148 Human phosphatase 2A mRNA, partial cds.           51   3e-05   
gb:CR457417_1993624 Homo sapiens full open reading frame cDNA cl...    51   3e-05   
gb:BT019526_1991111 Homo sapiens protein phosphatase 2 (formerly...    51   3e-05   
gb:AF444006_1902311 Homo sapiens protein phosphatase type 2A cat...    51   3e-05   
gb:AJ717404_1813795 Aspergillus nidulans sitA gene, exons 1-4.         51   3e-05   
gb:AF448499_1420556 Canis familiaris type 2A protein phosphatase...    51   3e-05   
gb:PFMAL8P1_1192300 Plasmodium falciparum 3D7 chromosome 8, *** ...    51   3e-05   
gb:AK090311_1176215 Mus musculus 0 day neonate cortex cDNA, RIKE...    51   3e-05   
pir|A28029|A28029 phosphoprotein phosphatase (EC 3.1.3.16) 2A ca...    51   3e-05   
pir|B27430|B27430 phosphoprotein phosphatase (EC 3.1.3.16) catal...    51   3e-05   
pir|T31469|T31469 probable phosphoprotein phosphatase (EC 3.1.3....    51   3e-05   
pir|JC4316|JC4316 phosphoprotein phosphatase (EC 3.1.3.16) 2A-be...    51   3e-05   
pir|S20348|S20348 phosphoprotein phosphatase (EC 3.1.3.16) 2A-al...    51   3e-05   
sp|P11611|P2AB_RABIT|P2AB_RABIT Serine/threonine protein phosphatase 2A, ca...    51   3e-05   
sp|P11493|P2AB_PIG|P2AB_PIG Serine/threonine protein phosphatase 2A, cata...    51   3e-05   
sp|P11082|P2AB_HUMAN|P2AB_HUMAN Serine/threonine protein phosphatase 2A, ca...    51   3e-05   
sp|P13353|P2AA_MOUSE|P2AA_MOUSE Serine/threonine protein phosphatase 2A, ca...    51   3e-05   
sp|P05323|P2AA_HUMAN|P2AA_HUMAN Serine/threonine protein phosphatase 2A, ca...    51   3e-05   
sp|P48463|P2AA_CHICK|P2AA_CHICK Serine/threonine protein phosphatase 2A, ca...    51   3e-05   
gb:RNU12203_2136861 Rattus norvegicus phosphoprotein phosphatase...    50   5e-05   
gb:BC078786_2106945 Rattus norvegicus protein phosphatase 5, cat...    50   5e-05   
gb:AE017345_1756909 Cryptococcus neoformans var. neoformans JEC2...    50   5e-05   
gb:AE016818_1748410 Ashbya gossypii (= Eremothecium gossypii) AT...    50   5e-05   
gb:CR382127_1659781 Yarrowia lipolytica chromosome A of strain C...    50   5e-05   
gb:U80444_1406256 Caenorhabditis elegans cosmid F26B1, complete ...    50   5e-05   
gb:CNS07EGC_1373288 chromosome V of strain GB-M1 of Encephalitoz...    50   5e-05   
gb:AY247961_1312730 Isotricha sp. BBF-2003 protein phosphatase I...    50   5e-05   
pir|T30164|T30164 probable phosphoprotein phosphatase (EC 3.1.3....    50   5e-05   
pir|A55346|A55346 phosphoprotein phosphatase (EC 3.1.3.16) PPT [...    50   5e-05   
sp|P53042|PPP5_RAT|PPP5_RAT Serine/threonine protein phosphatase 5 (EC 3....    50   5e-05   
sp|Q60676|PPP5_MOUSE|PPP5_MOUSE Serine/threonine protein phosphatase 5 (EC ...    50   5e-05   
sp|P23696|P2A_DROME|P2A_DROME Serine/threonine protein phosphatase PP2A (E...    50   5e-05   
gb:PPP5C_2039892 Human serine-threonine phosphatase (PP5) mRNA, ...    50   6e-05   
gb:HSRNAPPP5_2020084 H.sapiens mRNA for protein phosphatase 5.         50   6e-05   
gb:BC000750_1967000 Homo sapiens protein phosphatase 5, catalyti...    50   6e-05   
gb:CNS07EGG_1374113 chromosome X of strain GB-M1 of Encephalitoz...    50   6e-05   
gb:CR859667_1183773 Pongo pygmaeus mRNA; cDNA DKFZp459E169 (from...    50   6e-05   
pir|S52570|S52570 phosphoprotein phosphatase (EC 3.1.3.16) 5 [va...    50   6e-05   
sp|P53041|PPP5_HUMAN|PPP5_HUMAN Serine/threonine protein phosphatase 5 (EC ...    50   6e-05   
gb:AF005883_2468221 Fugu rubripes serine/threonine phosphatase (...    50   8e-05   
gb:CR382122_1655042 Kluyveromyces lactis strain NRRL Y-1140 chro...    50   8e-05   
gb:RATPP1D_2133500 Rat protein serine-threonine phosphatase cata...    49   1e-04   
gb:NCB12F1_1689117 Neurospora crassa DNA linkage group II BAC cl...    49   1e-04   
gb:AY064136_1566017 Arabidopsis thaliana AT3g19980/MZE19_3 mRNA,...    49   1e-04   
gb:CEY40H4A_1369894 Caenorhabditis elegans YAC Y40H4A, complete ...    49   1e-04   
gb:AY125925_1301730 Toxoplasma gondii protein phosphatase 2B cat...    49   1e-04   
pir|G36491|G36491 phosphoprotein phosphatase (EC 3.1.3.16) 1d ca...    49   1e-04   
pir|S44808|S44808 F44B9.9 protein - Caenorhabditis elegans             49   1e-04   
pir|T21975|T21975 phosphoprotein phosphatase (EC 3.1.3.16) 2A F3...    49   1e-04   
pir|T51050|T51050 probable phosphoprotein phosphatase (EC 3.1.3....    49   1e-04   
sp|P34430|YL39_CAEEL|YL39_CAEEL Hypothetical protein F44B9.9 in chromosome ...    49   1e-04   
gb:AJ720684_2502871 Gallus gallus mRNA for hypothetical protein,...    49   1e-04   
gb:BT019747_2151520 Synthetic construct Homo sapiens protein pho...    49   1e-04   
gb:AF035158_1877899 Homo sapiens serine/threonine protein phosph...    49   1e-04   
gb:YSCPPGCS_1730337 Saccharomyces cerevisiae serine/threonine pr...    49   1e-04   
gb:FSY298986_1679420 Fagus sylvatica partial mRNA for protein ph...    49   1e-04   
gb:AY558021_1614248 Saccharomyces cerevisiae clone FLH005911.01X...    49   1e-04   
gb:AK002764_1151428 Mus musculus adult male kidney cDNA, RIKEN f...    49   1e-04   
pir|B55346|B55346 phosphoprotein phosphatase (EC 3.1.3.16) PPV -...    49   1e-04   
sp|Q64620|PPP6_RAT|PPP6_RAT Serine/threonine protein phosphatase 6 (EC 3....    49   1e-04   
sp|O00743|PPP6_HUMAN|PPP6_HUMAN Serine/threonine protein phosphatase 6 (EC ...    49   1e-04   
sp|P32838|P2A4_YEAST|P2A4_YEAST Serine/threonine protein phosphatase PP2A-l...    49   1e-04   
gb:CR382136_1669203 Debaryomyces hansenii chromosome D of strain...    49   2e-04   
sp|Q10298|YD44_SCHPO|YD44_SCHPO Putative serine/threonine protein phosphata...    49   2e-04   
gb:RATPP1B_2133498 Rat protein serine-threonine phosphatase cata...    47   4e-04   
gb:BX538352_1359065 Cryptosporidium parvum chromosome 6, complet...    47   4e-04   
pir|E36491|E36491 phosphoprotein phosphatase (EC 3.1.3.16) 1b ca...    47   4e-04   
pir|T09996|T09996 phosphoprotein phosphatase (EC 3.1.3.16) 2a1 c...    47   4e-04   
pir|H96539|H96539 phosphoprotein phosphatase (EC 3.1.3.16) F14I3...    47   4e-04   
gb:AF459442_1801720 Blumeria graminis Ser/Thr protein phosphatas...    47   5e-04   
gb:AF309689_1785003 Neurospora crassa chromosome 4 pdx-1 region.       47   5e-04   
gb:AE017261_419305 Picrophilus torridus DSM 9790, complete genome.     47   5e-04   
gb:AP003450_1829611 Oryza sativa (japonica cultivar-group) genom...    46   9e-04   
gb:AF305635_1784461 Pisum sativum serine/threonine protein phosp...    46   0.001   
gb:AK008835_1154808 Mus musculus adult male stomach cDNA, RIKEN ...    46   0.001   
pir|T17012|T17012 phosphoprotein phosphatase (EC 3.1.3.16) - app...    46   0.001   
gb:CR380959_1654122 Candida glabrata strain CBS138 chromosome M ...    45   0.001   
pir|T26790|T26790 phosphoprotein phosphatase (EC 3.1.3.16) Y40H4...    45   0.001   
gb:BA000023_693060 Sulfolobus tokodaii str. 7 DNA, complete genome.    45   0.002   
pir|G90261|G90261 serine/threonine phosphatase type 1 [imported]...    45   0.002   
pir|T32935|T32935 phosphoprotein phosphatase (EC 3.1.3.16) W03D8...    45   0.002   
gb:U40802_1403447 Caenorhabditis elegans cosmid ZC477, complete ...    45   0.003   
gb:AF287250_1259078 Bombyx mori calcineurin A (cna) mRNA, comple...    45   0.003   
gb:AC115584_1205693 Dictyostelium discoideum chromosome 2 map co...    45   0.003   
pir|S68963|S68963 phosphoprotein phosphatase (EC 3.1.3.16) 3 cat...    45   0.003   
pir|T34421|T34421 hypothetical protein F40E3.5 - Caenorhabditis ...    45   0.003   
pir|T27607|T27607 phosphoprotein phosphatase-related protein ZC4...    45   0.003   
gb:CR382123_1655842 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.003   
pir|JC7241|JC7241 phosphoprotein phosphatase (EC 3.1.3.16), calc...    44   0.004   
gb:RNCALCA_2134561 Rat mRNA for calcineurin A.                         43   0.007   
gb:MUSCNRA_2125496 Mouse brain calmodulin-dependent phosphatase ...    43   0.007   
gb:AX343907_1465941 Sequence 3 from Patent WO0200872.                  43   0.007   
gb:CEC02F4_1359942 Caenorhabditis elegans cosmid C02F4, complete...    43   0.007   
gb:AB041523_1195574 Mizuhopecten yessoensis mRNA for calcineurin...    43   0.007   
pir|T18864|T18864 phosphoprotein phosphatase (EC 3.1.3.16), calc...    43   0.007   
sp|P20652|P2BA_MOUSE|P2BA_MOUSE Serine/threonine protein phosphatase 2B cat...    43   0.007   
gb:BC079027_2107166 Rattus norvegicus cDNA clone MGC:93954 IMAGE...    43   0.010   
gb:BC046617_2099317 Mus musculus protein phosphatase 3, catalyti...    43   0.010   
gb:AE014298_1126007 Drosophila melanogaster chromosome X, comple...    43   0.010   
gb:AE014298_1126006 Drosophila melanogaster chromosome X, comple...    43   0.010   
pir|S70554|S70554 phosphoprotein phosphatase (EC 3.1.3.16), calc...    43   0.010   
pir|S70551|S70551 phosphoprotein phosphatase (EC 3.1.3.16), calc...    43   0.010   
sp|P48455|P2BC_MOUSE|P2BC_MOUSE Serine/threonine protein phosphatase 2B cat...    43   0.010   
gb:BC087175_2565032 Xenopus laevis hypothetical LOC495851, mRNA ...    42   0.012   
gb:AY324833_2527711 Gallus gallus calcineurin A beta mRNA, parti...    42   0.012   
gb:AJ720756_2502943 Gallus gallus mRNA for hypothetical protein,...    42   0.012   
gb:BC066000_2105647 Mus musculus protein phosphatase 3, catalyti...    42   0.012   
gb:HSA488506_2007504 Homo sapiens mRNA for protein phosphatase 3...    42   0.012   
gb:BC028049_1979082 Homo sapiens protein phosphatase 3 (formerly...    42   0.012   
gb:BC004864_1969398 Homo sapiens protein phosphatase 3 (formerly...    42   0.012   
gb:AY007249_1934081 Homo sapiens calcineurin A catalytic subunit...    42   0.012   
gb:AL353731_1923018 Human DNA sequence from clone RP11-345K20 on...    42   0.012   
gb:AJ584614_1422525 Sus scrofa partial mRNA for Calcineurin A pr...    42   0.012   
gb:AF541961_1422365 Oryctolagus cuniculus calcineurin A beta mRN...    42   0.012   
gb:SSU35278_191474 Sulfolobus solfataricus protein-serine/threon...    42   0.012   
pir|JT0976|JT0976 phosphoprotein phosphatase (EC 3.1.3.16) 3-alp...    42   0.012   
pir|A36222|A36222 phosphoprotein phosphatase (EC 3.1.3.16) 3-bet...    42   0.012   
sp|P48454|P2BC_HUMAN|P2BC_HUMAN Serine/threonine protein phosphatase 2B cat...    42   0.012   
sp|P20651|P2BB_RAT|P2BB_RAT Serine/threonine protein phosphatase 2B catal...    42   0.012   


>gb:FSY298828_1679412 Fagus sylvatica partial mRNA for protein
           phosphatase (pp1-1 gene).
          Length = 262

 Score =  216 bits (551), Expect = 4e-55
 Identities = 110/144 (76%), Positives = 115/144 (79%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQL
Sbjct: 119 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQL 178

Query: 723 ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
           ITLFSATNYCGTANNAGAILVVGRG                SP+TSPER+ EDTWMQELN
Sbjct: 179 ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELN 238

Query: 543 IXXXXXXXXXXXXPDLDRNSLAYI 472
           I            PDLDR+SLAYI
Sbjct: 239 IQRPPTPTRGRPQPDLDRSSLAYI 262



>pir|T01385|T01385 probable phosphoprotein phosphatase (EC 3.1.3.16)
            T4I9.4 - Arabidopsis thaliana>gb:ATCHRIV8_1547289
            Arabidopsis thaliana DNA chromosome 4, contig fragment
            No. 8.>gb:AF069442_1765713 Arabidopsis thaliana BAC T4I9,
            chromosome IV, near 17 cM, complete sequence.
          Length = 894

 Score =  206 bits (523), Expect = 6e-52
 Identities = 106/144 (73%), Positives = 111/144 (77%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFAQGQL
Sbjct: 751  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAQGQL 810

Query: 723  ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
            ITLFSATNYCGTANNAGAILVVGRG               LSP+ SPE   +D WMQELN
Sbjct: 811  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN 870

Query: 543  IXXXXXXXXXXXXPDLDRNSLAYI 472
            I            PD DR+SLAYI
Sbjct: 871  IQRPPTPTRGRPQPDFDRSSLAYI 894



>gb:FSY298985_1679419 Fagus sylvatica partial mRNA for protein
           phosphatase 1 (pp1f1 gene) clone FsPP1f1.
          Length = 139

 Score =  204 bits (518), Expect = 2e-51
 Identities = 99/121 (81%), Positives = 103/121 (85%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPTENDS EGLRPNARGPGLVTFGPDRVTDFCK+NKLQLI+RAHECVMDGFERFAQGQL
Sbjct: 5   SDPTENDSAEGLRPNARGPGLVTFGPDRVTDFCKKNKLQLIVRAHECVMDGFERFAQGQL 64

Query: 723 ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
           ITLFSATNYCGTANNAGAILVVGRG                SP+TSPER+ EDTWMQELN
Sbjct: 65  ITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERIQEDTWMQELN 124

Query: 543 I 541
           I
Sbjct: 125 I 125



>sp|Q8L7U5|BSL1_ARATH Serine/threonine protein phosphatase BSL1 (EC
            3.1.3.16) (BSU1-like protein 1).>gb:AY126992_1580449
            Arabidopsis thaliana AT4g03080/T4I9_4 mRNA, complete cds.
          Length = 881

 Score =  203 bits (517), Expect = 3e-51
 Identities = 105/144 (72%), Positives = 110/144 (76%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
            SDPTENDS+EGLRPNARGPGLVTFGPDRVT+FCKRNKLQLIIRAHECVMDGFERFA GQL
Sbjct: 738  SDPTENDSIEGLRPNARGPGLVTFGPDRVTEFCKRNKLQLIIRAHECVMDGFERFAPGQL 797

Query: 723  ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
            ITLFSATNYCGTANNAGAILVVGRG               LSP+ SPE   +D WMQELN
Sbjct: 798  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPILSPENSPEHSGDDAWMQELN 857

Query: 543  IXXXXXXXXXXXXPDLDRNSLAYI 472
            I            PD DR+SLAYI
Sbjct: 858  IQRPPTPTRGRPQPDFDRSSLAYI 881



>gb:AC104283_1737487 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1607_F09, complete sequence.
          Length = 883

 Score =  203 bits (516), Expect = 4e-51
 Identities = 104/144 (72%), Positives = 109/144 (75%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
            SDPTENDSVEGLRPNARGPGLVTFGPDRVT+FCKRN+LQLIIRAHECVMDGFERFA GQL
Sbjct: 740  SDPTENDSVEGLRPNARGPGLVTFGPDRVTEFCKRNRLQLIIRAHECVMDGFERFAHGQL 799

Query: 723  ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
            ITLFSATNYCGTANNAGAILVVGRG                SP++SPER  + TWMQELN
Sbjct: 800  ITLFSATNYCGTANNAGAILVVGRGLVIVPKLIHPLPPPVNSPESSPERAMDATWMQELN 859

Query: 543  IXXXXXXXXXXXXPDLDRNSLAYI 472
            I               DRNSLAYI
Sbjct: 860  IQRPPTPTRGRPQSASDRNSLAYI 883



>sp|Q9SHS7|BSL3_ARATH Serine/threonine protein phosphatase BSL3 (EC
           3.1.3.16) (BSU1-like protein 3).>pir|B84670|B84670
           probable phosphoprotein phosphatase (EC 3.1.3.16)
           At2g27210 [similarity] - Arabidopsis
           thaliana>gb:AC007290_1535769 Arabidopsis thaliana
           chromosome 2 clone T22O13 map B68, complete sequence.
          Length = 715

 Score =  181 bits (459), Expect = 2e-44
 Identities = 89/117 (76%), Positives = 93/117 (79%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPTENDSVEGLRPNARGPGLVTFGPDRV +FC  N LQLI+RAHECVMDGFERFAQG L
Sbjct: 592 SDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHL 651

Query: 723 ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQ 553
           ITLFSATNYCGTANNAGAILV+GR                 SP+TSPER  EDTWMQ
Sbjct: 652 ITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPERHIEDTWMQ 708



>sp|Q9SJF0|BSL2_ARATH Serine/threonine protein phosphatase BSL2 (EC
            3.1.3.16) (BSU1-like protein 2).>pir|E86217|E86217
            probable phosphoprotein phosphatase (EC 3.1.3.16)
            T27G7.10 - Arabidopsis thaliana>gb:AE005172_889847
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:AC006932_1534853 Genomic sequence for
            Arabidopsis thaliana BAC T27G7 from chromosome I,
            complete sequence.
          Length = 1088

 Score =  181 bits (458), Expect = 2e-44
 Identities = 92/125 (73%), Positives = 96/125 (76%), Gaps = 5/125 (4%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFG-----PDRVTDFCKRNKLQLIIRAHECVMDGFERF 739
            SDPTENDSVEGLRPNARGPGLVTFG     PDRV +FC  N LQLI+RAHECVMDGFERF
Sbjct: 939  SDPTENDSVEGLRPNARGPGLVTFGVSNFLPDRVMEFCNNNDLQLIVRAHECVMDGFERF 998

Query: 738  AQGQLITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTW 559
            AQG LITLFSATNYCGTANNAGAILV+GR                 SP+TSPER  EDTW
Sbjct: 999  AQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPALSSPETSPERHIEDTW 1058

Query: 558  MQELN 544
            MQELN
Sbjct: 1059 MQELN 1063



>gb:AE005172_889366 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC002560_1530856 Genomic sequence
            for Arabidopsis thaliana BAC F21B7 from chromosome I,
            complete sequence.
          Length = 846

 Score =  133 bits (334), Expect = 5e-30
 Identities = 70/121 (57%), Positives = 83/121 (68%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
            SDPT ND+V G+  NARG G+V+FGPD V  F +RN L++I+RAHECV+DGFERFA G+L
Sbjct: 716  SDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHECVIDGFERFADGRL 775

Query: 723  ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
            IT+FSATNYCGTA NAGAILV+GR                 S   S E   +  WMQELN
Sbjct: 776  ITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISS---SEEDYTDKAWMQELN 832

Query: 543  I 541
            I
Sbjct: 833  I 833



>pir|T00913|T00913 probable phosphoprotein phosphatase (EC 3.1.3.16)
           F21B7.27 - Arabidopsis thaliana
          Length = 729

 Score =  133 bits (334), Expect = 5e-30
 Identities = 70/121 (57%), Positives = 83/121 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT ND+V G+  NARG G+V+FGPD V  F +RN L++I+RAHECV+DGFERFA G+L
Sbjct: 599 SDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHECVIDGFERFADGRL 658

Query: 723 ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
           IT+FSATNYCGTA NAGAILV+GR                 S   S E   +  WMQELN
Sbjct: 659 ITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISS---SEEDYTDKAWMQELN 715

Query: 543 I 541
           I
Sbjct: 716 I 716



>sp|Q9LR78|BSU1_ARATH Serine/threonine protein phosphatase BSU1 (EC
            3.1.3.16) (Bri1 suppressor protein
            1).>gb:AY372269_1603233 Arabidopsis thaliana BSU1 Ser/Thr
            phosphatase (At1g03445) mRNA, complete cds.
          Length = 793

 Score =  133 bits (334), Expect = 5e-30
 Identities = 70/121 (57%), Positives = 83/121 (68%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
            SDPT ND+V G+  NARG G+V+FGPD V  F +RN L++I+RAHECV+DGFERFA G+L
Sbjct: 663  SDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHECVIDGFERFADGRL 722

Query: 723  ITLFSATNYCGTANNAGAILVVGRGXXXXXXXXXXXXXXXLSPDTSPERVNEDTWMQELN 544
            IT+FSATNYCGTA NAGAILV+GR                 S   S E   +  WMQELN
Sbjct: 723  ITVFSATNYCGTAQNAGAILVIGRDMVIYPKLIHPHPPPISS---SEEDYTDKAWMQELN 779

Query: 543  I 541
            I
Sbjct: 780  I 780



>gb:PFU88869_1395152 Plasmodium falciparum protein serine/threonine
            phosphatase alpha (Pfpp-alpha) gene, complete cds.
          Length = 875

 Score =  109 bits (273), Expect = 6e-23
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 5/89 (5%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPN-ARGPG----LVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERF 739
            SDPT+NDS+ G  PN  R P     +V +GPDRV  F + N LQLIIRAHECVMDGFERF
Sbjct: 752  SDPTDNDSILGTIPNDIRDPDGTGHIVKYGPDRVHKFLEENDLQLIIRAHECVMDGFERF 811

Query: 738  AQGQLITLFSATNYCGTANNAGAILVVGR 652
            A G+LITLFSATNYC +  NAGA+L + R
Sbjct: 812  AGGKLITLFSATNYCNSHKNAGALLFIRR 840



>gb:AE014187_939096 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014826_1228172 Plasmodium falciparum 3D7
            chromosome 14 section 11 of 13 of the complete sequence.
          Length = 889

 Score =  109 bits (273), Expect = 6e-23
 Identities = 57/89 (64%), Positives = 66/89 (74%), Gaps = 5/89 (5%)
 Frame = -2

Query: 903  SDPTENDSVEGLRPN-ARGPG----LVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERF 739
            SDPT+NDS+ G  PN  R P     +V +GPDRV  F + N LQLIIRAHECVMDGFERF
Sbjct: 752  SDPTDNDSILGTIPNDIRDPDGTGHIVKYGPDRVHKFLEENDLQLIIRAHECVMDGFERF 811

Query: 738  AQGQLITLFSATNYCGTANNAGAILVVGR 652
            A G+LITLFSATNYC +  NAGA+L + R
Sbjct: 812  AGGKLITLFSATNYCNSHKNAGALLFIRR 840



>sp|P48480|PP11_ACECL Serine/threonine protein phosphatase PP1
           isozyme 1 (EC 3.1.3.16).>gb:ACPRPH1_1745398 Acetabularia
           cliftonii gene for protein phosphatase 1 (1859bp).
          Length = 319

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 43/82 (52%), Positives = 58/82 (70%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  V+G   N RG    TFGPD VT+F +R+ L L+ RAH+ V DG+E FA+ QL
Sbjct: 204 ADPDKD--VQGWGENDRGVSY-TFGPDTVTEFLQRHDLDLVCRAHQVVEDGYEFFAKRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 261 VTLFSAPNYCGEFDNAGALMSV 282



>sp|P48481|PP12_ACECL Serine/threonine protein phosphatase PP1
           isozyme 2 (EC 3.1.3.16).>gb:ACPRPH2_1745399 Acetabularia
           cliftonii gene for protein phosphatase 1 (1853bp).
          Length = 319

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 44/82 (53%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFGPD VT F +++ L LI RAH+ V DG+E FA+ QL
Sbjct: 204 SDPDKD--VAGWGENDRGVSY-TFGPDTVTGFLQKHDLDLICRAHQVVEDGYEFFAKRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 261 VTLFSAPNYCGEFDNAGALMSV 282



>gb:AF383877_1794138 Oryza sativa protein phosphatase mRNA, complete
           cds.>gb:AP004048_1836913 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1202_E07.>gb:AP004878_1846456 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0474F11.
          Length = 316

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 43/82 (52%), Positives = 59/82 (71%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ ND+ +G   N RG    TFGPD+V++F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 204 SDPS-NDA-QGWAMNDRGVSY-TFGPDKVSEFLEKHDLDLICRAHQVVEDGYEFFANRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 261 VTIFSAPNYCGEFDNAGAMMSV 282



>gb:AY042840_1560905 Arabidopsis thaliana protein phosphatase
           (MNC17.6) mRNA, partial cds.
          Length = 223

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 42/82 (51%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFGPD+V +F  +N + LI RAH+ V DG+E FA  QL
Sbjct: 124 SDPSKD--VKGWGMNDRGVSY-TFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFFADRQL 180

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 181 VTIFSAPNYCGEFDNAGAMMSV 202



>pir|S24264|S24264 phosphoprotein phosphatase (EC 3.1.3.16) 1A
           catalytic chain - Arabidopsis
           thaliana>gb:ATPPHOS1_1553878 A.thaliana mRNA encoding
           protein phosphatase 1A.
          Length = 312

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 42/82 (51%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFGPD+V +F  +N + LI RAH+ V DG+E FA  QL
Sbjct: 213 SDPSKD--VKGWGMNDRGVSY-TFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFFADRQL 269

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 270 VTIFSAPNYCGEFDNAGAMMSV 291



>sp|P48482|PP12_ARATH Serine/threonine protein phosphatase PP1
           isozyme 2 (EC 3.1.3.16).>pir|S31086|S31086
           phosphoprotein phosphatase (EC 3.1.3.16) 1 catalytic
           chain  (clone TOPP2) - Arabidopsis
           thaliana>gb:AB016890_1513206 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MNC17.>gb:ATHPPHAA_1553310 Arabidopsis thaliana
           phosphoprotein phophatase-type 1 catalytic subunit mRNA,
           complete cds.>gb:BT002401_1636004 Arabidopsis thaliana
           phosphoprotein phosphatase 1 catalytic chain (At5g59160)
           mRNA, complete cds.
          Length = 312

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 42/82 (51%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFGPD+V +F  +N + LI RAH+ V DG+E FA  QL
Sbjct: 213 SDPSKD--VKGWGMNDRGVSY-TFGPDKVAEFLIKNDMDLICRAHQVVEDGYEFFADRQL 269

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 270 VTIFSAPNYCGEFDNAGAMMSV 291



>gb:AP004662_1842869 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0048G02.>gb:AP005483_1852659 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:B1144B06.
          Length = 307

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 43/82 (52%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP    S  G   N RG    TFG D+VT+F  ++ L LI RAH+ V DG+E FA  QL
Sbjct: 208 SDPDRESS--GWGENDRGVSF-TFGADKVTEFLNKHDLDLICRAHQVVEDGYEFFADRQL 264

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  NNAGA++ V
Sbjct: 265 VTIFSAPNYCGEFNNAGALMNV 286



>pir|T09995|T09995 phosphoprotein phosphatase (EC 3.1.3.16) 1a
           catalytic chain - Madagascar
           periwinkle>gb:CRO7332_1673484 Catharanthus roseus mRNA
           for type 1 Ser/Thr protein phosphatase.
          Length = 326

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 42/82 (51%), Positives = 58/82 (70%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFGPD+V +F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 203 SDPSKD--VKGWGLNDRGVSY-TFGPDKVKEFLQKHDLDLICRAHQVVEDGYEFFADRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 260 VTIFSAPNYCGEFDNAGAMMSV 281



>gb:ATU80920_1557299 Arabidopsis thaliana serine/threonine protein
           phosphatase type one (TOPP7) mRNA, complete cds.
          Length = 316

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 45/82 (54%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G  PN RG    TFG D V+ F KR  L LI RAH+ V DGFE FA  QL
Sbjct: 202 SDPDKD--VRGWGPNDRGVSY-TFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQL 258

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 259 VTIFSAPNYCGEFDNAGAMMSV 280



>gb:AB000094_1508282 Arabidopsis thaliana gene for inorganic
           phosphate transporter, protein phosphatase 1 catalytic
           subunit, complete cds.>gb:AB025638_1516665 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1 clone:MWF20.
          Length = 327

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 45/82 (54%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G  PN RG    TFG D V+ F KR  L LI RAH+ V DGFE FA  QL
Sbjct: 203 SDPDKD--VRGWGPNDRGVSY-TFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 260 VTIFSAPNYCGEFDNAGAMMSV 281



>sp|O82733|PP17_ARATH Serine/threonine protein phosphatase PP1
           isozyme 7 (EC 3.1.3.16).>gb:AY136464_1581964 Arabidopsis
           thaliana expressed protein (At5g43380) mRNA, complete
           cds.>gb:BT002143_1635746 Arabidopsis thaliana expressed
           protein (At5g43380) mRNA, complete cds.
          Length = 331

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 45/82 (54%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G  PN RG    TFG D V+ F KR  L LI RAH+ V DGFE FA  QL
Sbjct: 203 SDPDKD--VRGWGPNDRGVSY-TFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 260 VTIFSAPNYCGEFDNAGAMMSV 281



>sp|O04858|PP13_TOBAC Serine/threonine protein phosphatase PP1
           isozyme 3 (EC 3.1.3.16).>pir|T03597|T03597
           phosphoprotein phosphatase (EC 3.1.3.16) 1, npp3 -
           common tobacco>gb:NTNPP3_1691626 N.tabacum npp3 mRNA for
           protein phosphatase type 1.
          Length = 304

 Score = 79.3 bits (194), Expect = 9e-14
 Identities = 40/82 (48%), Positives = 58/82 (70%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFGPD+V++F  ++ L L+ RAH+ V DG+E FA+ +L
Sbjct: 204 SDPGKD--VKGWGMNDRGVSY-TFGPDKVSEFLSKHDLDLVCRAHQVVEDGYEFFAESEL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 261 VTIFSAPNYCGEFDNAGAMMSV 282



>sp|P22198|PP1_MAIZE Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|S29317|S29317 phosphoprotein phosphatase
           (EC 3.1.3.16) 1 - maize>gb:MZEZMPP1_1688095 Z.mays
           protein phosphatase-1 (ZmPP1) mRNA, complete cds.
          Length = 316

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 41/82 (50%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+  +   G   N RG    TFGPD+V++F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 204 SDPS--NEATGWAINDRGVSF-TFGPDKVSEFLEKHDLDLICRAHQVVEDGYEFFASRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 261 VTIFSAPNYCGEFDNAGAMMSV 282



>pir|T09547|T09547 phosphoprotein phosphatase (EC 3.1.3.16) 1,
           catalytic gsmma chain - alfalfa>gb:MSAJ2486_1687049
           Medicago sativa mRNA for protein phosphatase 1, gamma
           subunit.
          Length = 325

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 40/82 (48%), Positives = 58/82 (70%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFG D++T+F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 202 SDPSKD--VQGWGMNDRGVSY-TFGADKITEFLEKHDLDLICRAHQVVEDGYEFFANRQL 258

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T++SA NYCG  +NAGA++ V
Sbjct: 259 VTIYSAPNYCGEFDNAGAMMSV 280



>pir|T09550|T09550 phosphoprotein phosphatase (EC 3.1.3.16) 1,
           catalytic epsilon chain - alfalfa>gb:MSAJ2488_1687051
           Medicago sativa mRNA for protein phosphatase 1, epsilon
           subunit.
          Length = 323

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 40/74 (54%), Positives = 51/74 (68%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V+G   N RG    TFGPD+V +F  R+ L LI RAH+ V DG+E FA  QL+T+FSA N
Sbjct: 225 VKGWGMNDRGVSY-TFGPDKVAEFLTRHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPN 283

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 284 YCGEFDNAGAMMSV 297



>sp|P48484|PP14_ARATH Serine/threonine protein phosphatase PP1
           isozyme 4 (EC 3.1.3.16).>pir|S31088|S31088
           phosphoprotein phosphatase (EC 3.1.3.16) 1 catalytic
           chain  (clone TOPP4) - Arabidopsis
           thaliana>gb:AC003000_1530929 Arabidopsis thaliana
           chromosome 2 clone T5I7 map CIC10A06, complete
           sequence.>gb:ATHPPHAC_1553312 Arabidopsis thaliana
           phosphoprotein phosphatase-type 1 catalytic subunit
           mRNA, complete cds.
          Length = 321

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFGPD+V++F  ++ L L+ RAH+ V DG+E FA  QL
Sbjct: 217 SDPGKD--VKGWGMNDRGVSY-TFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQL 273

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 274 VTVFSAPNYCGEFDNAGAMMSV 295



>sp|O04856|PP11_TOBAC Serine/threonine protein phosphatase PP1
           isozyme 1 (EC 3.1.3.16).>pir|T03594|T03594
           phosphoprotein phosphatase (EC 3.1.3.16) 1 - common
           tobacco>gb:NTNPP1_1691624 N.tabacum npp1 mRNA for
           protein phosphatase type 1.
          Length = 317

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+    V+G   N RG    TFGPD+V +F  ++ + L+ RAH+ V DG+E FA+ QL
Sbjct: 218 SDPSRE--VKGWGMNDRGVSY-TFGPDKVAEFLMQHDMDLVCRAHQVVEDGYEFFAERQL 274

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 275 VTIFSAPNYCGEFDNAGAMMSV 296



>pir|T09544|T09544 phosphoprotein phosphatase (EC 3.1.3.16),
           catalytic beta chain - alfalfa>gb:MSAJ2485_1687048
           Medicago sativa mRNA for protein phosphatase 1, beta
           subunit.
          Length = 326

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP++   V+G   N RG    TFG D+V++F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 203 SDPSKE--VQGWGMNDRGVSY-TFGADKVSEFLQKHDLDLICRAHQVVEDGYEFFANRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 260 VTIFSAPNYCGEFDNAGAMMSV 281



>gb:AB038648_1519261 Vicia faba guard cell protoplasts mRNA for type
           1 protein phosphatase-1, complete cds.
          Length = 323

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  V+G   N RG    TFGPD+V +F   + L LI RAH+ V DG+E FA  QL
Sbjct: 219 SDPGRD--VKGWGMNDRGVSY-TFGPDKVAEFLSMHDLDLICRAHQVVEDGYEFFADRQL 275

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 276 VTIFSAPNYCGEFDNAGAMMSV 297



>gb:AP003764_1833151 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1051E10.
          Length = 318

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ +   EG   + RG    TFG D++ +F ++N L LI RAH+ V DG+E FAQ +L
Sbjct: 205 SDPSPDS--EGWGESDRGVSC-TFGADKLVEFLEKNDLDLICRAHQVVEDGYEFFAQRRL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA+L +
Sbjct: 262 VTIFSAPNYCGEFDNAGALLSI 283



>gb:AF156101_1773017 Chlamydomonas reinhardtii phosphatase PP1 gene,
           complete cds.
          Length = 304

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 39/82 (47%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  ++G   N RG    TFGPD VT+F +++ L L+ RAH+ V +G+E FA+ QL
Sbjct: 204 ADPDKD--IQGWGENDRGVSY-TFGPDCVTEFLQKHDLDLVCRAHQVVEEGYEFFAKRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG   NAGA++ V
Sbjct: 261 VTIFSAPNYCGEFENAGAMMSV 282



>gb:AE017342_1754860 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.>gb:AE017342_1754861
           Cryptococcus neoformans var. neoformans JEC21 chromosome
           2, complete sequence.
          Length = 314

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 41/82 (50%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AE017342_1754859 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 328

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 41/82 (50%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AY087200_1572234 Arabidopsis thaliana clone 32787 mRNA, complete
           sequence.
          Length = 304

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFG D+V +F  +N + L+ RAH+ V DG+E FA  QL
Sbjct: 205 SDPSKD--VKGWGMNDRGVSY-TFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 262 VTMFSAPNYCGEFDNAGALMSV 283



>pir|T09548|T09548 phosphoprotein phosphatase (EC 3.1.3.16) 1
           catalytic chain delta - alfalfa>gb:MSAJ2487_1687050
           Medicago sativa mRNA for protein phosphatase 1, delta
           subunit.
          Length = 326

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ +  V G   + RG    TFG DRV +F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 203 SDPSSD--VRGWGESERGVSY-TFGADRVKEFLQKHDLDLICRAHQVVEDGYEFFANRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 260 VTIFSAPNYCGEFDNAGAMMTV 281



>pir|T21553|T21553 phosphoprotein phosphatase (EC 3.1.3.16) 1-beta
           F29F11.6 [similarity] - Caenorhabditis
           elegans>gb:CEF29F11_1363167 Caenorhabditis elegans
           cosmid F29F11, complete sequence.
          Length = 329

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 43/82 (52%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFGPD V  F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VTGWGENDRGVSF-TFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGGMMSV 285



>sp|P48489|PP1_ORYSA Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|T03304|T03304 probable phosphoprotein
           phosphatase (EC 3.1.3.16) 1 catalytic chain -
           rice>gb:OSU31773_1698432 Oryza sativa protein
           phosphatase 1 mRNA, complete cds.
          Length = 317

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 41/82 (50%), Positives = 57/82 (69%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D+V++F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 213 SDPGKD--VQGWGMNDRGVSY-TFGADKVSEFLEKHDLDLICRAHQVVEDGYEFFADRQL 269

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 270 VTIFSAPNYCGEFDNAGAMMSV 291



>sp|P48485|PP15_ARATH Serine/threonine protein phosphatase PP1
           isozyme 5 (EC 3.1.3.16).>pir|S31089|S31089
           phosphoprotein phosphatase (EC 3.1.3.16) 1 catalytic
           chain  (clone TOPP5) - Arabidopsis
           thaliana>gb:ATHPPHAD_1553313 Arabidopsis thaliana
           phosphoprotein phosphatase-type 1 catalytic site mRNA,
           complete cds.>gb:ATT6H20_1556349 Arabidopsis thaliana
           DNA chromosome 3, BAC clone T6H20.
          Length = 312

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+++  V+G   N RG    TFG D+V +F  +N + L+ RAH+ V DG+E FA  QL
Sbjct: 213 SDPSKD--VKGWGMNDRGVSY-TFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQL 269

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 270 VTMFSAPNYCGEFDNAGALMSV 291



>gb:AP002536_1822462 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0015I14.
          Length = 322

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 40/82 (48%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   N RG    TFG D+V +F + + L LI RAH+ V DG+E FA+ QL
Sbjct: 204 SDPDKE--IEGWGENDRGVSY-TFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ +
Sbjct: 261 VTIFSAPNYCGEFDNAGAMMSI 282



>gb:AY879341_1354920 Schistosoma japonicum unknown protein mRNA,
           complete cds.
          Length = 327

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 43/82 (52%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFGPD V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VSGWGENDRGVSY-TFGPDIVARFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AY095072_1298222 Drosophila melanogaster RE17877 full insert
           cDNA.
          Length = 330

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 42/82 (51%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R++L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMTV 284



>gb:AE014298_1125065 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003450_1210247 Drosophila melanogaster
           chromosome X, section 34 of 74 of the complete
           sequence.>gb:AY069047_1293777 Drosophila melanogaster
           GH05039 full length cDNA.
          Length = 461

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 42/82 (51%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R++L LI RAH+ V DG+E FA+ QL
Sbjct: 337 SDPDKD--VQGWGENDRGVSF-TFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQL 393

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 394 VTLFSAPNYCGEFDNAGGMMTV 415



>sp|P48462|PP1B_DROME Serine/threonine protein phosphatase beta
           isoform (EC 3.1.3.16) (Flap wing
           protein).>pir|S13828|S13828 phosphoprotein phosphatase
           (EC 3.1.3.16) 1-beta catalytic chain - fruit fly
           (Drosophila melanogaster)>gb:AE014298_1125066 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003450_1210248 Drosophila melanogaster
           chromosome X, section 34 of 74 of the complete
           sequence.>gb:DME249214_1379009 Drosophila melanogaster
           partial PP1beta9C gene for serine/threonine protein
           phosphatase, exon 1 and joined CDS.>gb:DMPP1B_1379984
           D.melanogaster PP1-beta 9C gene for protein phosphatase
           1.
          Length = 330

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 42/82 (51%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R++L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMTV 284



>sp|P48483|PP13_ARATH Serine/threonine protein phosphatase PP1
           isozyme 3 (EC 3.1.3.16).>pir|S31087|S31087
           phosphoprotein phosphatase (EC 3.1.3.16) 1 (clone TOPP3)
           [similarity] - Arabidopsis thaliana>gb:ATHPPHAB_1553311
           Arabidopsis thaliana phosphoprotein phosphatase-type 1
           catalytic subunit mRNA, complete
           cds.>gb:AY081338_1568684 Arabidopsis thaliana putative
           serine/threonine protein phosphatase PP1 isozyme 3
           (At1g64040) mRNA, complete cds.>gb:AY128830_1580910
           Arabidopsis thaliana putative serine/threonine protein
           phosphatase PP1 isozyme 3 (At1g64040) mRNA, complete
           cds.
          Length = 322

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  +EG   N RG    TFG D+V +F + + L LI RAH+ V DG+E FA  QL
Sbjct: 204 SDPDKD--IEGWGENDRGVSY-TFGADKVEEFLQTHDLDLICRAHQVVEDGYEFFANRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 261 VTIFSAPNYCGEFDNAGAMMSV 282



>gb:CNS07EGH_1374242 chromosome XI of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 317

 Score = 76.3 bits (186), Expect = 8e-13
 Identities = 43/84 (51%), Positives = 53/84 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + SV G   N RG   VTFGPD V  F + + L LI RAH+ V DG+E FA   L
Sbjct: 206 SDP--DPSVRGWGENDRGVS-VTFGPDTVERFLEAHNLDLICRAHQVVEDGYEFFANRSL 262

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA NYCG   N+GAI+ V +
Sbjct: 263 VTVFSAPNYCGEFENSGAIMDVDK 286



>gb:AF049853_1764099 Neurospora crassa serine/threonine protein
           phosphatase type 1 (pp1) mRNA, complete cds.
          Length = 308

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E F++ QL
Sbjct: 207 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:CR382137_1669692 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 328

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E F++ QL
Sbjct: 207 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:CR382126_1658909 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 311

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F ++  ++LI RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--IVGWSENDRGVSF-TFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGAMMSV 284



>sp|Q9UW86|PP1_NEUCR Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>gb:AF124149_1770233 Neurospora crassa protein
           phosphatase-1 (ppp-1) gene, complete cds.
          Length = 308

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E F++ QL
Sbjct: 207 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|P20654|PP1_EMENI Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|A32549|A32549 phosphoprotein phosphatase
           (EC 3.1.3.16) bimG - Emericella
           nidulans>gb:EMEBIMG_1676602 Aspergillus nidulans
           phosphoprotein phosphatase 1 mRNA, complete cds.
          Length = 323

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F +++ + LI RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--ITGWSENDRGVSF-TFGPDVVSRFLQKHDMDLICRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGAMMSV 284



>gb:BC072730_2556660 Xenopus laevis MGC79074 protein, mRNA (cDNA
           clone MGC:79074 IMAGE:4963300), complete
           cds.>gb:BC088594_2565724 Xenopus tropicalis hypothetical
           LOC496958, mRNA (cDNA clone MGC:97826 IMAGE:6992035),
           complete cds.
          Length = 327

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:BC053296_2550686 Danio rerio protein phosphatase 1, catalytic
           subunit, beta isoform, like, mRNA (cDNA clone MGC:64169
           IMAGE:6797400), complete cds.
          Length = 281

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 160 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 216

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 217 VTLFSAPNYCGEFDNAGGMMSV 238



>gb:AL929207_2504814 Zebrafish DNA sequence from clone CH211-214P16
           in linkage group 17 Contains a novel gene for a protein
           similar to human mitochondrial isoleucine tRNA
           synthetase, a novel gene similar to RAB3GAP (RAB3
           GTPase-activating protein), a novel gene similar to
           PPP1CB (protein phosphatase 1, catalytic subunit, beta
           isoform), two novel genes and a CpG island, complete
           sequence.
          Length = 327

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:BT019743_2151518 Synthetic construct Homo sapiens protein
           phosphatase 1, catalytic subunit, beta isoform mRNA,
           partial cds.
          Length = 328

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:BT019744_1991211 Homo sapiens protein phosphatase 1, catalytic
           subunit, beta isoform mRNA, complete cds.
          Length = 327

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:CR380957_1652602 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 312

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V  F ++  ++LI RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--IVGWSENDRGVSF-TFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGAMMSV 284



>gb:AJ781055_1284025 Drosophila melanogaster Pp1Y2 gene.
          Length = 309

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/82 (52%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  + G   N RG   VTFG D V  F  R+K  LI RAH+ V DG+E FA+ QL
Sbjct: 205 SDP--DPKIMGWSDNDRGVS-VTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           IT+FSA NYCG  +NAGA++ V
Sbjct: 262 ITIFSAPNYCGEFDNAGAMMSV 283



>gb:AF427494_1270018 Drosophila melanogaster protein phosphatase 1
           catalytic subunit (Pp1Y2) mRNA, complete cds.
          Length = 309

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 43/82 (52%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  + G   N RG   VTFG D V  F  R+K  LI RAH+ V DG+E FA+ QL
Sbjct: 205 SDP--DPKIMGWSDNDRGVS-VTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           IT+FSA NYCG  +NAGA++ V
Sbjct: 262 ITIFSAPNYCGEFDNAGAMMSV 283



>gb:AK089067_1175784 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430038F13 product:protein phosphatase 1,
           catalytic subunit, beta isoform, full insert sequence.
          Length = 327

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:AE014187_938607 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014818_1227683 Plasmodium falciparum 3D7
           chromosome 14 section 3 of 13 of the complete
           sequence.>gb:AF395422_1267744 Plasmodium falciparum
           protein phosphatase type 1 mRNA, complete cds.
          Length = 304

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   + G   N RG    TFG D V +F ++++L LI RAH+ V DG+E FA+ QL
Sbjct: 205 SDPEKE--INGWGENDRGVSF-TFGQDVVHNFLRKHELDLICRAHQVVEDGYEFFAKRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 262 VTLFSAPNYCGEFDNAGAMMSV 283



>sp|P48487|PP1_BRAOL Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|S26225|S26225 phosphoprotein phosphatase
           (EC 3.1.3.16) 1 - wild cabbage>gb:BOBOPP1_1633745
           B.oleracea mRNA for type 1 protein serine/threonine
           phosphatase.
          Length = 316

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/82 (47%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ +  V+G   N RG    TFG D V +F ++N + LI RAH+ V DG+E FA+ Q+
Sbjct: 221 SDPSGD--VKGWGANDRGVSY-TFGADTVAEFLQKNDMDLICRAHQVVEDGYEFFAERQV 277

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ +
Sbjct: 278 VTVFSAPNYCGEFDNAGAMMSI 299



>sp|P62207|PP1B_CHICK Serine/threonine protein phosphatase PP1-beta
           catalytic subunit (EC 3.1.3.16)
           (PP-1B).>sp|P62140|PP1B_HUMAN Serine/threonine protein
           phosphatase PP1-beta catalytic subunit (EC 3.1.3.16)
           (PP-1B).>sp|P62141|PP1B_MOUSE Serine/threonine protein
           phosphatase PP1-beta catalytic subunit (EC 3.1.3.16)
           (PP-1B).>sp|P61292|PP1B_PIG Serine/threonine protein
           phosphatase PP1-beta catalytic subunit (EC 3.1.3.16)
           (PP-1B).>sp|P62143|PP1B_RABIT Serine/threonine protein
           phosphatase PP1-beta catalytic subunit (EC 3.1.3.16)
           (PP-1B).>sp|P62142|PP1B_RAT Serine/threonine protein
           phosphatase PP1-beta catalytic subunit (EC 3.1.3.16)
           (PP-1B).>pir|D32550|D32550 phosphoprotein phosphatase
           (EC 3.1.3.16) 1-beta catalytic chain [similarity] -
           mouse>pir|S13829|S13829 phosphoprotein phosphatase (EC
           3.1.3.16) 1-beta catalytic chain [validated] -
           rabbit>pir|S41052|S41052 phosphoprotein phosphatase (EC
           3.1.3.16) 1-beta [validated] - human>pir|I73630|I73630
           phosphoprotein phosphatase (EC 3.1.3.16) 1-beta
           catalytic chain - rat>pir|I76571|I76571 phosphoprotein
           phosphatase (EC 3.1.3.16) catalytic chain 1b -
           rat>gb:AK088893_1175687 Mus musculus 2 days neonate
           thymus thymic cells cDNA, RIKEN full-length enriched
           library, clone:E430030E07 product:protein phosphatase 1,
           catalytic subunit, beta isoform, full insert
           sequence.>gb:CR860278_1184365 Pongo pygmaeus mRNA; cDNA
           DKFZp459E215 (from clone
           DKFZp459E215).>gb:AB016735_1407846 Sus scrofa mRNA for
           protein phosphatase-1 delta, complete
           cds.>gb:OCPP1B_1442269 O.cuniculus PP1-beta gene for
           protein phosphatase 1.>gb:AF092905_1882679 Homo sapiens
           protein phosphatase type-1 catalytic subunit delta
           isoform (PPCS1D) mRNA, complete cds.>gb:BC002697_1968332
           Homo sapiens protein phosphatase 1, catalytic subunit,
           beta isoform, transcript variant 1, mRNA (cDNA clone
           MGC:3672 IMAGE:3609386), complete
           cds.>gb:BC012045_1973395 Homo sapiens protein
           phosphatase 1, catalytic subunit, beta isoform,
           transcript variant 1, mRNA (cDNA clone MGC:10563
           IMAGE:3631338), complete cds.>gb:CR542263_1994488 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834D1126D for gene PPP1CB, protein phosphatase 1,
           catalytic subunit, beta isoform; complete cds, incl.
           stopcodon.>gb:CR542285_1994509 Homo sapiens full open
           reading frame cDNA clone RZPDo834H1226D for gene PPP1CB,
           protein phosphatase 1, catalytic subunit, beta isoform;
           complete cds, without stopcodon.>gb:HSPPP1CB_2019677
           H.sapiens PPP1CB mRNA.>gb:HSPPP1CB8_2019678 Human type-1
           protein phosphatase catalytic beta-subunit (PPP1CB)
           gene, exon 8 and complete cds.>gb:BC046832_2099406 Mus
           musculus protein phosphatase 1, catalytic subunit, beta
           isoform, mRNA (cDNA clone MGC:61405 IMAGE:6812937),
           complete cds.>gb:BC062033_2104809 Rattus norvegicus
           protein phosphatase 1, catalytic subunit, beta isoform,
           mRNA (cDNA clone MGC:72523 IMAGE:5623630), complete
           cds.>gb:MUSDIS2M2A_2125673 Mus musuculus protein
           phosphatase type 1 (dis2m2) mRNA, complete
           cds.>gb:RATPP1DA_2133501 Rattus norvegicus mRNA for
           catalytic subunit of protein phosphatase 1, complete
           cds, clone:PP-1 delta.>gb:S78218_2139538 protein
           phosphatase 1 beta [rats, striatum, mRNA, 2668
           nt].>gb:CHK130KDC_2568708 Chicken mRNA for catalytic
           subunit of chicken gizzard type-1 delta protein
           phosphatase, complete cds.
          Length = 327

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/82 (51%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>sp|P32598|PP12_YEAST Serine/threonine protein phosphatase PP1-2 (EC
           3.1.3.16).>pir|S32595|S32595 phosphoprotein phosphatase
           (EC 3.1.3.16) 1 catalytic chain - yeast (Saccharomyces
           cerevisiae)>gb:SCE9781_1708223 Saccharomyces cerevisiae
           chromosome V cosmids 9781, 8198, 9115, 9981, and lambda
           clones 3955 and 6052.>gb:YSCPP1A_1730333 Saccharomyces
           cerevisiae protein phosphatase-1 (GLC7) gene, complete
           cds.
          Length = 312

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 40/82 (48%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V  F ++  ++LI RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--IVGWSENDRGVSF-TFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGAMMSV 284



>gb:AY741676_1349131 Aedes aegypti protein phosphatase 1 alpha
           (PP1alpha) mRNA, partial cds.
          Length = 253

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/84 (50%), Positives = 54/84 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++ +  G   N RG    TFG D V  F  ++   LI RAH+ V DG+E FA+ QL
Sbjct: 149 SDPDKDTN--GYGENDRGVSF-TFGVDIVGKFLSKHDFDLICRAHQVVEDGYEFFAKRQL 205

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +TLFSA NYCG  +NAGA++ VGR
Sbjct: 206 VTLFSAPNYCGEFDNAGAMMSVGR 229



>sp|P48727|YME1_CAEEL Putative serine/threonine protein phosphatase
           F56C9.1 in chromosome III (EC
           3.1.3.16).>pir|T16476|T16476 phosphoprotein phosphatase
           (EC 3.1.3.16) 1-alpha F56C9.1 [similarity] -
           Caenorhabditis elegans>gb:U00063_1401587 Caenorhabditis
           elegans cosmid F56C9, complete sequence.
          Length = 333

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFGP+ V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VTGWGENDRGVSF-TFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG+++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGSMMTV 284



>sp|O04857|PP12_TOBAC Serine/threonine protein phosphatase PP1
           isozyme 2 (EC 3.1.3.16).>pir|T03596|T03596
           phosphoprotein phosphatase (EC 3.1.3.16) 1 - common
           tobacco>gb:NTNPP2_1691625 N.tabacum npp2 mRNA for
           protein phosphatase type 1.
          Length = 310

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+    V+G   N RG    TFG D+V +F  ++ + L+ RAH+ V DG+E FA+ QL
Sbjct: 211 SDPSRE--VKGWGMNDRGVSY-TFGSDKVAEFLMQHDMDLVCRAHQVVEDGYEFFAERQL 267

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 268 VTIFSAPNYCGEFDNAGAMMSV 289



>gb:AF178530_1774713 Malus domestica serine/threonine protein
           phosphatase 1 mRNA, complete cds.
          Length = 316

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  V+G   N RG    TFG D+V +F  ++ L L+ RAH+ V DG+E FA  QL
Sbjct: 212 SDPGRD--VKGWGMNDRGVSY-TFGADKVAEFLTKHDLDLVCRAHQVVEDGYEFFADRQL 268

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 269 VTIFSAPNYCGEFDNAGAMMSV 290



>gb:AE016819_1749001 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 314

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 40/82 (48%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F ++  ++LI RAH+ V DG+E F++ QL
Sbjct: 208 SDPDKD--IVGWSENDRGVSF-TFGPDVVSRFLQKLDMELICRAHQVVEDGYEFFSKRQL 264

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 265 VTLFSAPNYCGEFDNAGAMMSV 286



>gb:GPU52691_1680852 Gonyaulax polyedra putative type-1
           serine/threonine phosphatase (PP1) mRNA, complete cds.
          Length = 302

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 40/82 (48%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   + G   N RG    TFGPD V  F +++ L L+ RAH+ V DG+E FA+  L
Sbjct: 204 SDPEKE--ISGWGENDRGVSF-TFGPDVVQRFLRQHGLDLVCRAHQVVEDGYEFFARRAL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGAI+ V
Sbjct: 261 VTIFSAPNYCGEFDNAGAIMTV 282



>gb:AY086060_1571120 Arabidopsis thaliana clone 20905 mRNA, complete
           sequence.>gb:AY090365_1574113 Arabidopsis thaliana
           AT4g11240/F8L21_30 mRNA, complete
           cds.>gb:AY122904_1579782 Arabidopsis thaliana
           AT4g11240/F8L21_30 mRNA, complete cds.
          Length = 322

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 51/74 (68%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           ++G   N RG    TFG D+V +F + + L LI RAH+ V DG+E FA+ QL+T+FSA N
Sbjct: 210 IQGWGENDRGVSY-TFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPN 268

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 269 YCGEFDNAGALMSV 282



>pir|T13015|T13015 phosphoprotein phosphatase (EC 3.1.3.16) PP1BG -
           Arabidopsis thaliana>gb:ATCHRIV31_1544889 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           31.>gb:ATF8L21_1551235 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8L21 (ESSA project).
          Length = 318

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 37/74 (50%), Positives = 51/74 (68%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           ++G   N RG    TFG D+V +F + + L LI RAH+ V DG+E FA+ QL+T+FSA N
Sbjct: 210 IQGWGENDRGVSY-TFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQLVTIFSAPN 268

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 269 YCGEFDNAGALMSV 282



>sp|P48488|PP1_MEDVA Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|S46282|S46282 phosphoprotein phosphatase
           (EC 3.1.3.16) 1 [similarity] -
           alfalfa>gb:MVPP1MS_1687763 M.varia mRNA for pp1Ms
           protein.
          Length = 321

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 39/82 (47%), Positives = 56/82 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  +EG   N RG    TFG D+V +F + + L LI RAH+ V DG+E FA+ +L
Sbjct: 204 ADPDKD--LEGWGENDRGVSF-TFGADKVVEFLEHHDLDLICRAHQVVEDGYEFFAKRKL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 261 VTVFSAPNYCGEFDNAGAMMSV 282



>gb:AY220096_1590428 Phaseolus acutifolius serine threonine protein
           phosphatase mRNA, complete cds.
          Length = 331

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + S+EG   + RG    TFGPD V +F  +N L L+ R H+ V DG+E FA+ +L
Sbjct: 207 SDP--DSSIEGWAESDRGVSC-TFGPDVVAEFLDKNDLDLVCRGHQVVEDGYEFFAKRRL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 264 VTIFSAPNYGGEFDNAGALLSV 285



>gb:AF525131_1422111 Canis familiaris protein phosphatase type 1
           catalytic subunit delta isoform mRNA, complete cds.
          Length = 327

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI R H+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRVHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:DME17355_1378796 Drosophila melanogaster PPN 58A gene.
          Length = 324

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 39/76 (51%), Positives = 50/76 (65%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           + G  PN RG    TFG D V+ F  R KL LI R H+ V DG+E FA+ QLIT+FSA N
Sbjct: 226 IMGWGPNERGVSH-TFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPN 284

Query: 699 YCGTANNAGAILVVGR 652
           YCG  +NAGA++ + +
Sbjct: 285 YCGEFDNAGAMMCINQ 300



>gb:AE013599_1133205 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003455_1210504 Drosophila melanogaster
           chromosome 2R, section 63 of 74 of the complete
           sequence.
          Length = 324

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 39/76 (51%), Positives = 50/76 (65%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           + G  PN RG    TFG D V+ F  R KL LI R H+ V DG+E FA+ QLIT+FSA N
Sbjct: 226 IMGWGPNERGVSH-TFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLITIFSAPN 284

Query: 699 YCGTANNAGAILVVGR 652
           YCG  +NAGA++ + +
Sbjct: 285 YCGEFDNAGAMMCINQ 300



>sp|P48490|PP1_PHAVU Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16).>pir|S60053|S52371 phosphoprotein phosphatase
           (EC 3.1.3.16) PP1 - kidney bean>gb:PVD22PP1_1702928
           P.vulgaris mRNA for protein phosphatase 1 (PP1).
          Length = 314

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + S+EG   + RG    TFGPD V +F  +N L L+ R H+ V DG+E FA+ +L
Sbjct: 201 SDP--DSSIEGWAESDRGVSC-TFGPDVVAEFLDKNDLDLVCRGHQVVEDGYEFFAKRRL 257

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 258 VTIFSAPNYGGEFDNAGALLSV 279



>gb:HUMPPPIA_2035835 Human protein phosphatase I alpha subunit
           (PPPIA) mRNA, 3' end.
          Length = 308

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 185 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 241

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 242 VTLFSAPNYCGEFDNAGAMMSV 263



>gb:AC135208_1742066 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1364E02, complete
           sequence.>gb:AC139168_1743987 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OJA1364E02, complete
           sequence.
          Length = 373

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 39/77 (50%), Positives = 53/77 (68%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D+V++F +++ L LI RAH+ V DG+E FA  QL
Sbjct: 296 SDPGKD--VQGWGMNDRGVSY-TFGADKVSEFLEKHDLDLICRAHQVVEDGYEFFADRQL 352

Query: 723 ITLFSATNYCGTANNAG 673
           +T+FSA NYCG  +NAG
Sbjct: 353 VTIFSAPNYCGEFDNAG 369



>gb:CR382127_1659861 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 327

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 39/82 (47%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V  F +++ + LI RAH+ V DG+E F++  L
Sbjct: 207 SDPDKD--ITGWNENDRGVSF-TFGPDVVLRFLQKHDMDLICRAHQVVEDGYEFFSKRHL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:OCPP1_1442267 Rabbit mRNA for protein phosphatase-1 catalytic
           subunit (EC 3.1.3.-).
          Length = 311

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 188 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 244

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 245 VTLFSAPNYCGEFDNAGAMMSV 266



>gb:OCCPP1A_1442137 Rabbit mRNA for type-1 protein phosphatase
           1-alpha catalytic subunit.
          Length = 330

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AY062037_1424534 Canis familiaris protein phosphatase type 1
           alpha catalytic subunit mRNA, complete cds.
          Length = 330

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AY094722_1297896 Drosophila melanogaster GH20565 full insert
           cDNA.
          Length = 324

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 39/76 (51%), Positives = 49/76 (64%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           + G  PN RG    TFG D V+ F  R KL LI R H+ V DG+E FA  QLIT+FSA N
Sbjct: 226 IMGWGPNERGVSH-TFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFANRQLITIFSAPN 284

Query: 699 YCGTANNAGAILVVGR 652
           YCG  +NAGA++ + +
Sbjct: 285 YCGEFDNAGAMMCINQ 300



>pir|A46240|A46240 phosphoprotein phosphatase (EC 3.1.3.16) 1-alpha
           catalytic chain, splice form 2 [validated] -
           human>gb:S57501_2040533 protein phosphatase type 1
           catalytic subunit [human, mRNA, 1400 nt].
          Length = 341

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 218 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 274

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 275 VTLFSAPNYCGEFDNAGAMMSV 296



>sp|P62137|PP1A_MOUSE Serine/threonine protein phosphatase PP1-alpha
           catalytic subunit (EC 3.1.3.16)
           (PP-1A).>gb:AK007932_1154288 Mus musculus 10 day old
           male pancreas cDNA, RIKEN full-length enriched library,
           clone:1810062E21 product:protein phosphatase 1,
           catalytic subunit, alpha isoform, full insert
           sequence.>gb:AK028392_1160971 Mus musculus 18 days
           pregnant adult female placenta and extra embryonic
           tissue cDNA, RIKEN full-length enriched library,
           clone:3830432B13 product:protein phosphatase 1,
           catalytic subunit, alpha isoform, full insert
           sequence.>gb:AK090070_1176129 Mus musculus female
           sarcoma RCB-0464 Meth-A cDNA, RIKEN full-length enriched
           library, clone:G430090H17 product:protein phosphatase 1,
           catalytic subunit, alpha isoform, full insert
           sequence.>gb:BC014828_2092051 Mus musculus protein
           phosphatase 1, catalytic subunit, alpha isoform, mRNA
           (cDNA clone MGC:25955 IMAGE:4239005), complete
           cds.>gb:MMU25809_2119876 Mus musculus serine/threonine
           protein phosphatase type 1 alpha mRNA, complete
           cds.>gb:BC084049_2563456 Xenopus laevis hypothetical
           LOC494982, mRNA (cDNA clone MGC:98412 IMAGE:7197591),
           complete cds.
          Length = 330

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|P62136|PP1A_HUMAN Serine/threonine protein phosphatase PP1-alpha
           catalytic subunit (EC 3.1.3.16)
           (PP-1A).>sp|P62139|PP1A_RABIT Serine/threonine protein
           phosphatase PP1-alpha catalytic subunit (EC 3.1.3.16)
           (PP-1A).>sp|P62138|PP1A_RAT Serine/threonine protein
           phosphatase PP1-alpha catalytic subunit (EC 3.1.3.16)
           (PP-1A).>pir|JX0157|JX0157 phosphoprotein phosphatase
           (EC 3.1.3.16) 1-alpha catalytic chain [validated] -
           rat>pir|S04335|PARB11 phosphoprotein phosphatase (EC
           3.1.3.16) 1-alpha catalytic chain [validated] -
           rabbit>gb:OCPP1A_1442268 Rabbit mRNA for type-1 protein
           phosphatase catalytic subunit (PP1 alpha) alpha
           isoenzyme.>gb:BC001888_1967934 Homo sapiens protein
           phosphatase 1, catalytic subunit, alpha isoform,
           transcript variant 1, mRNA (cDNA clone MGC:1674
           IMAGE:3546588), complete cds.>gb:BC004482_1969313 Homo
           sapiens protein phosphatase 1, catalytic subunit, alpha
           isoform, transcript variant 1, mRNA (cDNA clone
           MGC:10585 IMAGE:3689198), complete
           cds.>gb:BC008010_1971154 Homo sapiens protein
           phosphatase 1, catalytic subunit, alpha isoform,
           transcript variant 1, mRNA (cDNA clone MGC:15877
           IMAGE:3528742), complete cds.>gb:BT006629_1990067 Homo
           sapiens protein phosphatase 1, catalytic subunit, alpha
           isoform mRNA, complete cds.>gb:HSPH1CAT_2019535
           H.sapiens mRNA for phosphatase 1 catalytic
           subunit.>gb:HUMPRPHOS1_2035949 Human protein
           phosphatase-1 catalytic subunit mRNA, complete
           cds.>gb:BC070517_2106324 Rattus norvegicus protein
           phosphatase 1, catalytic subunit, alpha isoform, mRNA
           (cDNA clone MGC:91638 IMAGE:7104674), complete
           cds.>gb:RATPP1AA_2133496 Rattus norvegicus mRNA for
           catalytic subunit of protein phosphatase 1, complete
           cds, clone:PP-1 alpha.>gb:RATPP1ACS_2133497 Rattus
           norvegicus PP-1 alpha mRNA for catalytic subunit of
           protein phosphatase type 1 alpha, complete
           cds.>gb:S78215_2139536 protein phosphatase 1 alpha
           [rats, striatum, mRNA, 1404 nt].
          Length = 330

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 41/82 (50%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VQGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|P13681|PP11_SCHPO Serine/threonine protein phosphatase PP1-1 (EC
           3.1.3.16).>pir|A32550|A32550 phosphoprotein phosphatase
           (EC 3.1.3.16) dis2 - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC776_1720405 S.pombe chromosome II cosmid
           c776.>gb:YSPBSW1A_1731044 Schizosaccharomyces pombe
           protein phosphatase type 1 (bws1+) gene, complete
           cds.>gb:YSPDIS2A_1731088 Schizosaccharomyces pombe
           putative protein phosphatase type 1 (dis2+) gene,
           complete cds.
          Length = 327

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V+ F  ++ + L+ RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--LTGWGDNDRGVSF-TFGPDVVSRFLHKHDMDLVCRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGAMMSV 284



>gb:AF525129_1422109 Canis familiaris protein phosphatase type 1
           beta isoform mRNA, complete cds.
          Length = 327

 Score = 73.2 bits (178), Expect = 7e-12
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           + LFSA NYCG  +NAG ++ V
Sbjct: 263 VILFSAPNYCGEFDNAGGMMSV 284



>gb:AC114258_1205575 Dictyostelium discoideum chromosome 2 map
           complement(427476-387492) strain AX4, complete
           sequence.>gb:AF020537_1233348 Dictyostelium discoideum
           protein phosphatase type 1-like catalytic subunit (pppB)
           mRNA, complete cds.
          Length = 321

 Score = 73.2 bits (178), Expect = 7e-12
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP +N  ++G   N RG    TFG D V  F K++ L L+ RAH+ V DG+E FA+ QL
Sbjct: 203 ADPDKN--IQGWEDNDRGVSY-TFGADVVESFLKKHDLDLVCRAHQVVEDGYEFFAKRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NY G  +NAGA++ V
Sbjct: 260 VTLFSAPNYFGEFDNAGAMMGV 281



>gb:AK004686_1152510 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200010B19
           product:protein phosphatase 1, catalytic subunit, beta
           isoform, full insert sequence.
          Length = 327

 Score = 73.2 bits (178), Expect = 7e-12
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG    TFG D V+ F  R+ L LI RAH+   DG+E FA+ QL
Sbjct: 206 SDPDKD--VQGWGENDRGVSF-TFGADVVSKFLNRHDLDLICRAHQVEEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>pir|T21288|T21288 phosphoprotein phosphatase (EC 3.1.3.16) F23B12.1
           [similarity] - Caenorhabditis
           elegans>gb:CEF23B12_1362861 Caenorhabditis elegans
           cosmid F23B12, complete sequence.
          Length = 401

 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 38/82 (46%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP E   V G   + RG G  +FGP+ V  F + + L L++RAH+ VMDG+E FA  QL
Sbjct: 274 ADPDEK--VFGYADSPRGAGR-SFGPNAVKKFLQMHNLDLVVRAHQVVMDGYEFFADRQL 330

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA +YCG  +NA A++ V
Sbjct: 331 VTVFSAPSYCGQFDNAAAVMNV 352



>gb:AY449458_1327275 Oikopleura dioica clone BACOIKO002 4xj18,
           complete sequence.
          Length = 322

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 40/82 (48%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  V G   N RG    TFG D V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 206 ADPEKD--VSGWAENDRGVSF-TFGADVVNKFLNKHDLDLICRAHQVVEDGYEFFAKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG ++ V
Sbjct: 263 VTLFSAPNYCGEFDNAGGMMSV 284



>gb:AE013599_1132532 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003801_1225178 Drosophila melanogaster
           chromosome 2R, section 49 of 74 of the complete
           sequence.>gb:AY075165_1296015 Drosophila melanogaster
           AT05565 full length cDNA.
          Length = 314

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/77 (50%), Positives = 48/77 (62%)
 Frame = -2

Query: 888 NDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFS 709
           N + +G   N RG    TF    V DF K   LQL++RAHE V DG+E FA  QL+T+FS
Sbjct: 206 NHTTKGWGHNDRGVSF-TFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264

Query: 708 ATNYCGTANNAGAILVV 658
           A NYCG  NNAG ++ V
Sbjct: 265 APNYCGMMNNAGGVMSV 281



>sp|P11612|PPY_DROME Serine/threonine protein phosphatase PP-Y (EC
           3.1.3.16).>pir|S03963|PAFFY phosphoprotein phosphatase
           (EC 3.1.3.16) Y - fruit fly  (Drosophila
           melanogaster)>gb:DMPPY_1379989 Drosophila melanogaster
           PP-Y mRNA for protein phosphatase Y (EC 3.1.3.).
          Length = 314

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 39/77 (50%), Positives = 48/77 (62%)
 Frame = -2

Query: 888 NDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFS 709
           N + +G   N RG    TF    V DF K   LQL++RAHE V DG+E FA  QL+T+FS
Sbjct: 206 NHTTKGWGHNDRGVSF-TFDKVIVRDFLKAFDLQLMVRAHEVVEDGYEFFANRQLVTVFS 264

Query: 708 ATNYCGTANNAGAILVV 658
           A NYCG  NNAG ++ V
Sbjct: 265 APNYCGMMNNAGGVMSV 281



>sp|P30366|PP11_ARATH Serine/threonine protein phosphatase PP1
           isozyme 1 (EC 3.1.3.16).>gb:AC004561_1531884 Arabidopsis
           thaliana chromosome 2 clone F16P2 map ve014, complete
           sequence.>gb:ATH1PPHA_1552047 Arabidopsis thaliana
           phosphoprotein phosphatase-type 1 catalytic subunit
           mRNA, complete cds.>gb:ATPP1ATM_1553874 A.thaliana
           PP1-At mRNA for protein
           phosphatase-1.>gb:AY080871_1568556 Arabidopsis thaliana
           putative phosphoprotein phosphatase type 1 catalytic
           subunit (At2g29400) mRNA, complete
           cds.>gb:AY142593_1583009 Arabidopsis thaliana putative
           phosphoprotein phosphatase type 1 catalytic subunit
           (At2g29400) mRNA, complete cds.
          Length = 318

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 38/82 (46%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ +    G   N RG    TFG D+V +F +++ + LI RAH+ V DG+E FA+ QL
Sbjct: 220 SDPSGD---VGWGMNDRGVSY-TFGADKVAEFLEKHDMDLICRAHQVVEDGYEFFAERQL 275

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ +
Sbjct: 276 VTVFSAPNYCGEFDNAGAMMSI 297



>gb:BC041730_2548015 Xenopus laevis Protein phosphatase type 1
           alpha, catalytic subunit, mRNA (cDNA clone MGC:52704
           IMAGE:4682749), complete cds.
          Length = 326

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG D V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGADVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG+++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGSMMSV 285



>gb:YSCDIS2S1A_1728817 Saccharomyces cerevisiae protein phosphatase
           type 1-like (DIS2S1) gene, complete cds.
          Length = 312

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 39/82 (47%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFGPD V  F ++  ++LI RAH+ V DG+E F++ QL
Sbjct: 206 SDPDKD--IVGWSENDRGVSF-TFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQL 262

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYC   +NAGA++ V
Sbjct: 263 VTLFSAPNYCVEFDNAGAMMSV 284



>sp|P48486|PP16_ARATH Serine/threonine protein phosphatase PP1
           isozyme 6 (EC 3.1.3.16).>gb:ATPP1BG_1553875 A.thaliana
           PP1bg gene encoding protein phosphatase
           1.>gb:ATU80921_1557300 Arabidopsis thaliana
           serine/threonine protein phosphatase type one (TOPP7)
           gene, complete cds.
          Length = 322

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 36/74 (48%), Positives = 50/74 (67%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           ++G   N RG    TFG D+V +F + + L LI RAH+   DG+E FA+ QL+T+FSA N
Sbjct: 210 IQGWGENDRGVSY-TFGADKVAEFLQTHDLDLICRAHQVDEDGYEFFAKRQLVTIFSAPN 268

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 269 YCGEFDNAGALMSV 282



>sp|Q05547|PP13_DROME Serine/threonine protein phosphatase alpha-3
           isoform (EC 3.1.3.16).>pir|S29396|S29396 phosphoprotein
           phosphatase (EC 3.1.3.16) 1, isoform 13C, catalytic
           chain - fruit fly (Drosophila
           melanogaster)>gb:AE014298_1125733 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003498_1212742 Drosophila melanogaster
           chromosome X, section 50 of 74 of the complete
           sequence.>gb:AY060272_1292184 Drosophila melanogaster
           GH10637 full length cDNA.>gb:DMPP113C_1379981
           D.melanogaster PP1 13C gene for protein phosphatase 1
           13C.
          Length = 302

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D++ G   N RG    TFG + V  F +++ L LI RAH+ V DG+E FA+ QL
Sbjct: 205 SDP-DKDTI-GWGENDRGVSF-TFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 262 VTLFSAPNYCGEFDNAGAMMSV 283



>gb:BC067911_2554897 Xenopus tropicalis hypothetical protein
           MGC69216, mRNA (cDNA clone MGC:69216 IMAGE:5307610),
           complete cds.>gb:BC090213_2566430 Xenopus laevis protein
           phosphatase 1-gamma 1, mRNA (cDNA clone MGC:85040
           IMAGE:6326645), complete cds.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:BC054188_2550842 Xenopus laevis protein phosphatase 1, catalytic
           subunit, gamma isoform, mRNA (cDNA clone MGC:64327
           IMAGE:6876315), complete cds.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:BC045444_2549281 Danio rerio zgc:76940, mRNA (cDNA clone
           MGC:55744 IMAGE:3816387), complete
           cds.>gb:BC066693_2554532 Danio rerio zgc:76940, mRNA
           (cDNA clone MGC:76940 IMAGE:6524922), complete cds.
          Length = 332

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 40/82 (48%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  V G   N RG    TFG D V  F  ++ + LI RAH+ V DG+E FA+ QL
Sbjct: 207 ADPDKD--VMGWGENDRGVSF-TFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AJ719895_2502082 Gallus gallus mRNA for hypothetical protein,
           clone 7p6.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:MMPPICG6_2117040 Mus musculus protein phosphatase 1cgamma
           (PP1cgamma) gene, exons 7 and 8 and two alternatively
           spliced complete cds.>gb:MMU53456_2121976 Mus musculus
           protein phosphatase 1cgamma (PP1cgamma) mRNA, complete
           cds.>gb:MUSPIM1K_2129638 Mouse mRNA for PP1gamma,
           complete cds.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:HUMPP1G1X_2035797 Human protein phosphatase-1 gamma 1 mRNA,
           partial cds.
          Length = 319

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 203 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 260 VTLFSAPNYCGEFDNAGAMMSV 281



>gb:AB030258S5_1865954 Homo sapiens PPP1CC gene for serine/threonine
           phosphatase 1 gamma, exon 5, 6 and partial cds.
          Length = 294

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AF427493_1270017 Drosophila melanogaster protein phosphatase 1
           catalytic subunit (Pp1Y1) mRNA, complete cds.
          Length = 306

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 51/82 (62%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +  G   N+RG    TFG D V  F  R    LI RAH+ V DG+E FA+ QL
Sbjct: 201 SDP--DPTAIGWEKNSRGVSF-TFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQL 257

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           IT+FSA NYCG  +NAGA++ V
Sbjct: 258 ITVFSAVNYCGEFDNAGAMMCV 279



>pir|S29310|S29310 phosphoprotein phosphatase (EC 3.1.3.16) -
           Paramecium tetraurelia>gb:PARPP1A_1391635 Paramecium
           tetraurelia macronuclear phosphoprotein phosphatase 1
           isozyme omega-1 gene, complete cds.>gb:PTPPT1_1395973
           P.tetraurelia gene for protein phosphatase type 1.
          Length = 320

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG   V F  + V  F K+++L LI RAH+ V DG+E F++ QL
Sbjct: 209 SDPDKD--VQGWADNERGVSYV-FSQEIVQVFLKKHELDLICRAHQVVEDGYEFFSKRQL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG+++ V
Sbjct: 266 VTLFSAPNYCGEFDNAGSMMTV 287



>pir|S35700|S35700 phosphoprotein phosphatase (EC 3.1.3.16) 1-gamma
           catalytic chain, splice form 2 - human
          Length = 337

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>pir|C32550|C32550 phosphoprotein phosphatase (EC 3.1.3.16) 1-gamma
           catalytic chain - mouse>gb:BC078825_2106981 Rattus
           norvegicus protein phosphatase 1, catalytic subunit,
           gamma isoform, mRNA (cDNA clone MGC:93440
           IMAGE:7112668), complete cds.>gb:MMPPICG6_2117039 Mus
           musculus protein phosphatase 1cgamma (PP1cgamma) gene,
           exons 7 and 8 and two alternatively spliced complete
           cds.>gb:MUSDIS2M1A_2125672 Mus musculus protein
           phosphatase type 1 (dis2m1) mRNA, complete cds.
          Length = 337

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>pir|I76573|I76573 phosphoprotein phosphatase (EC 3.1.3.16) 1-gamma
           catalytic chain - rat>gb:RATPP1G2_2133503 Rattus
           norvegicus mRNA for catalytic subunit of protein
           phosphatase 1, complete cds, clone:PP-1 gamma 2.
          Length = 337

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VFGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|P36873|PP1G_HUMAN Serine/threonine protein phosphatase PP1-gamma
           catalytic subunit (EC 3.1.3.16) (PP-1G) (Protein
           phosphatase 1C catalytic subunit).>pir|S35699|S35699
           phosphoprotein phosphatase (EC 3.1.3.16) 1-gamma
           catalytic chain, splice form 1 [validated] -
           human>gb:BC014073_1974374 Homo sapiens protein
           phosphatase 1, catalytic subunit, gamma isoform, mRNA
           (cDNA clone MGC:20085 IMAGE:3956353), complete
           cds.>gb:HSPPPICC_2019684 H.sapiens mRNA for protein
           phosphatase 1 gamma.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|P61287|PP1G_BOVIN Serine/threonine protein phosphatase PP1-gamma
           catalytic subunit (EC 3.1.3.16) (PP-1G) (Protein
           phosphatase 1C catalytic subunit).>sp|P37139|PP1G_MOUSE
           Serine/threonine protein phosphatase PP1-gamma catalytic
           subunit (EC 3.1.3.16) (PP-1G) (Protein phosphatase 1C
           catalytic subunit).>pir|I76572|I76572 phosphoprotein
           phosphatase (EC 3.1.3.16) 1 catalytic chain -
           rat>gb:AK076009_1171166 Mus musculus 10 days embryo
           whole body cDNA, RIKEN full-length enriched library,
           clone:2610028M06 product:protein phosphatase 1,
           catalytic subunit, gamma isoform, full insert
           sequence.>gb:AK088229_1175275 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430007K21 product:protein
           phosphatase 1, catalytic subunit, gamma isoform, full
           insert sequence.>gb:BTA429235_1436655 Bos taurus mRNA
           for protein phosphatase 1C catalytic subunit (ppp1cc
           gene) splice variant 1.>gb:BC010613_2091041 Mus musculus
           protein phosphatase 1, catalytic subunit, gamma isoform,
           mRNA (cDNA clone MGC:8123 IMAGE:3589168), complete
           cds.>gb:BC021646_2093588 Mus musculus protein
           phosphatase 1, catalytic subunit, gamma isoform, mRNA
           (cDNA clone MGC:13976 IMAGE:3487479), complete
           cds.>gb:BC085496_2109240 Mus musculus protein
           phosphatase 1, catalytic subunit, gamma isoform, mRNA
           (cDNA clone MGC:102084 IMAGE:6829867), complete
           cds.>gb:RATPP1G1_2133502 Rattus norvegicus mRNA for
           catalytic subunit of protein phosphatase 1, complete
           cds, clone:PP-1 gamma 1.>gb:BC086013_2564606 Xenopus
           laevis hypothetical LOC495560, mRNA (cDNA clone
           MGC:98061 IMAGE:7199332), complete cds.
          Length = 323

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/82 (50%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:BC070008_2555487 Danio rerio zgc:85729, mRNA (cDNA clone
           MGC:85729 IMAGE:6970086), complete cds.
          Length = 331

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 40/82 (48%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP ++  V G   N RG    TFG D V  F  ++ + LI RAH+ V DG+E FA+ QL
Sbjct: 207 ADPDKD--VLGWGENDRGVSF-TFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AY087823_1572850 Arabidopsis thaliana clone 38656 mRNA, complete
           sequence.
          Length = 317

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V DG+E FA+ +L
Sbjct: 202 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRL 258

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 259 VTIFSAPNYGGEFDNAGALLSV 280



>gb:AY042854_1560919 Arabidopsis thaliana serine/threonine protein
           phosphatase (MOJ9.27) mRNA, complete
           cds.>gb:AY081492_1568752 Arabidopsis thaliana unknown
           protein mRNA, complete cds.
          Length = 318

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V DG+E FA+ +L
Sbjct: 209 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 266 VTIFSAPNYGGEFDNAGALLSV 287



>pir|S12985|S12985 phosphoprotein phosphatase (EC 3.1.3.16) 1
           catalytic chain - rape (fragment)
          Length = 255

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V DG+E FA+ +L
Sbjct: 145 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRL 201

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 202 VTIFSAPNYGGEFDNAGALLSV 223



>pir|T27314|T27314 phosphoprotein phosphatase (EC 3.1.3.16) Y69E1A.4
           [similarity] - Caenorhabditis
           elegans>gb:CEY69E1A_1370943 Caenorhabditis elegans YAC
           Y69E1A, complete sequence.
          Length = 375

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 36/83 (43%), Positives = 52/83 (62%)
 Frame = -2

Query: 900 DPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLI 721
           DPTE    +G +P+ARG   V FGP  +  F K+  LQ++IR H+ V DG+E F   +L+
Sbjct: 270 DPTE----KGYKPSARGASFV-FGPPALRAFLKKLDLQMVIRGHQVVEDGYEFFDGRRLV 324

Query: 720 TLFSATNYCGTANNAGAILVVGR 652
           T+FSA NYCG  +N  A+  + +
Sbjct: 325 TIFSAPNYCGQNDNTAAVFSIDK 347



>pir|T25259|T25259 phosphoprotein phosphatase (EC 3.1.3.16) T25B9.2
           [similarity] - Caenorhabditis elegans>gb:CET25B9_1368150
           Caenorhabditis elegans cosmid T25B9, complete sequence.
          Length = 366

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 36/83 (43%), Positives = 52/83 (62%)
 Frame = -2

Query: 900 DPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLI 721
           DPTE    +G +P+ARG   V FGP  +  F K+  LQ++IR H+ V DG+E F   +L+
Sbjct: 238 DPTE----KGYKPSARGASFV-FGPPALRAFLKKLDLQMVIRGHQVVEDGYEFFDGRRLV 292

Query: 720 TLFSATNYCGTANNAGAILVVGR 652
           T+FSA NYCG  +N  A+  + +
Sbjct: 293 TIFSAPNYCGQNDNTAAVFSIDK 315



>sp|P23777|PP1_BRANA Serine/threonine protein phosphatase PP1 (EC
           3.1.3.16) (Fragment).>gb:BNPP1_1633624 B.napus mRNA for
           phosphatase 1.
          Length = 255

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V DG+E FA+ +L
Sbjct: 145 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRL 201

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 202 VTIFSAPNYGGEFDNAGALLSV 223



>sp|P36874|PP1G_XENLA Serine/threonine protein phosphatase PP1-gamma
           catalytic subunit (EC 3.1.3.16)
           (PP-1G).>gb:XELPP1G1CC_2582188 Xenopus laevis protein
           phosphatase 1-gamma 1 mRNA, complete cds.
          Length = 323

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 40/82 (48%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--ILGWGENYRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>sp|O82734|PP18_ARATH Serine/threonine protein phosphatase PP1
           isozyme 8 (EC 3.1.3.16).
          Length = 324

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V DG+E FA+ +L
Sbjct: 209 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDGYEFFAKRRL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 266 VTIFSAPNYGGEFDNAGALLSV 287



>gb:PARPP1B_1391636 Paramecium tetraurelia macronuclear
           phosphoprotein phosphatase 1 isozyme omega-2 gene,
           complete cds.
          Length = 320

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 39/82 (47%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V+G   N RG   V F  + V  F K+++L LI RAH  V DG+E F++ QL
Sbjct: 209 SDPDKD--VQGWADNERGVSYV-FSQEIVQVFLKKHELDLICRAHPVVEDGYEFFSKRQL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAG+++ V
Sbjct: 266 VTLFSAPNYCGEFDNAGSMMTV 287



>gb:ATAC011620_1543307 Arabidopsis thaliana chromosome III BAC F18C1
           genomic sequence, complete sequence.>gb:BT010532_1640478
           Arabidopsis thaliana At3g05580 gene, complete
           cds.>gb:AK175443_1817431 Arabidopsis thaliana mRNA for
           putative serine/threonine protein phosphatase type one,
           complete cds, clone: RAFL21-87-E07.
          Length = 318

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 40/82 (48%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + +  EG   + RG    TFG D V DF  +N L LI R H+ V DG+E FA+ +L
Sbjct: 209 SDPDQKN--EGWTDSDRGISC-TFGADVVADFLDKNDLDLICRGHQVVEDGYEFFAKRRL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 266 VTIFSAPNYGGEFDNAGALLSV 287



>pir|S20882|S20882 phosphoprotein phosphatase (EC 3.1.3.16) 1
           catalytic chain  (clone TOPP1) - Arabidopsis thaliana
          Length = 318

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 38/82 (46%), Positives = 54/82 (65%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ +    G   N RG    TFG D+V +F +++ + LI RAH+ V DG+E FA+ QL
Sbjct: 220 SDPSGD---VGWGMNDRGVSY-TFGADKVAEFLEKHDMDLICRAHQVVEDGYEFFAERQL 275

Query: 723 ITLFSATNYCGTANNAGAILVV 658
            T+FSA NYCG  +NAGA++ +
Sbjct: 276 WTVFSAPNYCGEFDNAGAMMSI 297



>gb:S78217_2139537 protein phosphatase 1 gamma 1 [rats, striatum,
           mRNA Partial, 1508 nt].
          Length = 113

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 38/74 (51%), Positives = 48/74 (64%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL+TLFSA N
Sbjct: 3   VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN 61

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 62  YCGEFDNAGAMMSV 75



>gb:U58755_1405375 Caenorhabditis elegans cosmid C34D4, complete
           sequence.
          Length = 329

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 33/66 (50%), Positives = 46/66 (69%)
 Frame = -2

Query: 855 RGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNA 676
           RG G V FG + V  F   + L+L++RAH+ VMDG+E FA  QL+T+FSA +YCG  +NA
Sbjct: 235 RGAGRV-FGAEAVKKFLNTHHLELVVRAHQVVMDGYEFFADRQLVTIFSAPSYCGQMDNA 293

Query: 675 GAILVV 658
            A++ V
Sbjct: 294 AAVMTV 299



>gb:AF195248_1249803 Plasmodium falciparum PP1-like protein
           serine/threonine phosphatase mRNA, complete cds.
          Length = 294

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHEC--VMDGFERFAQG 730
           SDP + + + G   NARG   +TFGPD    F K N L ++IR+H+    + G E   +G
Sbjct: 166 SDPQKKEGIGG---NARGNNCITFGPDVTEMFLKNNNLDILIRSHQVPKTLKGIESHHEG 222

Query: 729 QLITLFSATNYCGTANNAGAILV 661
           + ITLFSA+NYC    N GA ++
Sbjct: 223 KCITLFSASNYCNKIKNLGAAII 245



>gb:AE013599_1133224 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003456_1210523 Drosophila melanogaster
           chromosome 2R, section 64 of 74 of the complete
           sequence.
          Length = 346

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 39/82 (47%), Positives = 49/82 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E         N RG    TFG + V  F  ++K  LI+RAH+ V DG+E FA  QL
Sbjct: 222 SDPDETTGTWA--SNDRGVSF-TFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQL 278

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC   +N GA+LVV
Sbjct: 279 VTIFSAPNYCDIFDNCGAVLVV 300



>gb:AE014187_938690 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014819_1227766 Plasmodium falciparum 3D7
           chromosome 14 section 4 of 13 of the complete sequence.
          Length = 959

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHEC--VMDGFERFAQG 730
           SDP + + + G   NARG   +TFGPD    F K N L ++IR+H+    + G E   +G
Sbjct: 397 SDPQKKEGIGG---NARGNNCITFGPDVTEMFLKNNNLDILIRSHQVPKTLKGIESHHEG 453

Query: 729 QLITLFSATNYCGTANNAGAILV 661
           + ITLFSA+NYC    N GA ++
Sbjct: 454 KCITLFSASNYCNKIKNLGAAII 476



>pir|I73629|I73629 phosphoprotein phosphatase (EC 3.1.3.16) 1-gamma
           catalytic chain - rat (fragment)
          Length = 113

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 38/74 (51%), Positives = 48/74 (64%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V G   N RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL+TLFSA N
Sbjct: 3   VLGWGENDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN 61

Query: 699 YCGTANNAGAILVV 658
           YCG  +NAGA++ V
Sbjct: 62  YCGEFDNAGAMMSV 75



>pir|T29290|T29290 phosphoprotein phosphatase (EC 3.1.3.16) C34D4.2
           [similarity] - Caenorhabditis elegans
          Length = 345

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 33/66 (50%), Positives = 46/66 (69%)
 Frame = -2

Query: 855 RGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNA 676
           RG G V FG + V  F   + L+L++RAH+ VMDG+E FA  QL+T+FSA +YCG  +NA
Sbjct: 251 RGAGRV-FGAEAVKKFLNTHHLELVVRAHQVVMDGYEFFADRQLVTIFSAPSYCGQMDNA 309

Query: 675 GAILVV 658
            A++ V
Sbjct: 310 AAVMTV 315



>pir|T25993|T25993 phosphoprotein phosphatase (EC 3.1.3.16) 1
           ZK354.9 [similarity] - Caenorhabditis
           elegans>gb:U88172_1406635 Caenorhabditis elegans cosmid
           ZK354, complete sequence.
          Length = 310

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 36/84 (42%), Positives = 52/84 (61%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT     +G  PN+RG   V FG D +     R ++ L++RAH+ V DG+E FA  +L
Sbjct: 209 SDPTNFQ--KGWNPNSRGVSYV-FGSDALRKLLDRLQIDLVVRAHQVVQDGYEFFANRRL 265

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA  YCG  +NA A++ V +
Sbjct: 266 VTIFSAPFYCGQFDNAAAVMYVNK 289



>pir|T21322|T21322 phosphoprotein phosphatase (EC 3.1.3.16) 1
           F25B3.4 [similarity] - Caenorhabditis
           elegans>gb:CEF25B3_1362901 Caenorhabditis elegans cosmid
           F25B3, complete sequence.
          Length = 291

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 36/84 (42%), Positives = 52/84 (61%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT     +G  PN+RG   V FG D +     R ++ L++RAH+ V DG+E FA  +L
Sbjct: 186 SDPTNFQ--KGWNPNSRGVSYV-FGSDALRKLLDRLQIDLVVRAHQVVQDGYEFFANRRL 242

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA  YCG  +NA A++ V +
Sbjct: 243 VTIFSAPFYCGQFDNAAAVMYVNK 266



>sp|P48461|PP11_DROME Serine/threonine protein phosphatase alpha-1
           isoform (EC 3.1.3.16).>pir|S13827|S13827 phosphoprotein
           phosphatase (EC 3.1.3.16) 1-alpha-1 catalytic chain -
           fruit fly (Drosophila melanogaster)>gb:AE014297_1141192
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003748_1223185 Drosophila melanogaster
           chromosome 3R, section 86 of 118 of the complete
           sequence.>gb:BT016110_1358555 Drosophila melanogaster
           LD14639 full insert cDNA.>gb:DMPP1A1_1379983
           D.melanogaster PP1-alpha 96A gene for protein
           phosphatase 1.
          Length = 327

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 39/82 (47%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++    G   N RG    TFG + V  F ++++  LI RAH+ V DG+E FA+ QL
Sbjct: 205 SDPDKDTM--GWGENDRGVSF-TFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQL 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 262 VTLFSAPNYCGEFDNAGAMMSV 283



>gb:CR382136_1669321 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 532

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 33/77 (42%), Positives = 46/77 (59%)
 Frame = -2

Query: 894 TENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITL 715
           T+     G  P+ RG G+  FGPD    FC  NK++ ++R+HE  MDG E    G+LIT+
Sbjct: 402 TDPQPTNGCSPSKRGIGM-QFGPDITERFCLTNKIRKVLRSHEVRMDGVEEEHNGRLITV 460

Query: 714 FSATNYCGTANNAGAIL 664
           FSA NYC +  N G ++
Sbjct: 461 FSAPNYCDSTGNLGGVV 477



>gb:AF525130_1422110 Canis familiaris protein phosphatase type 1
           catalytic subunit gamma isoform mRNA, complete cds.
          Length = 323

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 40/82 (48%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  V G     RG    TFG + V  F  ++ L LI RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKD--VLGWGETDRGVSF-TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>gb:AE014185_937754 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014831_1228488 Plasmodium falciparum 3D7
            chromosome 10 section 3 of 7 of the complete sequence.
          Length = 3165

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 33/71 (46%), Positives = 45/71 (63%)
 Frame = -2

Query: 891  ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLF 712
            +N S   + P+ RG     FG  R+ DF K N+L+LIIR HECV +G++   + +L+TLF
Sbjct: 2473 KNSSTYDIIPSRRGNITFKFGKHRLNDFLKNNQLKLIIRGHECVQEGYKYSYKRKLLTLF 2532

Query: 711  SATNYCGTANN 679
            SA NYC   NN
Sbjct: 2533 SAKNYCNKYNN 2543



>sp|P23880|PP12_SCHPO Serine/threonine protein phosphatase PP1-2 (EC
           3.1.3.16) (Suppressor protein SDS21).>pir|B32550|B32550
           phosphoprotein phosphatase (EC 3.1.3.16) sds21 - fission
           yeast (Schizosaccharomyces pombe)>gb:SPCC31H12_1721251
           S.pombe chromosome III cosmid
           c31H12.>gb:YSPSDS21A_1731220 Schizosaccharomyces pombe
           protein phosphatase type 1-like (sds21+) gene, complete
           cds.
          Length = 322

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 38/82 (46%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++  + G   N RG    TFG D V+ F +++ L LI RAH+ V DG+E F + QL
Sbjct: 203 SDPEKD--LTGWGENDRGVSY-TFGADVVSRFLQKHDLDLICRAHQVVEDGYEFFGKRQL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +N GA++ V
Sbjct: 260 VTIFSAPNYCGEFDNVGAMMSV 281



>gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 479

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 34/80 (42%), Positives = 48/80 (60%)
 Frame = -2

Query: 894 TENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITL 715
           T+     G  P+ RG G + FGPD    FCK N L+ ++R+HE  M G+E    G+L+T+
Sbjct: 372 TDPQPENGRSPSQRGVG-IRFGPDVTEAFCKENGLKGVLRSHEVRMGGYEVEHNGKLVTV 430

Query: 714 FSATNYCGTANNAGAILVVG 655
           FSA NYC +  N GA + +G
Sbjct: 431 FSAPNYCDSQGNKGAYINIG 450



>gb:AF001363_1230646 Herdmania curvata protein phosphatase-1 mRNA,
           complete cds.
          Length = 332

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 40/82 (48%), Positives = 50/82 (60%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   V G   N RG    TFG + V  F  +  L  I RAH+ V DG+E FA+ QL
Sbjct: 207 SDPDKE--VAGWGENDRGVSF-TFGAEVVAKFLHKQDLDHICRAHQVVEDGYEFFAKRQL 263

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 264 VTLFSAPNYCGEFDNAGAMMSV 285



>pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1
           [similarity] - Neurospora crassa>gb:NCB20D17_1689634
           Neurospora crassa DNA linkage group V BAC clone
           B20D17.>gb:NCU89985_1690714 Neurospora crassa
           serine/threonine protein phosphatase PPT1 (ppt-1) mRNA,
           complete cds.
          Length = 479

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 35/80 (43%), Positives = 46/80 (57%)
 Frame = -2

Query: 894 TENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITL 715
           T+     G  P+ RG G+  FGPD    FC +N L+ IIR+HE  MDG+E    G+ IT+
Sbjct: 368 TDPQPFPGRGPSKRGVGM-QFGPDVTKRFCDKNGLEAIIRSHEVRMDGYEEEHDGKCITV 426

Query: 714 FSATNYCGTANNAGAILVVG 655
           FSA  YC    N GA + +G
Sbjct: 427 FSAPKYCDMTENKGAYINIG 446



>pir|C96665|C96665 phosphoprotein phosphatase (EC 3.1.3.16) 1
           F22C12.20 [similarity] - Arabidopsis
           thaliana>gb:AE005173_894063 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007764_1536182 Genomic sequence for
           Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.
          Length = 340

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 40/92 (43%), Positives = 55/92 (59%), Gaps = 10/92 (10%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVM----------D 754
           SDP ++  +EG   N RG    TFG D+V +F + + L LI RAH+ +           D
Sbjct: 204 SDPDKD--IEGWGENDRGVSY-TFGADKVEEFLQTHDLDLICRAHQVIFCFRHVSVVVED 260

Query: 753 GFERFAQGQLITLFSATNYCGTANNAGAILVV 658
           G+E FA  QL+T+FSA NYCG  +NAGA++ V
Sbjct: 261 GYEFFANRQLVTIFSAPNYCGEFDNAGAMMSV 292



>gb:CEC05A2_1360023 Caenorhabditis elegans cosmid C05A2, complete
           sequence.>gb:CET28B11_1368305 Caenorhabditis elegans
           cosmid T28B11, complete sequence.
          Length = 349

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +V G  PN RG   V FG D +  F ++  L +++R H+ V DG+E F +  L
Sbjct: 212 SDP--DATVVGWAPNERGVSYV-FGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGL 268

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 269 VTVFSAPNYCGEFDNAGAVMNV 290



>pir|T18936|T18936 phosphoprotein phosphatase (EC 3.1.3.16) 1-beta
           catalytic chain - Caenorhabditis elegans
          Length = 401

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 36/82 (43%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +V G  PN RG   V FG D +  F ++  L +++R H+ V DG+E F +  L
Sbjct: 264 SDP--DATVVGWAPNERGVSYV-FGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGL 320

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA++ V
Sbjct: 321 VTVFSAPNYCGEFDNAGAVMNV 342



>sp|P12982|PP12_DROME Serine/threonine protein phosphatase alpha-2
           isoform (EC 3.1.3.16).>pir|S12960|PAFF1A phosphoprotein
           phosphatase (EC 3.1.3.16) 1-alpha-2 catalytic chain -
           fruit fly (Drosophila melanogaster)>gb:AE014297_1139216
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003695_1221209 Drosophila melanogaster
           chromosome 3R, section 33 of 118 of the complete
           sequence.>gb:AY061063_1292866 Drosophila melanogaster
           LD03380 full length cDNA.>gb:DMPP1_1379980
           D.melanogaster gene for protein phosphase
           1.>gb:DMPP1A_1379982 Fruitfly mRNA for protein
           phosphatase 1 alpha.
          Length = 302

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 38/82 (46%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP ++    G   N RG    TFG + V  F ++++  LI RAH+ V DG+E FA+  L
Sbjct: 205 SDPDKDTM--GWGENDRGVSF-TFGAEVVAKFLQKHEFDLICRAHQVVEDGYEFFAKRML 261

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +TLFSA NYCG  +NAGA++ V
Sbjct: 262 VTLFSAPNYCGEFDNAGAMMSV 283



>gb:ATU80922_1557301 Arabidopsis thaliana serine/threonine protein
           phosphatase type one (TOPP8) gene, complete cds.
          Length = 318

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 38/82 (46%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   +EG   + RG    TFG D+V +F  +N L LI R H+ V D +E FA+ +L
Sbjct: 209 SDPDQK--IEGWADSDRGISC-TFGADKVAEFLDKNDLDLICRGHQVVEDEYEFFAKRRL 265

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NY G  +NAGA+L V
Sbjct: 266 VTIFSAPNYGGEFDNAGALLSV 287



>gb:CEF22D6_1362832 Caenorhabditis elegans cosmid F22D6, complete
           sequence.
          Length = 368

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 32/76 (42%), Positives = 49/76 (64%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           ++  + + RG G + FG   V +FCK  +L LI+RAH+ V DG+E FA  +L+T+FSA  
Sbjct: 265 IDYYKESPRGAGKI-FGAKAVDEFCKHFQLDLIVRAHQVVQDGYEFFADRKLVTIFSAPF 323

Query: 699 YCGTANNAGAILVVGR 652
           YCG  NN  ++L + +
Sbjct: 324 YCGQTNNIASMLNIDK 339



>pir|T21256|T21256 hypothetical protein F22D6.9 - Caenorhabditis
           elegans
          Length = 285

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 32/76 (42%), Positives = 49/76 (64%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           ++  + + RG G + FG   V +FCK  +L LI+RAH+ V DG+E FA  +L+T+FSA  
Sbjct: 207 IDYYKESPRGAGKI-FGAKAVDEFCKHFQLDLIVRAHQVVQDGYEFFADRKLVTIFSAPF 265

Query: 699 YCGTANNAGAILVVGR 652
           YCG  NN  ++L + +
Sbjct: 266 YCGQTNNIASMLNIDK 281



>pir|T34462|T34462 phosphoprotein phosphatase (EC 3.1.3.16) 1
           W09C3.6 [similarity] - Caenorhabditis
           elegans>gb:U88178_1406680 Caenorhabditis elegans cosmid
           W09C3, complete sequence.
          Length = 305

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 33/74 (44%), Positives = 47/74 (63%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V+G + N RG   V FG D V D C R  + L+ RAH+ V DG+E FA  +++T+FSA +
Sbjct: 212 VKGWQANTRGVSYV-FGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPH 270

Query: 699 YCGTANNAGAILVV 658
           YCG  +N+ A + V
Sbjct: 271 YCGQFDNSAATMKV 284



>pir|T29191|T29191 phosphoprotein phosphatase (EC 3.1.3.16) 1
           T03F1.5 [similarity] - Caenorhabditis
           elegans>gb:U88169_1406603 Caenorhabditis elegans cosmid
           T03F1, complete sequence.
          Length = 305

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 33/74 (44%), Positives = 47/74 (63%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V+G + N RG   V FG D V D C R  + L+ RAH+ V DG+E FA  +++T+FSA +
Sbjct: 212 VKGWQANTRGVSYV-FGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPH 270

Query: 699 YCGTANNAGAILVV 658
           YCG  +N+ A + V
Sbjct: 271 YCGQFDNSAATMKV 284



>gb:CR382122_1655259 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 496

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 37/85 (43%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + S+     N RG    TF    + DFC +    LIIR H  V DG+E FA+ +L
Sbjct: 398 SDP--DSSINDWSLNDRGVSY-TFSKKNIADFCSKFNFDLIIRGHMVVEDGYEFFARKKL 454

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYCG   N GA++ V  G
Sbjct: 455 VTIFSAPNYCGEFENWGAVMSVTTG 479



>gb:LMFL232_1387844 Leishmania major Friedlin chromosome 14 cosmid
           L232.
          Length = 586

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 33/68 (48%), Positives = 44/68 (64%)
 Frame = -2

Query: 861 NARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTAN 682
           ++RG G   FGP   +DFC RNKL  I RAH+  MDG+      +++T+FSA NYC   N
Sbjct: 487 SSRGCGW-DFGPAASSDFCSRNKLNFICRAHQVAMDGYFWTHNDRVVTVFSAPNYCDINN 545

Query: 681 NAGAILVV 658
           N GA++VV
Sbjct: 546 NRGAVMVV 553



>gb:AF190457_1249485 Trypanosoma cruzi type 1 serine/threonine
           phosphoprotein phosphatase PP1beta (PP1beta) gene,
           complete cds.
          Length = 330

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 35/82 (42%), Positives = 53/82 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP EN    G   + RG    TFG D V   C+  K+ +++RAH+ V +G+  FA+ +L
Sbjct: 237 SDPEENSC--GWMQSQRGVSY-TFGEDVVRRACENLKIDVVLRAHQVVDNGYAFFAERRL 293

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA+NYCG   N+GA+L++
Sbjct: 294 VTIFSASNYCGEFTNSGAMLMM 315



>gb:AE016819_1748785 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 535

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 39/85 (45%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +V     N RG    TFG   V DFC   K  LIIR H  V DG+E FA+ + 
Sbjct: 435 SDP--DPAVSDWSLNDRGVSY-TFGKRNVYDFCANFKFDLIIRGHMVVEDGYEFFAKKKF 491

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYCG   N GA++ V  G
Sbjct: 492 VTIFSAPNYCGQFQNWGAVMSVTTG 516



>gb:TBBCHR1A4_1398856 Trypanosoma brucei DNA chromosome 1, segment
           4/4.
          Length = 925

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 37/81 (45%), Positives = 52/81 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E+  ++G R + RG G V FGPD   +F + N L+LIIR+H     G+E F  G+L
Sbjct: 492 SDPVED--LQGWRESHRGAG-VEFGPDLTHEFLQSNGLELIIRSHCDCERGYEEFHDGKL 548

Query: 723 ITLFSATNYCGTANNAGAILV 661
           +T+FSA+NY G   N G++ V
Sbjct: 549 VTVFSASNYNGPDTNYGSVAV 569



>sp|P49576|PPX1_PARTE Serine/threonine protein phosphatase PP-X
           homolog (EC 3.1.3.16).>gb:PTU31445_1396025 Paramecium
           tetraurelia macronuclear PPX homolog (ppx1) gene,
           complete cds.
          Length = 303

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 36/80 (45%), Positives = 48/80 (60%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D +EG   +ARG G V FG D V +F +RN + LI RAH+  M+GF+      L
Sbjct: 195 SDP---DEIEGWSQSARGAGFV-FGADVVKEFNRRNGISLICRAHQLAMEGFKLMFDNSL 250

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  +IL
Sbjct: 251 VTVWSAPNYCYRCGNVASIL 270



>gb:PFU89025_1395153 Plasmodium falciparum protein phosphatase-beta
           gene, complete cds.
          Length = 466

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = -2

Query: 903 SDPT--ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQG 730
           SDP   E++  EG +P+ RG G V F  ++   F + NKL  I RAH+ V DGF+     
Sbjct: 353 SDPAGPEDEITEGWKPSPRGAG-VLFSEEKTESFLRMNKLSCICRAHQLVQDGFQWMHND 411

Query: 729 QLITLFSATNYCGTANNAGAILVV 658
           +++T+FSA NYC    N  ++++V
Sbjct: 412 KVVTIFSAPNYCYRCGNCASLMLV 435



>gb:PFA929358_1393473 Plasmodium falciparum strain 3D7, chromosome
           9; segment 4/5.
          Length = 466

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 2/84 (2%)
 Frame = -2

Query: 903 SDPT--ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQG 730
           SDP   E++  EG +P+ RG G V F  ++   F + NKL  I RAH+ V DGF+     
Sbjct: 353 SDPAGPEDEITEGWKPSPRGAG-VLFSEEKTESFLRMNKLSCICRAHQLVQDGFQWMHND 411

Query: 729 QLITLFSATNYCGTANNAGAILVV 658
           +++T+FSA NYC    N  ++++V
Sbjct: 412 KVVTIFSAPNYCYRCGNCASLMLV 435



>gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete
           sequence.
          Length = 496

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG G   FGPD  + +C+ N ++ ++R+HE   +G+E    GQ 
Sbjct: 386 SDP---QPINGRSPSKRGVGC-QFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQC 441

Query: 723 ITLFSATNYCGTANNAGAILVV 658
            T+FSA NYC   NN GA + +
Sbjct: 442 FTVFSAPNYCDQMNNKGAFITI 463



>pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16)
           Y39B6B.ff [similarity] - Caenorhabditis elegans
          Length = 526

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 32/82 (39%), Positives = 47/82 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG G   FGPD  + +C+ N ++ ++R+HE   +G+E    GQ 
Sbjct: 416 SDP---QPINGRSPSKRGVGC-QFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQC 471

Query: 723 ITLFSATNYCGTANNAGAILVV 658
            T+FSA NYC   NN GA + +
Sbjct: 472 FTVFSAPNYCDQMNNKGAFITI 493



>gb:AE016814_1745912 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 538

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 40/87 (45%), Positives = 51/87 (58%), Gaps = 2/87 (2%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP    + EGL P+ RG G   FGPD    F ++N L+ IIR+HE  M G      G+L
Sbjct: 419 SDP---QAAEGLGPSQRGLGYA-FGPDVTARFLEKNGLKKIIRSHEVRMGGVAFEHAGKL 474

Query: 723 ITLFSATNYCGTANNAGAIL--VVGRG 649
           +T+FSA NYC T  N G I+  V G+G
Sbjct: 475 VTVFSAPNYCDTQGNLGGIIHVVPGKG 501



>gb:FRNINE1_2572048 Fugu rubripes U2 small nuclear ribonucleoprotein
           auxiliary factor subunit-related protein (U2AF1-RS2), 19
           kDa Golgi adaptor protein adaptin (AP19), and
           phosphorylase kinase alpha 2 subunit (PHKA2) genes,
           complete cds; kelch protein (KELCH1) and kelch protein
           (KELCH2) genes, partial cds; and protein phosphatase 1
           (PPEF-1), X-linked juvenile retinoschisis precursor
           protein (XLRS1), and serine-threonine kinase 9 (STK9)
           genes, complete cds.
          Length = 683

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 36/84 (42%), Positives = 50/84 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP    +++G  PN    G   FGPD       ++ LQL+IR+HEC  +G+E    GQ+
Sbjct: 390 SDPK---TLKGCCPNTFRGGGCYFGPDVTRRLLLQHGLQLLIRSHECKQEGYELCHSGQV 446

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           IT+FSA+NY    +N GA + VGR
Sbjct: 447 ITIFSASNYYEEGSNRGAYIKVGR 470



>gb:CR380949_1649472 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 563

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/85 (44%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  ++    N RG    TF    V D C R K  LIIR H  V DG+E FA+ +L
Sbjct: 459 SDP--DPQIQDWSLNDRGVSY-TFSKRNVYDICSRFKFDLIIRGHMVVEDGYEFFAKKKL 515

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYCG   N GA++ V  G
Sbjct: 516 VTVFSAPNYCGEFQNWGAVMSVTTG 540



>gb:AC137988_1208192 Trypanosoma cruzi strain Brener chromosome 3
           clone cosmids 1o17, 1m17, 1b21, 2n11, complete sequence.
          Length = 923

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 35/81 (43%), Positives = 52/81 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E+  ++G R + RG G+V FG D   +F + N L+L+IR+HE  + G+E    G+L
Sbjct: 493 SDPVED--LQGWRESPRGAGVV-FGADVTQEFLQNNGLELVIRSHEECLRGYEEHHDGKL 549

Query: 723 ITLFSATNYCGTANNAGAILV 661
           +T+FSA+NY G   N G+  V
Sbjct: 550 LTVFSASNYDGPETNFGSFAV 570



>pir|T14614|T14614 hypothetical protein - Trypanosoma cruzi
          Length = 704

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 35/81 (43%), Positives = 52/81 (64%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E+  ++G R + RG G+V FG D   +F + N L+L+IR+HE  + G+E    G+L
Sbjct: 368 SDPVED--LQGWRESPRGAGVV-FGADVTQEFLQNNGLELVIRSHEECLRGYEEHHDGKL 424

Query: 723 ITLFSATNYCGTANNAGAILV 661
           +T+FSA+NY G   N G+  V
Sbjct: 425 LTVFSASNYDGPETNFGSFAV 445



>gb:AY054983_1291088 Plasmodium falciparum Dd2 serine/threonine
           protein phosphatase PP5 mRNA, complete cds.
          Length = 594

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 37/80 (46%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E    +G +P+ RG G  +FG D   +F K N L LIIR+HE   +G+     GQL
Sbjct: 484 SDPNEE---KGFKPSKRGIGF-SFGTDITENFLKINNLSLIIRSHEVRDEGYSLEQNGQL 539

Query: 723 ITLFSATNYCGTANNAGAIL 664
            T+FSA NYC    N GA L
Sbjct: 540 YTVFSAPNYCDIMKNKGAFL 559



>gb:AF404815_1268581 Plasmodium falciparum serine/threonine protein
           phosphatase PfPP5 (pp5) gene, complete cds.
          Length = 594

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 37/80 (46%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E    +G +P+ RG G  +FG D   +F K N L LIIR+HE   +G+     GQL
Sbjct: 484 SDPNEE---KGFKPSKRGIGF-SFGTDITENFLKINNLSLIIRSHEVRDEGYSLEQNGQL 539

Query: 723 ITLFSATNYCGTANNAGAIL 664
            T+FSA NYC    N GA L
Sbjct: 540 YTVFSAPNYCDIMKNKGAFL 559



>gb:PFMAL13_1191603 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 658

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 37/80 (46%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E    +G +P+ RG G  +FG D   +F K N L LIIR+HE   +G+     GQL
Sbjct: 548 SDPNEE---KGFKPSKRGIGF-SFGTDITENFLKINNLSLIIRSHEVRDEGYSLEQNGQL 603

Query: 723 ITLFSATNYCGTANNAGAIL 664
            T+FSA NYC    N GA L
Sbjct: 604 YTVFSAPNYCDIMKNKGAFL 623



>gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138738 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003684_1220730
           Drosophila melanogaster chromosome 3R, section 22 of 118
           of the complete sequence.>gb:AE003684_1220731 Drosophila
           melanogaster chromosome 3R, section 22 of 118 of the
           complete sequence.>gb:AY058356_1291510 Drosophila
           melanogaster GH12714 full length
           cDNA.>gb:DME271781_1379103 Drosophila melanogaster mRNA
           for protein phosphatase 5 (PPP5 gene).
          Length = 520

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 34/72 (47%), Positives = 42/72 (58%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           GL  + RG G + FGPD    FCK N L  IIR+HE    G+E    G+ IT+FSA NYC
Sbjct: 416 GLGQSKRGVG-IQFGPDVTEKFCKDNNLDYIIRSHEVKDMGYEVAHNGKCITVFSAPNYC 474

Query: 693 GTANNAGAILVV 658
            T  N GA + +
Sbjct: 475 DTMGNMGAFITI 486



>sp|P32945|PPQ1_YEAST Serine/threonine protein phosphatase PPQ (EC
           3.1.3.16).>pir|S39533|S39533 phosphoprotein phosphatase
           (EC 3.1.3.16) PPQ1 - yeast  (Saccharomyces
           cerevisiae)>gb:SCDNAPPQ1_1707792 S.cerevisiae PPQ1
           gene.>gb:SCU00795_1709699 Saccharomyces cerevisiae
           translational allosuppressor serine-threonine protein
           phosphatase (SAL6) gene, complete cds, and tRNA-Glu,
           complete sequence.>gb:SCYPL179W_1714693 S.cerevisiae
           chromosome XVI reading frame ORF YPL179w.
          Length = 549

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 37/85 (43%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  +  V     N RG    TF    V DFC + K  LI+R H  V DG+E FA+ + 
Sbjct: 444 SDP--DPQVTDWSENDRGVSY-TFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKF 500

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYCG  +N GA++ V  G
Sbjct: 501 VTIFSAPNYCGEFHNWGAVMSVTTG 525



>pir|T22522|T22522 phosphoprotein phosphatase (EC 3.1.3.16) 1
           F52H3.6 [similarity] - Caenorhabditis
           elegans>gb:CEF52H3_1364276 Caenorhabditis elegans cosmid
           F52H3, complete sequence.
          Length = 329

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 33/82 (40%), Positives = 50/82 (60%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP  N  + G   ++RG   + FG D V DF ++  + LI R H+ V DG+E FA  +L
Sbjct: 203 ADPENN--MTGWAESSRGVSQI-FGADVVKDFTEKMNIDLIARGHQVVQDGYEFFADKRL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA  YCG  +N  A+++V
Sbjct: 260 VTIFSAPKYCGEFDNNAAVMIV 281



>gb:CR380950_1649867 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 510

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 38/87 (43%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D   GL P+ RG G   FGPD   D+ KRN L+ + R+HE  M G       +L
Sbjct: 391 SDPQQAD---GLGPSQRGLGFA-FGPDITADYLKRNNLKKVFRSHEVRMKGVLFEHNNKL 446

Query: 723 ITLFSATNYCGTANNAGAI--LVVGRG 649
            T+FSA NYC +  N G I  +V G+G
Sbjct: 447 ATVFSAPNYCDSQGNMGGIIHIVPGKG 473



>gb:AF496634_1277092 Oesophagostomum dentatum putative
           serine/threonine phosphatase (mPP1) gene, complete
           cds.>gb:AF496635_1277093 Oesophagostomum dentatum
           putative serine/threonine phosphatase (mPP1) mRNA,
           complete cds.
          Length = 311

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 32/74 (43%), Positives = 47/74 (63%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           V+G + N RG   V FG D V + C++  + LI RAH+ V DG+E FA  +++T+FSA +
Sbjct: 211 VKGWQANTRGVSYV-FGQDVVFETCQKLNIDLIARAHQVVQDGYEFFASKKMVTIFSAPH 269

Query: 699 YCGTANNAGAILVV 658
           YCG  +N  A + V
Sbjct: 270 YCGQFDNFAATMKV 283



>pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16)
           SPBC3F6.01c [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC3F6_1720089 S.pombe
           chromosome II cosmid c3F6.
          Length = 473

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 34/79 (43%), Positives = 45/79 (56%)
 Frame = -2

Query: 894 TENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITL 715
           T+     G  P+ RG GL  FGPD    FC+ N L+ +IR+HE    G+E    G  IT+
Sbjct: 364 TDPQPAPGRGPSKRGVGL-QFGPDVSKRFCEANGLKAVIRSHEVRDQGYEVEHDGYCITV 422

Query: 714 FSATNYCGTANNAGAILVV 658
           FSA NYC +  N GA++ V
Sbjct: 423 FSAPNYCDSTGNLGAVIKV 441



>pir|T27138|T27138 phosphoprotein phosphatase (EC 3.1.3.16) 1
           ZK938.1 [similarity] - Caenorhabditis
           elegans>gb:CEY53C12C_1370483 Caenorhabditis elegans YAC
           Y53C12C, complete sequence.>gb:CEZK938_1371922
           Caenorhabditis elegans cosmid ZK938, complete sequence.
          Length = 327

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 33/82 (40%), Positives = 49/82 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP  N +  G   N+RG   + FG + V DF ++  + LI R H+ V DG+E FA  +L
Sbjct: 203 ADPENNHT--GWGKNSRGVSYI-FGANVVKDFTEKMNIDLIARGHQVVQDGYEFFADKRL 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA  YCG  +N   I++V
Sbjct: 260 VTIFSAPKYCGEFDNNAGIMIV 281



>gb:BT011200_1357807 Drosophila melanogaster AT31252 full insert
           cDNA.
          Length = 337

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 29/61 (47%), Positives = 42/61 (68%)
 Frame = -2

Query: 834 FGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVG 655
           +G D +  F ++N   L+ RAH+ V DG+E FA+ QL+T+FSA NYCG  +NAGA + V 
Sbjct: 250 YGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVD 309

Query: 654 R 652
           +
Sbjct: 310 K 310



>gb:AF016433_1232316 Caenorhabditis elegans cosmid C09H5, complete
           sequence.
          Length = 333

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 36/82 (43%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  ++SV    PN RG   + FGP+ V    +   + LI RAH+ V DG+E FA+ +L
Sbjct: 232 SDP--DNSVIDWLPNVRGVSYI-FGPNVVKKQIETLGIDLIARAHQVVQDGYEFFAEKKL 288

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA +YCG  +N+ AI+ V
Sbjct: 289 VTIFSAPHYCGQFDNSAAIMNV 310



>gb:AE014134_1127309 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003581_1216385 Drosophila melanogaster
           chromosome 2L, section 10 of 83 of the complete
           sequence.
          Length = 336

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 29/61 (47%), Positives = 42/61 (68%)
 Frame = -2

Query: 834 FGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVG 655
           +G D +  F ++N   L+ RAH+ V DG+E FA+ QL+T+FSA NYCG  +NAGA + V 
Sbjct: 249 YGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVD 308

Query: 654 R 652
           +
Sbjct: 309 K 309



>pir|T31766|T31766 phosphoprotein phosphatase (EC 3.1.3.16) 1
           C09H5.7 [similarity] - Caenorhabditis elegans
          Length = 348

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 36/82 (43%), Positives = 52/82 (63%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  ++SV    PN RG   + FGP+ V    +   + LI RAH+ V DG+E FA+ +L
Sbjct: 247 SDP--DNSVIDWLPNVRGVSYI-FGPNVVKKQIETLGIDLIARAHQVVQDGYEFFAEKKL 303

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA +YCG  +N+ AI+ V
Sbjct: 304 VTIFSAPHYCGQFDNSAAIMNV 325



>gb:CEC47A4_1361305 Caenorhabditis elegans cosmid C47A4, complete
           sequence.
          Length = 316

 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 31/72 (43%), Positives = 43/72 (59%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           + G   N RG G   FG D V + C   +L L+ RAH+ V DG+E FA  +L+T+FSA +
Sbjct: 213 LSGFMNNQRGAGC-GFGRDSVLNLCSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPH 271

Query: 699 YCGTANNAGAIL 664
           YCG  +N  A +
Sbjct: 272 YCGQFDNCAAFM 283



>gb:AC024135_1204204 Caenorhabditis elegans cosmid C25A6, complete
           sequence.
          Length = 261

 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 33/72 (45%), Positives = 42/72 (58%)
 Frame = -2

Query: 879 VEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATN 700
           + G   N RG G   FG D V   C   KL LI RAH+ V DG+E FA  +L+T+FSA +
Sbjct: 179 LSGFMENNRGAGC-GFGRDAVLKVCSDFKLDLICRAHQVVQDGYEFFAGRKLVTIFSAPH 237

Query: 699 YCGTANNAGAIL 664
           YCG  +N  A +
Sbjct: 238 YCGQFDNCAAFM 249



>gb:AF305085_1260700 Trypanosoma brucei serine/threonine protein
           phosphatase type 5 mRNA, complete cds.
          Length = 472

 Score = 62.8 bits (151), Expect = 9e-09
 Identities = 32/80 (40%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG   ++FGPD    F   N L+L++R+HE   +G+E    G+ 
Sbjct: 362 SDP---QPMPGRAPSKRGVSCLSFGPDVTETFLNNNNLKLLVRSHEVKDEGYEIEHGGKC 418

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FSA NYC    N GA +
Sbjct: 419 ITVFSAPNYCDQMGNKGAFI 438



>sp|P53043|PPT1_YEAST Serine/threonine protein phosphatase T (EC
           3.1.3.16) (PPT).>pir|S52571|S52571 phosphoprotein
           phosphatase (EC 3.1.3.16) PPT1 - yeast  (Saccharomyces
           cerevisiae)>gb:AY558095_1614322 Saccharomyces cerevisiae
           clone FLH112420.01X YGR123C gene, complete
           cds.>gb:SCDNAORFS_1707785 S.cerevisiae DNA for ORFs from
           chromosome VII.>gb:SCYGR123C_1712351 S.cerevisiae
           chromosome VII reading frame ORF YGR123c.
          Length = 513

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 35/85 (41%), Positives = 49/85 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP E     G+ P+ RG G   FGPD    F + NKL+ I R+HE  M G +   +G+L
Sbjct: 394 ADPQE---ANGMGPSQRGLGHA-FGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKL 449

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYC +  N G ++ V  G
Sbjct: 450 MTVFSAPNYCDSQGNLGGVIHVVPG 474



>gb:CR382131_1664667 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 716

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 35/84 (41%), Positives = 47/84 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP    S+     N RG     FG   V  FC + K  L+ RAH  V DG+E F + +L
Sbjct: 600 SDPER--SIMEWSENDRGVSYC-FGRSVVNKFCTKFKFDLVCRAHMVVQDGYEFFNKRKL 656

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA NYCG  +N GA++ V +
Sbjct: 657 VTVFSAPNYCGEFDNWGAVMCVSK 680



>gb:EUP515296_1384966 Euplotes octocarinatus macronuclear partial c6
           gene for putative serine/threonine protein phosphatase
           PP1.
          Length = 116

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 4/69 (5%)
 Frame = -2

Query: 855 RGPG----LVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGT 688
           R PG    LV FGPDR+  F K N   +I+RAH+ +  G+ +FA GQ IT+ S TNY   
Sbjct: 9   RDPGGKRNLVKFGPDRIEKFLKANYHYIILRAHDIISTGYSKFADGQCITINSCTNYNKY 68

Query: 687 ANNAGAILV 661
            N+AG  +V
Sbjct: 69  NNDAGFFVV 77



>gb:AE016820_1750090 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 310

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 35/80 (43%), Positives = 47/80 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E D+   L P  RG G + FG + V  F  RN + LI RAH+ VM+G++    G L
Sbjct: 197 SDPDEVDTWS-LSP--RGAGFL-FGKNEVDQFLHRNDISLIARAHQLVMEGYKEMFDGGL 252

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  A+L
Sbjct: 253 VTVWSAPNYCYRCGNVAAVL 272



>gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 512

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 32/73 (43%), Positives = 42/73 (57%)
 Frame = -2

Query: 876 EGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNY 697
           +G  P+ RG     FGPD    F K+N L+ I R+HE    G+E   + QL+T+FSA NY
Sbjct: 400 DGFGPSPRGLSNA-FGPDITRKFLKQNNLKRIFRSHEVRQGGYEFEHENQLVTVFSAPNY 458

Query: 696 CGTANNAGAILVV 658
           C    N GAI+ V
Sbjct: 459 CDAGGNLGAIIHV 471



>gb:U39851_1403139 Caenorhabditis elegans cosmid C23G10, complete
           sequence.
          Length = 456

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 34/85 (40%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   V G   N RG   V FG + V + CK   + LI+R H+ V DG+E FA  +L
Sbjct: 344 SDPAK---VSGWTANPRGAS-VQFGENEVKEMCKLLDIDLIVRGHQVVQDGYEFFAGKKL 399

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA +Y  +  N+ A+  V  G
Sbjct: 400 VTVFSAPHYMQSFTNSAAVCKVSAG 424



>gb:TCR312136_1399782 Trypanosoma cruzi PP1 gene for putative
           serine/threonine protein phosphatase, strain Y.
          Length = 351

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 37/82 (45%), Positives = 48/82 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP E     G   N RG    TFG D V    K+  L LI RAH+ V  G+E F+  +L
Sbjct: 252 ADPGE---CSGWGENDRGVSW-TFGEDIVQATLKQFDLDLICRAHQVVDAGYEFFSARRL 307

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +NAGA ++V
Sbjct: 308 VTVFSAPNYCGEFDNAGAFMIV 329



>gb:AC006679_1203699 Caenorhabditis elegans cosmid R13A5, complete
           sequence.
          Length = 421

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 35/82 (42%), Positives = 50/82 (60%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP  + SV   + ++RG G  TFG + + D CKR  ++LIIRAH+   DG+   +  +L
Sbjct: 306 ADP--DPSVFEWKASSRGSGF-TFGTNVIDDVCKRLGVELIIRAHQMCFDGYWVLSGRKL 362

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           IT+FSA  YC    NAG +L V
Sbjct: 363 ITIFSAPMYCNFYKNAGCVLKV 384



>sp|P48459|YSD1_CAEEL Putative serine/threonine protein phosphatase
           C23G10.1 in chromosome II (EC
           3.1.3.16).>gb:U39851_1403140 Caenorhabditis elegans
           cosmid C23G10, complete sequence.
          Length = 354

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 34/85 (40%), Positives = 48/85 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +   V G   N RG   V FG + V + CK   + LI+R H+ V DG+E FA  +L
Sbjct: 242 SDPAK---VSGWTANPRGAS-VQFGENEVKEMCKLLDIDLIVRGHQVVQDGYEFFAGKKL 297

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA +Y  +  N+ A+  V  G
Sbjct: 298 VTVFSAPHYMQSFTNSAAVCKVSAG 322



>gb:AC135918_1742825 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0115F21, complete sequence.
          Length = 483

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 31/70 (44%), Positives = 42/70 (60%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+LIT+FSA NYC
Sbjct: 379 GRGPSKRGVGL-SFGADVTKKFLQENNLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYC 437

Query: 693 GTANNAGAIL 664
               N GA +
Sbjct: 438 DQMGNKGAYI 447



>gb:AF190456_1249484 Trypanosoma cruzi type 1 serine/threonine
           phosphoprotein phosphatase PP1alpha (PP1alpha) gene,
           complete cds.
          Length = 297

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 33/82 (40%), Positives = 48/82 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP   D V G   + RG   + FG D V+DF     + L++RAH+ +  G+  FA  QL
Sbjct: 204 ADP--EDEVRGFLESDRGVSYL-FGEDIVSDFLDMVDMDLVVRAHQVMERGYGFFANRQL 260

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +N  A++ V
Sbjct: 261 VTIFSAPNYCGEFDNDAAVMNV 282



>gb:AB070573_1197345 Caenorhabditis elegans pph-4.1 mRNA for Ser/Thr
           protein phosphatase, complete cds.
          Length = 294

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E +   GL P  RG G + FG D    FC+ N + LI RAH+ VM+G++     ++
Sbjct: 184 SDPEEGNVGWGLSP--RGAGYL-FGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKV 240

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 241 LTVWSAPNYCYRCGNVAAIL 260



>pir|T27390|T27390 phosphoprotein phosphatase (EC 3.1.3.16)
           Y75B8A.30 - Caenorhabditis elegans>gb:CEY75B8A_1371121
           Caenorhabditis elegans YAC Y75B8A, complete sequence.
          Length = 333

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 34/80 (42%), Positives = 47/80 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E +   GL P  RG G + FG D    FC+ N + LI RAH+ VM+G++     ++
Sbjct: 223 SDPEEGNVGWGLSP--RGAGYL-FGADASKTFCETNGVDLICRAHQLVMEGYKWHFNEKV 279

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 280 LTVWSAPNYCYRCGNVAAIL 299



>sp|O35385|PPE2_MOUSE Serine/threonine protein phosphatase with
           EF-hands-2 (EC 3.1.3.16) (PPEF-2).>gb:AF023458_2051247
           Mus musculus protein phosphatase with EF-hands-2
           (PPEF-2) mRNA, complete cds.>gb:BC027049_2095714 Mus
           musculus protein phosphatase, EF hand calcium-binding
           domain 2, mRNA (cDNA clone MGC:38671 IMAGE:5356685),
           complete cds.
          Length = 757

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 33/83 (39%), Positives = 48/83 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP      EG + NA   G   FGPD      ++ KLQL+IR+HEC  +G+E     ++
Sbjct: 451 SDPAAQ---EGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKV 507

Query: 723 ITLFSATNYCGTANNAGAILVVG 655
           +T+FSA+NY    +N GA + +G
Sbjct: 508 LTIFSASNYYEVGSNRGAYVKLG 530



>gb:AY182777_1587883 Lycopersicon esculentum type 5 protein
           serine/threonine phosphatase 62 kDa isoform (PP5) mRNA,
           complete cds, alternatively spliced.>gb:AY182778_1587884
           Lycopersicon esculentum type 5 protein serine/threonine
           phosphatase (PP5) gene, complete cds, alternatively
           spliced.
          Length = 556

 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 31/70 (44%), Positives = 42/70 (60%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+LIT+FSA NYC
Sbjct: 452 GRGPSKRGVGL-SFGGDVTKRFLQENNLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYC 510

Query: 693 GTANNAGAIL 664
               N GA +
Sbjct: 511 DQMGNKGAFI 520



>gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threonine
           phosphatase 55 kDa isoform mRNA, complete cds;
           alternatively spliced.>gb:AY182778_1587885 Lycopersicon
           esculentum type 5 protein serine/threonine phosphatase
           (PP5) gene, complete cds, alternatively spliced.
          Length = 485

 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 31/70 (44%), Positives = 42/70 (60%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+LIT+FSA NYC
Sbjct: 381 GRGPSKRGVGL-SFGGDVTKRFLQENNLDLVVRSHEVKDEGYEIEHDGKLITVFSAPNYC 439

Query: 693 GTANNAGAIL 664
               N GA +
Sbjct: 440 DQMGNKGAFI 449



>pir|A99987|A99987 phosphoprotein phosphatase (EC 3.1.3.16) 1
           catalytic chain [similarity] - Guillardia theta
           nucleomorph>gb:AF165818_1773778 Guillardia theta
           nucleomorph chromosome 1, complete sequence.
          Length = 304

 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 33/84 (39%), Positives = 51/84 (60%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  N+  +G   + RG    T+G + V +F ++    LI RAH+ V  G++ F+   L
Sbjct: 203 SDP--NEDKQGWNLSDRGISY-TYGDNIVKEFIEKFDFDLICRAHQVVDKGYKFFSNRML 259

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA NYCG  +NAGA++ V +
Sbjct: 260 VTIFSAPNYCGEFSNAGAVMNVDK 283



>gb:SCPPH3_1709179 S.cerevisiae PPH3 gene for type 2A-related
           protein phosphatase 2A.
          Length = 308

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 33/82 (40%), Positives = 49/82 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D+   L P  RG G + FG   V  F ++N ++LI RAH+ VM+G++    G L
Sbjct: 195 SDPEDVDTWS-LSP--RGAGFL-FGKREVDQFLEKNNVELIARAHQLVMEGYKEIFDGGL 250

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T++SA NYC    N  A+L +
Sbjct: 251 VTVWSAPNYCYRCGNVAAVLKI 272



>gb:CR382133_1666444 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 559

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = -2

Query: 903 SDPT---ENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQ 733
           SDP    +N S      N RG     FG   V  FC + K+ LI+R H  V DG+E F +
Sbjct: 462 SDPDPLIKNFSPTNWPKNDRGVSYC-FGKKHVDYFCLKFKMDLIVRGHMVVEDGYEFFDK 520

Query: 732 GQLITLFSATNYCGTANNAGAILVVGR 652
            +L+T+F A NYCG  +N GAI+ V +
Sbjct: 521 RKLVTVFLAPNYCGEFDNYGAIMSVDK 547



>gb:AY182779_1587886 Arabidopsis thaliana type 5 protein
           serine/threonine phosphatase 60 kDa isoform mRNA,
           complete cds, alternatively spliced.
          Length = 538

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/80 (42%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+L
Sbjct: 427 SDP---QPLPGRGPSKRGVGL-SFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKL 482

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FSA NYC    N GA +
Sbjct: 483 ITVFSAPNYCDQMGNKGAFI 502



>gb:AY080674_1568404 Arabidopsis thaliana putative phosphoprotein
           phosphatase (At2g42810) mRNA, partial cds.
          Length = 325

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/80 (42%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+L
Sbjct: 214 SDP---QPLPGRGPSKRGVGL-SFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKL 269

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FSA NYC    N GA +
Sbjct: 270 ITVFSAPNYCDQMGNKGAFI 289



>gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D19
           map m551, complete sequence.>gb:BT010180_1640246
           Arabidopsis thaliana At2g42810/F7D19.19 mRNA, complete
           cds.>gb:AF419574_1798436 Arabidopsis thaliana
           At2g42810/F7D19.19 mRNA, complete cds.
          Length = 484

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/80 (42%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+L
Sbjct: 373 SDP---QPLPGRGPSKRGVGL-SFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKL 428

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FSA NYC    N GA +
Sbjct: 429 ITVFSAPNYCDQMGNKGAFI 448



>gb:BT015959_1358404 Drosophila melanogaster RH46370 full insert
           cDNA.
          Length = 603

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNA-RGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQ 727
           SDP    +  G  PN  RG G V FGPD   +F +R++L  +IR+HEC  +G E     +
Sbjct: 261 SDP---QATMGCVPNTLRGAG-VWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 316

Query: 726 LITLFSATNYCGTANNAGAIL 664
           +IT+FSA+NY    +N GA +
Sbjct: 317 IITIFSASNYYAIGSNKGAYI 337



>gb:AE014296_1137139 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003514_1213577 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.
          Length = 603

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNA-RGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQ 727
           SDP    +  G  PN  RG G V FGPD   +F +R++L  +IR+HEC  +G E     +
Sbjct: 261 SDP---QATMGCVPNTLRGAG-VWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 316

Query: 726 LITLFSATNYCGTANNAGAIL 664
           +IT+FSA+NY    +N GA +
Sbjct: 317 IITIFSASNYYAIGSNKGAYI 337



>pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16)
           At2g42810 [similarity] - Arabidopsis thaliana
          Length = 533

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/80 (42%), Positives = 46/80 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+L
Sbjct: 422 SDP---QPLPGRGPSKRGVGL-SFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKL 477

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FSA NYC    N GA +
Sbjct: 478 ITVFSAPNYCDQMGNKGAFI 497



>sp|P40421|RDGC_DROME Serine/threonine protein phosphatase rdgC (EC
           3.1.3.16) (Retinal degeneration C
           protein).>pir|A42287|A42287 phosphoprotein phosphatase
           (EC 3.1.3.16) rdgC - fruit fly  (Drosophila
           melanogaster)>gb:AE014296_1137136 Drosophila
           melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1137137 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE014296_1137138
           Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003514_1213574 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:AE003514_1213575 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:AE003514_1213576 Drosophila melanogaster
           chromosome 3L, section 71 of 83 of the complete
           sequence.>gb:DRORDGC_1382632 Drosophila melanogaster
           retinal degeneration C (rdgC) gene, complete cds.
          Length = 661

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 34/81 (41%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNA-RGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQ 727
           SDP    +  G  PN  RG G V FGPD   +F +R++L  +IR+HEC  +G E     +
Sbjct: 319 SDP---QATMGCVPNTLRGAG-VWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 374

Query: 726 LITLFSATNYCGTANNAGAIL 664
           +IT+FSA+NY    +N GA +
Sbjct: 375 IITIFSASNYYAIGSNKGAYI 395



>sp|O04951|P2A5_ARATH Serine/threonine protein phosphatase PP2A-5
           catalytic subunit (EC 3.1.3.16).>pir|B96722|B96722
           phosphoprotein phosphatase (EC 3.1.3.16) 2A catalytic
           chain F20P5.30 [similarity] - Arabidopsis
           thaliana>gb:AE005173_894580 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1536994 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.>gb:ATU39568_1556965 Arabidopsis thaliana type
           2A serine/threonine protein phosphatase (PP2A) mRNA,
           complete cds.>gb:F20P5_1677784 Sequence of BAC F20P5
           from Arabidopsis thaliana chromosome 1, complete
           sequence.
          Length = 307

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 32/73 (43%), Positives = 40/73 (54%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D  T F   N L LI RAH+ VM+GF    +  ++T+FSA NYC
Sbjct: 208 GISPRGAG---YTFGQDIATQFNHTNGLSLISRAHQLVMEGFNWCQEKNVVTVFSAPNYC 264

Query: 693 GTANNAGAILVVG 655
               N  AIL +G
Sbjct: 265 YRCGNMAAILEIG 277



>sp|P32345|P2A3_YEAST Serine/threonine protein phosphatase PPH3 (EC
           3.1.3.16).>pir|S44331|PABY3 phosphoprotein phosphatase
           (EC 3.1.3.16) PPH3 - yeast  (Saccharomyces
           cerevisiae)>gb:AY557686_1613913 Saccharomyces cerevisiae
           clone FLH001557.01X YDR075W gene, complete
           cds.>gb:SC8554_1705687 S.cerevisiae chromosome IV cosmid
           8554.>gb:SCCHROIV_1707014 S.cerevisiae DNA for right arm
           of chromosome IV.>gb:SCYDR075W_1711894 S.cerevisiae
           chromosome IV reading frame ORF YDR075w.
          Length = 308

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 33/82 (40%), Positives = 49/82 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D+   L P  RG G + FG   V  F ++N ++LI RAH+ VM+G++    G L
Sbjct: 195 SDPEDVDTWS-LSP--RGAGFL-FGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGL 250

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T++SA NYC    N  A+L +
Sbjct: 251 VTVWSAPNYCYRCGNVAAVLKI 272



>sp|P34350|YK84_CAEEL Hypothetical protein C30A5.4 in chromosome
           III.>pir|S44777|S44777 C30A5.3 protein - Caenorhabditis
           elegans>gb:L10990_1386817 Caenorhabditis elegans cosmid
           C30A5, complete sequence.
          Length = 378

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 34/82 (41%), Positives = 49/82 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           +DP  + SV   + ++RG G  TFG + + D CKR  ++LIIRAH+   DG+   +  +L
Sbjct: 263 ADP--DPSVFEWKTSSRGSGF-TFGTNVIDDVCKRLGVELIIRAHQMCFDGYWVLSGRKL 319

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           IT+FSA  YC    N G +L V
Sbjct: 320 ITIFSAPMYCNFYKNTGCVLKV 341



>gb:CR380957_1652952 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 309

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 32/82 (39%), Positives = 46/82 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D V+    + RG G + FG   V +F   N + LI RAH+ VM+G++    G L
Sbjct: 196 SDP---DEVDTWSMSPRGAGFL-FGKGEVDEFLHVNNVDLIARAHQLVMEGYKEMFDGGL 251

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T++SA NYC    N  A+L +
Sbjct: 252 VTVWSAPNYCYRCGNVAAVLKI 273



>gb:AY087557_1572587 Arabidopsis thaliana clone 36621 mRNA, complete
           sequence.
          Length = 306

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 31/73 (42%), Positives = 40/73 (54%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D  T F   N L LI RAH+ VM+G+    +  ++T+FSA NYC
Sbjct: 207 GISPRGAG---YTFGQDIATQFNHNNGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYC 263

Query: 693 GTANNAGAILVVG 655
               N  AIL +G
Sbjct: 264 YRCGNMAAILEIG 276



>sp|P48577|P2A_ACECL Serine/threonine protein phosphatase PP2A-1
           catalytic subunit (EC 3.1.3.16).>gb:ACMRPP2A_1745376
           A.cliftonii mRNA for protein phosphatase 2A.
          Length = 307

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 34/85 (40%), Positives = 45/85 (52%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E     G+ P   G    TFG D    F  RN L+L+ RAH+ VM+G+    +  +
Sbjct: 198 SDPDERLGW-GISPRGAG---YTFGQDISEQFNVRNSLKLVARAHQLVMEGYNWSHEKNV 253

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYC    N  AI+ V  G
Sbjct: 254 VTIFSAPNYCYRCGNMAAIMEVAEG 278



>sp|Q07099|P2A2_ARATH Serine/threonine protein phosphatase PP2A-2
           catalytic subunit (EC 3.1.3.16).>pir|S31161|S31161
           phosphoprotein phosphatase (EC 3.1.3.16) 2A-alpha
           catalytic chain (clone EP8a) - Arabidopsis
           thaliana>gb:AE005173_893666 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007258_1535667 Arabidopsis thaliana
           chromosome I BAC F23H11 genomic sequence, complete
           sequence.>gb:ATHPRPHA_1553325 Arabidopsis thaliana
           protein phosphatase mRNA, complete
           cds.>gb:AY063942_1565889 Arabidopsis thaliana putative
           serine/threonine protein phosphatase type 2A (At1g59830)
           mRNA, complete cds.>gb:AY096543_1576085 Arabidopsis
           thaliana putative serine/threonine protein phosphatase
           type 2A (At1g59830) mRNA, complete cds.
          Length = 306

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 31/73 (42%), Positives = 40/73 (54%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D  T F   N L LI RAH+ VM+G+    +  ++T+FSA NYC
Sbjct: 207 GISPRGAG---YTFGQDIATQFNHNNGLSLISRAHQLVMEGYNWCQEKNVVTVFSAPNYC 263

Query: 693 GTANNAGAILVVG 655
               N  AIL +G
Sbjct: 264 YRCGNMAAILEIG 276



>gb:TRBPHOAT1B_1400759 Trypansoma brucei protein phosphatase 1
           catalytic subunit mRNA, complete cds.
          Length = 346

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/82 (45%), Positives = 45/82 (54%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ N        N RG    TF    V  F K+  L LI RAH+ V  G+E FA  QL
Sbjct: 245 SDPSTNME-SNWSENDRGVSW-TFSESVVKSFNKKFDLDLICRAHQVVDAGYEFFAARQL 302

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC   +NAGA + V
Sbjct: 303 VTVFSAPNYCDEFDNAGAFMCV 324



>gb:TCR311369_1399781 Trypanosoma cruzi PP2A gene for putative
           serine threonine/protein phosphatase, type 2A.
          Length = 340

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/80 (41%), Positives = 44/80 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D   G+ P  RG G  TFG D    FC  N L++I RAH+ V DG+      +L
Sbjct: 232 SDPEDRDGW-GISP--RGAGF-TFGADISEQFCHNNGLKMIARAHQLVTDGYSWAHNDRL 287

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T+F+A NYC    N   +L
Sbjct: 288 VTIFTAPNYCYRCGNLAGLL 307



>sp|P23734|PP12_TRYBB Serine/threonine protein phosphatase PP1(5.9)
           (EC 3.1.3.16).>pir|S12599|S12599 phosphoprotein
           phosphatase (EC 3.1.3.16) - Trypanosoma
           brucei>gb:TBPP159_1399177 Trypanosoma brucei PP1(5.9)
           gene for protein phosphatase catalytic subunit.
          Length = 346

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/82 (45%), Positives = 45/82 (54%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ N        N RG    TF    V  F K+  L LI RAH+ V  G+E FA  QL
Sbjct: 245 SDPSTNME-SNWSENDRGVSW-TFSESVVKSFNKKFDLDLICRAHQVVDAGYEFFAARQL 302

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC   +NAGA + V
Sbjct: 303 VTVFSAPNYCDEFDNAGAFMCV 324



>sp|P23733|PP11_TRYBB Serine/threonine protein phosphatase PP1(4.8)
           (EC 3.1.3.16).>gb:TBPP148_1399176 Trypanosoma brucei
           PP1(4.8) gene for protein phosphatase catalytic subunit.
          Length = 346

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/82 (45%), Positives = 45/82 (54%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP+ N        N RG    TF    V  F K+  L LI RAH+ V  G+E FA  QL
Sbjct: 245 SDPSTNME-SNWSENDRGVSW-TFSESVVKSFNKKFDLDLICRAHQVVDAGYEFFAARQL 302

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC   +NAGA + V
Sbjct: 303 VTVFSAPNYCDEFDNAGAFMCV 324



>gb:AF321467_1785940 Yarrowia lipolytica serine/threonine
           phosphatase Pph21p (pph21) gene, complete cds.
          Length = 380

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 36/82 (43%), Positives = 44/82 (53%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D   G   + RG G  TFG D    F   N L LI RAH+ VM+GF    + Q+
Sbjct: 272 SDP---DDRGGWGMSPRGAGF-TFGADISEQFNHTNNLSLISRAHQLVMEGFSWAHEQQV 327

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC    N  AI+ V
Sbjct: 328 VTIFSAPNYCYRCGNQAAIMEV 349



>gb:CR382127_1659626 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 463

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 36/82 (43%), Positives = 44/82 (53%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D   G   + RG G  TFG D    F   N L LI RAH+ VM+GF    + Q+
Sbjct: 355 SDP---DDRGGWGMSPRGAGF-TFGADISEQFNHTNNLSLISRAHQLVMEGFSWAHEQQV 410

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC    N  AI+ V
Sbjct: 411 VTIFSAPNYCYRCGNQAAIMEV 432



>gb:CR382125_1657666 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 308

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 33/80 (41%), Positives = 47/80 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D+   L P  RG G + FG + V  F   N ++LI RAH+ VM+G++    G L
Sbjct: 195 SDPEDVDTWS-LSP--RGAGFL-FGQNEVDKFLHTNSVELIARAHQLVMEGYKEMFDGGL 250

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  A+L
Sbjct: 251 VTVWSAPNYCYRCGNVAAVL 270



>gb:CR548612_1375297 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 303

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 1/81 (1%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFER-FAQGQ 727
           SDP E   VE    N+RG G + FG     +FC+ N L LI RAH+ VM+G++  F    
Sbjct: 194 SDPEE---VEYWAVNSRGAGYL-FGAKVTKEFCRLNDLTLICRAHQLVMEGYKYWFPDQN 249

Query: 726 LITLFSATNYCGTANNAGAIL 664
           L+T++SA NYC    N  +IL
Sbjct: 250 LVTVWSAPNYCYRCGNVASIL 270



>gb:CEF58G1_1364797 Caenorhabditis elegans cosmid F58G1, complete
           sequence.
          Length = 364

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 44/80 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT     EG   + RG   + FG   V   CK  ++ LIIR H+ V DG+E  A  +L
Sbjct: 236 SDPTNKG--EGWFHSIRGISYM-FGKGVVEQACKSLEIDLIIRGHQVVQDGYEMMAGRRL 292

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FS  NYC    NA A++
Sbjct: 293 ITVFSVPNYCAQFTNAAAVV 312



>gb:AY902477_1355020 Schistosoma japonicum serine/threonine specific
           protein phosphatase mRNA, complete cds.
          Length = 302

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D V     + RG G + FGP    +F + N L+ I RAH+ V +G++    GQL
Sbjct: 194 SDP---DDVAHWAVSPRGAGYL-FGPKVTNEFVELNGLECICRAHQLVHEGYKCMFDGQL 249

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT++SA NYC    N  AIL
Sbjct: 250 ITIWSAPNYCYRCGNVAAIL 269



>gb:AC024817_1204822 Caenorhabditis elegans cosmid Y54G2A, complete
           sequence.
          Length = 177

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 44/80 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT     EG   + RG   + FG   V   CK  ++ LIIRAH+ V DG+E     +L
Sbjct: 49  SDPTNKG--EGWFHSIRGISYM-FGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRL 105

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FS  NYC    NA A++
Sbjct: 106 ITVFSVPNYCAQFTNAAAVV 125



>pir|S42843|S42843 phosphoprotein phosphatase (EC 3.1.3.16) 1 -
           Caenorhabditis elegans (fragment)
          Length = 320

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 32/84 (38%), Positives = 50/84 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +V+    + RG G V FG   +T    +  + L+ RAH+ V DG+E F   +L
Sbjct: 222 SDP--DSTVDDFVDSTRGVGQV-FGAKALTAIMNKLDVDLVARAHQVVQDGYEFFNNKRL 278

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA +YCG  +NA A++ V +
Sbjct: 279 VTIFSAPHYCGEFDNAAAMMNVDK 302



>pir|G88572|G88572 protein T16G12.7 [imported] - Caenorhabditis
           elegans>gb:CEM04D8_1366201 Caenorhabditis elegans cosmid
           M04D8, complete sequence.>gb:CET16G12_1367769
           Caenorhabditis elegans cosmid T16G12, complete sequence.
          Length = 319

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 32/84 (38%), Positives = 50/84 (59%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP  + +V+    + RG G V FG   +T    +  + L+ RAH+ V DG+E F   +L
Sbjct: 222 SDP--DSTVDDFVDSTRGVGQV-FGAKALTAIMNKLDVDLVARAHQVVQDGYEFFNNKRL 278

Query: 723 ITLFSATNYCGTANNAGAILVVGR 652
           +T+FSA +YCG  +NA A++ V +
Sbjct: 279 VTIFSAPHYCGEFDNAAAMMNVDK 302



>pir|T27049|T27049 phosphoprotein phosphatase (EC 3.1.3.16) Y49E10.3
           [similarity] - Caenorhabditis
           elegans>gb:CEY49E10_1370323 Caenorhabditis elegans YAC
           Y49E10, complete sequence.
          Length = 321

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 33/82 (40%), Positives = 47/82 (57%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP E  S  G+ P  RG G + FG D    FC+ N    I RAH+ VM+G++   + ++
Sbjct: 208 SDPEEGCSGWGISP--RGAGYL-FGGDAAELFCENNDFLRICRAHQLVMEGYKLHFRKRV 264

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T++SA NYC    N  AI+ V
Sbjct: 265 VTVWSAPNYCYRCGNVAAIMEV 286



>sp|P48458|YT91_CAEEL Putative serine/threonine protein phosphatase
           C06A1.3 in chromosome II (EC
           3.1.3.16).>pir|T18972|T18972 phosphoprotein phosphatase
           (EC 3.1.3.16) C06A1.3 [similarity] - Caenorhabditis
           elegans>gb:CEC06A1_1360079 Caenorhabditis elegans cosmid
           C06A1, complete sequence.
          Length = 364

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 34/80 (42%), Positives = 44/80 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT     EG   + RG   + FG   V   CK  ++ LIIRAH+ V DG+E     +L
Sbjct: 236 SDPTNKG--EGWFHSIRGISYM-FGKGVVEQACKSLEIDLIIRAHQVVQDGYEMMTGRRL 292

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+FS  NYC    NA A++
Sbjct: 293 ITVFSVPNYCAQFTNAAAVV 312



>sp|P48528|PPX2_ARATH Serine/threonine protein phosphatase PP-X
           isozyme 2 (EC 3.1.3.16).>gb:AB010071_1510907 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MCO15.>gb:AF030290_1762472 Arabidopsis thaliana
           protein phosphatase X isoform 2 (PPX2) gene, complete
           cds.
          Length = 305

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D V+G   + RG G + FG   VT F   N +  I RAH+ VM+G++     Q+
Sbjct: 195 SDP--EDIVDGWGLSPRGAGFL-FGGSVVTSFNHSNNIDYICRAHQLVMEGYKWMFNSQI 251

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 252 VTVWSAPNYCYRCGNVAAIL 271



>sp|P48579|P2A_HELAN Serine/threonine protein phosphatase PP2A
           catalytic subunit (EC 3.1.3.16).>pir|S37086|S37086
           phosphoprotein phosphatase (EC 3.1.3.16) type 2A -
           common sunflower>gb:HAPRPH2A_1681490 H.annuus mRNA for
           protein phosphatase type 2A.
          Length = 305

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 31/73 (42%), Positives = 39/73 (53%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D    F   N L LI RAH+ VM+G+    +  ++T+FSA NYC
Sbjct: 206 GISPRGAG---YTFGQDIAAQFNHTNGLSLISRAHQLVMEGYNWSQENNVVTIFSAPNYC 262

Query: 693 GTANNAGAILVVG 655
               N  AIL VG
Sbjct: 263 YRCGNMAAILEVG 275



>gb:AP005562_1854084 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1190_B07.>gb:AP005818_1858385 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0009H03.
          Length = 307

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 32/80 (40%), Positives = 47/80 (58%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D+V+G   + RG G + FG + V+ F   N +  I RAH+ VM+GF+     ++
Sbjct: 197 SDP--EDAVDGWGLSPRGAGFL-FGGNVVSSFNHTNNIDYICRAHQLVMEGFKWMFNNKI 253

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 254 VTVWSAPNYCYRCGNVAAIL 273



>gb:AF030978_1234496 Paramecium tetraurelia serine-threonine
           phosphoprotein phosphatase (pp2r-1) gene, complete cds.
          Length = 312

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 33/82 (40%), Positives = 44/82 (53%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +  S  G+ P   G    TFG D    F   NKL++I RAH+ VMDG+    +  +
Sbjct: 204 SDPDDR-SGWGISPRGAG---YTFGQDISEQFNHNNKLKMIARAHQLVMDGYSLAHERNV 259

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC    N   I+ V
Sbjct: 260 VTIFSAPNYCYRCGNQAGIMEV 281



>pir|S42559|S42559 phosphoprotein phosphatase (EC 3.1.3.16) X-2
           (clone EP128) - Arabidopsis
           thaliana>gb:ATPROPHOB_1553891 A.thaliana protein
           phosphatase mRNA.
          Length = 305

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D V+G   + RG G + FG   VT F   N +  I RAH+ VM+G++     Q+
Sbjct: 195 SDP--EDIVDGWGLSPRGAGFL-FGGSVVTSFNHLNNIDYICRAHQLVMEGYKWMFNSQI 251

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 252 VTVWSAPNYCYRCGNVAAIL 271



>gb:AF071751_1765806 Neurospora crassa protein phosphatase-Z-like
           serine/threonine protein phosphatase (pzl-1) gene,
           complete cds.>gb:AF071752_1765807 Neurospora crassa
           protein phosphatase-Z-like serine/threonine protein
           phosphatase (pzl-1) mRNA, complete cds.
          Length = 531

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 31/82 (37%), Positives = 45/82 (54%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP + D  +    N RG     FG   ++DF   +   ++ RAH  V DG+E +    L
Sbjct: 407 SDPADMD--QDWEANERGVSYC-FGKKVISDFLATHDFDVVCRAHMVVEDGYEFYTDRIL 463

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYCG  +N GA++ V
Sbjct: 464 VTIFSAPNYCGEFDNWGAVMAV 485



>gb:AF032879_1762665 Arabidopsis thaliana protein phosphatase U
           (PPU) mRNA, partial cds.
          Length = 195

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP     + G  P+ RG GL +FG D    F + N L L++R+HE   +G+E    G+L
Sbjct: 84  SDP---QPLPGRGPSKRGVGL-SFGGDVTKRFLQDNNLDLLVRSHEVKDEGYEVEHDGKL 139

Query: 723 ITLFSATNYCGTANNAGAIL 664
           IT+F A NYC    N GA +
Sbjct: 140 ITVFFAPNYCDQMGNKGAFI 159



>gb:AC115607_1205912 Dictyostelium discoideum chromosome 2 map
           4559693-4624405 strain AX4, complete
           sequence.>gb:AF161253_1246265 Dictyostelium discoideum
           protein phosphatase 4 catalytic subunit (pppC) mRNA,
           complete cds.
          Length = 305

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 33/80 (41%), Positives = 44/80 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   + + G   + RG G + FG D V  F   N L+ I RAH+ VM+GF+      L
Sbjct: 196 SDP---EDIPGWNGSPRGAGFL-FGEDVVQKFNHDNNLEFICRAHQLVMEGFKYMFNETL 251

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  AIL
Sbjct: 252 VTVWSAPNYCYRCGNVAAIL 271



>sp|Q07098|P2A1_ARATH Serine/threonine protein phosphatase PP2A-1
           catalytic subunit (EC 3.1.3.16).>pir|S31162|S31162
           phosphoprotein phosphatase (EC 3.1.3.16) 2A-alpha
           catalytic chain (clone EP14a) - Arabidopsis
           thaliana>gb:AE005172_890050 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007067_1535122 Genomic sequence for
           Arabidopsis thaliana BAC T10O24 from Chromosome 1,
           complete sequence.>gb:ATHPRPHB_1553326 Arabidopsis
           thaliana protein phosphatase mRNA, complete
           cds.>gb:AY059847_1564691 Arabidopsis thaliana similar to
           protein phosphatase type 2A (At1g10430; T10O24.4) mRNA,
           complete cds.>gb:AY093267_1575221 Arabidopsis thaliana
           similar to protein phosphatase type 2A (At1g10430) mRNA,
           complete cds.
          Length = 306

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 31/73 (42%), Positives = 38/73 (52%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D    F   N L LI RAH+ VM+GF       ++T+FSA NYC
Sbjct: 207 GISPRGAG---YTFGQDIAAQFNHNNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAPNYC 263

Query: 693 GTANNAGAILVVG 655
               N  AIL +G
Sbjct: 264 YRCGNMAAILEIG 276



>gb:HSPPEF_2019670 H.sapiens mRNA for serine/threonine protein
           phosphatase.
          Length = 653

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 30/85 (35%), Positives = 47/85 (55%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP       G  PN    G   FGPD  +    + +L+++IR+HEC  +G+E    G++
Sbjct: 362 SDPR---GTNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKV 418

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA+NY    +N GA + +  G
Sbjct: 419 VTIFSASNYYEEGSNRGAYIKLCSG 443



>gb:AE016817_1747483 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 362

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 36/82 (43%), Positives = 44/82 (53%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP +     G+ P  RG G  TFG D    F   N L LI RAH+ VMDG+    Q  +
Sbjct: 254 SDPDDRGGW-GISP--RGAGF-TFGQDISQQFNHTNDLSLIARAHQLVMDGYAWSHQQSV 309

Query: 723 ITLFSATNYCGTANNAGAILVV 658
           +T+FSA NYC    N  AI+ V
Sbjct: 310 VTIFSAPNYCYRCGNQAAIMEV 331



>gb:YSCPPZ2A_1730343 Saccharomyces cerevisiae type 1-related protein
           phosphatase (ppz2) gene, complete cds.
          Length = 710

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 33/85 (38%), Positives = 43/85 (50%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDPT  DS      N RG     +    +  F  +    L+ RAH  V DG+E F    L
Sbjct: 597 SDPT--DSSNEWEDNERGVSFC-YNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSL 653

Query: 723 ITLFSATNYCGTANNAGAILVVGRG 649
           +T+FSA NYCG  +N GA++ V  G
Sbjct: 654 VTVFSAPNYCGEFDNWGAVMTVSEG 678



>gb:AY325818_1599646 Lycopersicon esculentum protein phosphatase 2A
           catalytic subunit (PP2Ac2) mRNA, complete cds.
          Length = 306

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 31/73 (42%), Positives = 39/73 (53%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D  + F   N L LI RAH+ VM+GF       ++T+FSA NYC
Sbjct: 207 GISPRGAG---YTFGQDIASQFNHTNGLTLISRAHQLVMEGFNWCQDKNVVTVFSAPNYC 263

Query: 693 GTANNAGAILVVG 655
               N  AIL +G
Sbjct: 264 YRCGNMAAILEIG 276



>gb:AY099880_1576905 Arabidopsis thaliana phosphoprotein phosphatase
           (At4g26720) mRNA, complete cds.>gb:BT000338_1634616
           Arabidopsis thaliana phosphoprotein phosphatase
           (At4g26720) mRNA, complete cds.
          Length = 159

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 32/80 (40%), Positives = 45/80 (56%)
 Frame = -2

Query: 903 SDPTENDSVEGLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQL 724
           SDP   D V+G   + RG G + FG   VT F   N +  I RAH+ VM+G++     Q+
Sbjct: 49  SDP--EDIVDGWGLSPRGAGFL-FGGSVVTSFNHSNNIDYIARAHQLVMEGYKWMFDSQI 105

Query: 723 ITLFSATNYCGTANNAGAIL 664
           +T++SA NYC    N  +IL
Sbjct: 106 VTVWSAPNYCYRCGNVASIL 125



>gb:AY087612_1572642 Arabidopsis thaliana clone 37057 mRNA, complete
           sequence.
          Length = 298

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 31/72 (43%), Positives = 40/72 (55%)
 Frame = -2

Query: 873 GLRPNARGPGLVTFGPDRVTDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYC 694
           G+ P   G    TFG D    F   N L+LI RAH+ VMDGF    + +++T+FSA NYC
Sbjct: 199 GISPRGAG---YTFGQDISEQFNHTNNLKLIARAHQLVMDGFNWAHEQKVVTIFSAPNYC 255

Query: 693 GTANNAGAILVV 658
               N  +IL V
Sbjct: 256 YRCGNMASILEV 267



>gb:ATPPHOS6_1553879 A.thaliana mRNA encoding protein phosphatase 1A
           (partial).
          Length = 68

 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 25/45 (55%), Positives = 34/45 (75%)
 Frame = -2

Query: 792 LQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVV 658
           + L+ RAH+ V DG+E FA  QL+T+FSA NYCG  +NAGA++ V
Sbjct: 3   MDLVCRAHQVVEDGYEFFADRQLVTMFSAPNYCGEFDNAGAMMSV 47


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 896,399,349
Number of Sequences: 1806583
Number of extensions: 17790541
Number of successful extensions: 34466
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 33420
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34352
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 62990696208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)