BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3392
         (1660 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:OSJN00253_1697436 Oryza sativa genomic DNA, chromosome 4, BAC...    90   2e-16   
gb:AP003875_1834671 Oryza sativa (japonica cultivar-group) genom...    89   3e-16   
gb:OSJN00209_1696738 Oryza sativa genomic DNA, chromosome 4, BAC...    85   5e-15   
gb:OSJN00255_1697496 Oryza sativa genomic DNA, chromosome 4, BAC...    74   7e-12   
gb:AB030709_1518534 Triticum aestivum gene for AHM2, partial cds.      73   2e-11   
gb:OSJN00167_1696066 Oryza sativa genomic DNA, chromosome 4, BAC...    71   6e-11   
gb:OSJN00120_1695232 Oryza sativa genomic DNA, chromosome 4, BAC...    68   5e-10   
gb:OSJN00120_1695238 Oryza sativa genomic DNA, chromosome 4, BAC...    68   6e-10   
gb:AB025603_1516244 Arabidopsis thaliana genomic DNA, chromosome...    65   3e-09   
gb:AY136403_1581904 Arabidopsis thaliana unknown protein (At5g52...    65   4e-09   
gb:AY863050_1630984 Zea mays methyl-binding domain protein MBD11...    64   1e-08   
gb:AY086606_1571653 Arabidopsis thaliana clone 261609 mRNA, comp...    51   8e-05   
pir|T45595|T45595 hypothetical protein F12A12.100 - Arabidopsis ...    51   8e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AB025604_1516253 Arabidopsis thaliana genomic DNA, chromosome...    48   5e-04   
gb:AY888006_2547649 Gallus gallus methyl-CpG-binding domain prot...    45   0.003   
gb:AF072245_2053358 Mus musculus testis specific methyl-CpG bind...    45   0.003   
gb:AF072243_2053356 Mus musculus methyl-CpG binding protein MBD2...    45   0.003   
gb:AB015475_1512570 Arabidopsis thaliana genomic DNA, chromosome...    45   0.004   
gb:AB084168_2463710 Xenopus laevis mRNA for methyl-CpG binding p...    44   0.010   
gb:HSMETHYL2_2018714 Homo sapiens methyl-CpG binding protein 2 (...    44   0.010   
gb:AF072242_1880853 Homo sapiens methyl-CpG binding protein MBD2...    44   0.010   
gb:AY238336_2521387 Danio rerio methyl-CpG binding protein 2 (mb...    43   0.017   
gb:HSMECP2X_2018698 H.sapiens mRNA for methyl-CpG-binding protei...    42   0.038   
gb:HSMECP2_2018697 H.sapiens MeCP-2 gene.                              42   0.038   
gb:HSM806231_2018245 Homo sapiens mRNA; cDNA DKFZp686A24160 (fro...    42   0.038   
gb:AY541280_1956333 Homo sapiens methyl CpG binding protein 2 is...    42   0.038   
sp|P51608|MEC2_HUMAN|MEC2_HUMAN Methyl-CpG-binding protein 2 (MeCP-2 protei...    42   0.038   Homo sapiens [man]
gb:AF051768_2470747 Xenopus laevis methyl-CpG-binding protein 2 ...    42   0.049   
gb:AB061672_2462906 Xenopus laevis mRNA for methyl-CpG binding p...    42   0.049   
gb:AF295597_1895484 Macaca fascicularis methyl-CpG-binding prote...    42   0.049   
sp|Q00566|MEC2_RAT|MEC2_RAT Methyl-CpG-binding protein 2 (MeCP-2 protein)...    42   0.049   Rattus norvegicus [brown rat]
gb:BC071531_2556267 Danio rerio methyl-CpG binding domain protei...    41   0.064   
gb:AY398379_2531909 Danio rerio clone RK121A1A12 methyl-CpG bind...    41   0.064   
gb:AX886192_1481645 Sequence 2055 from Patent EP1033401.               41   0.064   
sp|Q9Z2D6|MEC2_MOUSE|MEC2_MOUSE Methyl-CpG-binding protein 2 (MeCP-2 protei...    40   0.11    Mus musculus [mouse]
gb:AF170346_2478291 Xenopus laevis methyl-CpG binding protein MB...    40   0.14    
gb:HSRNACPGB_2020035 H.sapiens mRNA for methyl CpG binding prote...    40   0.14    
pir|S57963|S57963 methyl CpG binding protein 2 - human (fragment)      40   0.14    Homo sapiens [man]
gb:AF072248_2053359 Mus musculus methyl-CpG binding domain-conta...    40   0.19    
gb:AF072246_1880854 Homo sapiens testis specific methyl-CpG bind...    40   0.19    
gb:AC005943_1875060 Homo sapiens chromosome 19, cosmid R30538, c...    40   0.19    
gb:AY050816_1562320 Arabidopsis thaliana unknown protein (At1g63...    40   0.19    
gb:AY238339_1312188 Branchiostoma floridae methyl-CpG binding pr...    40   0.19    
gb:BC066079_2105708 Mus musculus RIKEN cDNA 6330407J23 gene, mRN...    38   0.71    
gb:HSJ403A15_2016113 Human DNA sequence from clone RP3-403A15 on...    38   0.71    
gb:AK018139_1159459 Mus musculus adult male medulla oblongata cD...    38   0.71    
gb:BC024812_2094733 Mus musculus methyl-CpG binding domain prote...    37   0.93    
gb:AF072249_2053360 Mus musculus methyl-CpG binding protein MBD4...    37   0.93    
gb:GGARBP_2572927 Gallus gallus mRNA for attachment region bindi...    37   1.2     
gb:AY298900_2525767 Danio rerio methyl-cytosine binding protein ...    37   1.2     
gb:AP005907_1859888 Oryza sativa (japonica cultivar-group) genom...    37   1.2     
gb:NCB9G16_1690435 Neurospora crassa DNA linkage group II BAC cl...    37   1.2     
gb:CP000019_870174 Haemophilus somnus 129PT plasmid pHS129, comp...    37   1.6     
gb:BC043835_2548291 Xenopus laevis methyl-CpG binding domain pro...    36   2.1     
gb:BA000026_693508 Mycoplasma penetrans HF-2 DNA, complete genome.     36   2.7     
sp|Q09685|YA12_SCHPO|YA12_SCHPO Hypothetical protein C13C5.02 in chromosome...    36   2.7     Schizosaccharomyces pombe
gb:AY080662_1568394 Arabidopsis thaliana unknown protein (At1g22...    35   4.6     
gb:AE014297_1139181 Drosophila melanogaster chromosome 3R, compl...    35   4.6     
gb:AE014297_1139180 Drosophila melanogaster chromosome 3R, compl...    35   4.6     
pir|A86356|A86356 hypothetical protein [imported] - Arabidopsis ...    35   4.6     Arabidopsis thaliana [mouse-ear cress]
gb:BC074695_2558189 Xenopus tropicalis methyl-CpG binding domain...    35   6.0     
pir|T04274|T04274 hypothetical protein F20B18.300 - Arabidopsis ...    35   6.0     Arabidopsis thaliana [mouse-ear cress]
gb:BC080900_2561815 Xenopus tropicalis MBD1 protein, mRNA (cDNA ...    34   7.9     
gb:AF412121_2492683 Gallus gallus late domain-interacting protei...    34   7.9     
gb:BC082281_2108348 Mus musculus neural precursor cell expressed...    34   7.9     
gb:BC039746_2098420 Mus musculus neural precursor cell expressed...    34   7.9     
gb:AK122283_2068948 Mus musculus mRNA for mKIAA0439 protein.           34   7.9     
gb:AF277232_2061265 Mus musculus ubiquitin-protein ligase Nedd4-...    34   7.9     
gb:BC065234_1986769 Homo sapiens KIAA0423, mRNA (cDNA clone IMAG...    34   7.9     
gb:AB007883_1864009 Homo sapiens KIAA0423 mRNA, partial cds.           34   7.9     
gb:CR382133_1666276 Debaryomyces hansenii chromosome A of strain...    34   7.9     
gb:CR749557_1181127 Homo sapiens mRNA; cDNA DKFZp686D12126 (from...    34   7.9     
gb:AK042621_1166353 Mus musculus 7 days neonate cerebellum cDNA,...    34   7.9     
pir|T00057|T00057 hypothetical protein KIAA0423 - human (fragment)     34   7.9     Homo sapiens [man]


>gb:OSJN00253_1697436 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0072D08, complete sequence.
          Length = 505

 Score = 89.7 bits (221), Expect = 2e-16
 Identities = 56/171 (32%), Positives = 77/171 (45%), Gaps = 1/171 (0%)
 Frame = +3

Query: 411 WLPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIXXXXX 587
           WLP GW +E+  R+ G      YK Y+  P+G +F SK  V  + N    S   +     
Sbjct: 105 WLPDGWAIEV--RAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDV----- 157

Query: 588 XXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWV 767
                                        K + D  +   +   +A  + + DGLP GWV
Sbjct: 158 -----------------------------KGLCDTSSEDNI---LAMVEFNPDGLPEGWV 185

Query: 768 KELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK 920
           KE+  R C  GIRKDPYY DPVS + FR+ + V+ YLETG I K    P++
Sbjct: 186 KEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIPRR 236



 Score = 84.3 bits (207), Expect = 7e-15
 Identities = 65/233 (27%), Positives = 101/233 (43%), Gaps = 29/233 (12%)
 Frame = +3

Query: 645  ENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYI 824
            E +    +  +SV  N+  +    A   +++  D LP GW+ E+R   C        YY 
Sbjct: 6    EAEEMKKQGEESVEANEAEEKDKDAEVLEELP-DWLPDGWIMEVR---CGDNGNIYRYYT 61

Query: 825  DPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIE-----EVSPNEKSV 989
             PVSGY F +K + + YL +   ++ +      D++    +H  +      EV    K +
Sbjct: 62   SPVSGYTFSTKMETLHYLFSEMDERVLESQACADDNELHRMHTWLPDGWAIEVRAGGKKM 121

Query: 990  ED----------NSQISKRRKSVVDKRPAKIV--------------SPVAVQNGSESELP 1097
            E             +   +   ++     KI               + +A+   +   LP
Sbjct: 122  EKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCDVKGLCDTSSEDNILAMVEFNPDGLP 181

Query: 1098 AGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP 1256
             GW+KE   R+   GIRKDPYYTDPVS +VFR+ K    Y+ETG I+K A  P
Sbjct: 182  EGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLKSVINYLETGQITKHAYIP 234



 Score = 68.6 bits (166), Expect = 4e-10
 Identities = 59/193 (30%), Positives = 77/193 (39%), Gaps = 24/193 (12%)
 Frame = +3

Query: 1092 LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETG------DISKCAMK 1253
            LP GWI E +    G+  R   YYT PVSGY F +K +   Y+ +       +   CA  
Sbjct: 40   LPDGWIMEVRCGDNGNIYR---YYTSPVSGYTFSTKMETLHYLFSEMDERVLESQACADD 96

Query: 1254 PTLREPG---PTSTDLSYDTGXXXXXXXXXXXXXXXXXXRHVAKKQK---SGSGK-RPAK 1412
              L       P    +    G                  R ++K+     S  GK     
Sbjct: 97   NELHRMHTWLPDGWAIEVRAGGKKMEKMYKFYVHLPTGMRFLSKENVLLYSNEGKISRCD 156

Query: 1413 VVSNAEGQTE---------SVDGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSKK 1559
            V    +  +E         + DGLP GW +E   RKC  G + DP+Y DPVS   FR+ K
Sbjct: 157  VKGLCDTSSEDNILAMVEFNPDGLPEGWVKEIIFRKCNDGIRKDPYYTDPVSRHVFRTLK 216

Query: 1560 DAQRYLETGDIAK 1598
                YLETG I K
Sbjct: 217  SVINYLETGQITK 229



>gb:AP003875_1834671 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1119_C05.>gb:AP003919_1835227 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1734_E04.
          Length = 422

 Score = 89.0 bits (219), Expect = 3e-16
 Identities = 39/64 (60%), Positives = 50/64 (78%)
 Frame = +3

Query: 732 DISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIK 911
           D+  DGLP GW KE R R   S ++ DPYYIDPVSGYEFRS +DV R+L++GDI KC+++
Sbjct: 337 DLIVDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVR 396

Query: 912 PKKR 923
           P+KR
Sbjct: 397 PRKR 400



 Score = 81.3 bits (199), Expect = 6e-14
 Identities = 37/61 (60%), Positives = 48/61 (78%), Gaps = 2/61 (3%)
 Frame = +3

Query: 1446 VDGLPPGWTREFRARKCGT--KSDPFYVDPVSGFGFRSKKDAQRYLETGDIAKCIMKPTK 1619
            VDGLP GW +E R RK G+  K+DP+Y+DPVSG+ FRS KD  R+L++GDI KCI++P K
Sbjct: 340  VDGLPDGWWKEDRPRKNGSNLKTDPYYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVRPRK 399

Query: 1620 R 1622
            R
Sbjct: 400  R 400



 Score = 73.9 bits (180), Expect = 9e-12
 Identities = 40/101 (39%), Positives = 58/101 (57%), Gaps = 3/101 (2%)
 Frame = +3

Query: 978  EKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP 1157
            E S E N  +S  +  +V ++   IV            LP GW KE + R+ G  ++ DP
Sbjct: 317  ENSAEKN--VSNHKNELVQRKDDLIVDG----------LPDGWWKEDRPRKNGSNLKTDP 364

Query: 1158 YYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP---TLREP 1271
            YY DPVSGY FRS KD  R++++GDI KC ++P   T+++P
Sbjct: 365  YYIDPVSGYEFRSLKDVHRFLKSGDIYKCIVRPRKRTIQDP 405



>gb:OSJN00209_1696738 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0058J09, complete sequence.
          Length = 385

 Score = 84.7 bits (208), Expect = 5e-15
 Identities = 73/284 (25%), Positives = 110/284 (38%), Gaps = 5/284 (1%)
 Frame = +3

Query: 411  WLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIXXXXX 587
            WLP GW +E+        +G+ Y+ Y SP SG  F  K++V Q+L S  +          
Sbjct: 44   WLPDGWIMEVYQ----GDDGTIYRYYTSPISGLTFTMKSEVLQYLFSGMDE--------- 90

Query: 588  XXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKT---VSPAVAAQDISADGLPA 758
                                   R    +    DNQ       VSP +    ++ + LP 
Sbjct: 91   -----------------------RFLESKNCAADNQLINNSVYVSPTMTYMQMTHEWLPK 127

Query: 759  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS 938
            GW+ E+R        +   +Y+ P +G    SK DV+ Y+   +I               
Sbjct: 128  GWIIEVRAGGKNMN-KMYKFYVYPPAGVRLFSKEDVLLYINKSEIT-------------- 172

Query: 939  KDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEY 1118
                             + N +   R K  +          +A    +   LP GW+KE 
Sbjct: 173  ---------------GFDTNGECDTRTKDNI----------LANVEFNPHSLPEGWVKEV 207

Query: 1119 KTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCA 1247
              R+   G IRKDPY+TDPV+ Y FR++K A  Y++TG + K A
Sbjct: 208  VFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRA 251



 Score = 74.3 bits (181), Expect = 7e-12
 Identities = 62/240 (25%), Positives = 105/240 (43%), Gaps = 12/240 (5%)
 Frame = +3

Query: 408  DWLPPGWTVELKTRSTGSHNGSTYKCYI-SPSGRKFYSKAQVSQFLNSAANSNTPIXXXX 584
            +WLP GW +E+  R+ G +    YK Y+  P+G + +SK  V  ++N +           
Sbjct: 123  EWLPKGWIIEV--RAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKSE---------- 170

Query: 585  XXXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGW 764
                        +    T  E  +RT        DN         +A  + +   LP GW
Sbjct: 171  ------------ITGFDTNGECDTRTK-------DN--------ILANVEFNPHSLPEGW 203

Query: 765  VKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI-KKCVIKPKKRDE--- 929
            VKE+  R   +G IRKDPY+ DPV+ Y FR+++  M Y++TG + K+  I+     +   
Sbjct: 204  VKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPKRAFIQRTSVHDLYS 263

Query: 930  -SASKDIHHNIEE-----VSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESE 1091
               S D+H ++++        N KS      +  +  S+ +K  +   S    ++G  S+
Sbjct: 264  FEKSADLHESLKKRLDFAARTNRKS---RRSLKSKNSSLTEKSLSDEESSYKSEDGDSSD 320



 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 67/287 (23%), Positives = 108/287 (37%), Gaps = 4/287 (1%)
 Frame = +3

Query: 750  LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDE 929
            LP GW+ E+      +  R   YY  P+SG  F  K +V++YL +G  ++ +   + ++ 
Sbjct: 45   LPDGWIMEVYQGDDGTIYR---YYTSPISGLTFTMKSEVLQYLFSGMDERFL---ESKNC 98

Query: 930  SASKDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWI 1109
            +A   + +N   VSP                             +     +   LP GWI
Sbjct: 99   AADNQLINNSVYVSPT----------------------------MTYMQMTHEWLPKGWI 130

Query: 1110 KEYKTRRLGHGIRKD-PYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTST 1286
             E   R  G  + K   +Y  P +G    SK+D   YI   +I+                
Sbjct: 131  IE--VRAGGKNMNKMYKFYVYPPAGVRLFSKEDVLLYINKSEIT---------------- 172

Query: 1287 DLSYDTGXXXXXXXXXXXXXXXXXXRHVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPG 1466
               +DT                               +    +++N E    S   LP G
Sbjct: 173  --GFDTNGECDT-------------------------RTKDNILANVEFNPHS---LPEG 202

Query: 1467 WTRE--FRARKCGT-KSDPFYVDPVSGFGFRSKKDAQRYLETGDIAK 1598
            W +E  FR  K G  + DP++ DPV+ + FR++K A  Y++TG + K
Sbjct: 203  WVKEVVFRKTKTGVIRKDPYFTDPVNNYSFRTRKSAMLYVQTGKVPK 249



>gb:OSJN00255_1697496 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0070C17, complete sequence.
          Length = 438

 Score = 74.3 bits (181), Expect = 7e-12
 Identities = 40/89 (44%), Positives = 54/89 (60%), Gaps = 9/89 (10%)
 Frame = +3

Query: 714 PAVAAQ---DISADGLPAGWVKELRTRTCPSG--IRKDPYYIDPVSGYEFRSKRDVMRYL 878
           PAV A    + + +GLP GW+KE R R   SG  ++ D +YIDP + YEFRS++DV RYL
Sbjct: 20  PAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQKDVQRYL 79

Query: 879 ETGDIKKCVIKPKKRD----ESASKDIHH 953
           E+GD+  CV+   KR      +A    HH
Sbjct: 80  ESGDVTNCVMIQNKRKMEDLHTARNQSHH 108



 Score = 74.3 bits (181), Expect = 7e-12
 Identities = 38/83 (45%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = +3

Query: 1392 SGKRPAKVVSNAEGQTESV-DGLPPGWTREFRARK----CGTKSDPFYVDPVSGFGFRSK 1556
            SG   AK    A+G+ E   +GLP GW +E+R RK       K D FY+DP + + FRS+
Sbjct: 13   SGIVRAKPAVTADGKIEPAGEGLPHGWLKEYRPRKNQSGSRVKGDTFYIDPTNMYEFRSQ 72

Query: 1557 KDAQRYLETGDIAKCIMKPTKRE 1625
            KD QRYLE+GD+  C+M   KR+
Sbjct: 73   KDVQRYLESGDVTNCVMIQNKRK 95



 Score = 63.9 bits (154), Expect = 9e-09
 Identities = 34/90 (37%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = +3

Query: 993  DNSQISKR--RKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRR--LGHGIRKDPY 1160
            D+++ S R  R  +V  +PA + +   ++   E  LP GW+KEY+ R+   G  ++ D +
Sbjct: 2    DSNEGSHRITRSGIVRAKPA-VTADGKIEPAGEG-LPHGWLKEYRPRKNQSGSRVKGDTF 59

Query: 1161 YTDPVSGYVFRSKKDAFRYIETGDISKCAM 1250
            Y DP + Y FRS+KD  RY+E+GD++ C M
Sbjct: 60   YIDPTNMYEFRSQKDVQRYLESGDVTNCVM 89



>gb:AB030709_1518534 Triticum aestivum gene for AHM2, partial cds.
          Length = 353

 Score = 72.8 bits (177), Expect = 2e-11
 Identities = 33/59 (55%), Positives = 41/59 (69%)
 Frame = +3

Query: 744 DGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK 920
           DGLP GWVKEL  R C  GIRKDPYY DPVS   FR+ + V+ YL+TG+I +    P++
Sbjct: 3   DGLPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLPRR 61



 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 30/55 (54%), Positives = 38/55 (69%)
 Frame = +3

Query: 1092 LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP 1256
            LP GW+KE   R+   GIRKDPYYTDPVS  +FR+ K    Y++TG+IS+ A  P
Sbjct: 5    LPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLP 59



 Score = 57.4 bits (137), Expect = 9e-07
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 2/59 (3%)
 Frame = +3

Query: 1449 DGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSKKDAQRYLETGDIAKCIMKPTK 1619
            DGLP GW +E   RKC  G + DP+Y DPVS   FR+ K    YL+TG+I++    P +
Sbjct: 3    DGLPKGWVKELVFRKCNDGIRKDPYYTDPVSHLLFRTLKSVISYLQTGEISRHAYLPRR 61



>gb:OSJN00167_1696066 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0040D17, complete sequence.
          Length = 377

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 50/173 (28%), Positives = 75/173 (43%), Gaps = 2/173 (1%)
 Frame = +3

Query: 381 LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN 557
           + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct: 63  VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLLYIKEMKI 120

Query: 558 SNTPIXXXXXXXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI 737
           S                            + Q  TS             T    +A  + 
Sbjct: 121 SG------------------------FDTDGQCNTS-------------TQENILAILEF 143

Query: 738 SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI 893
           + +GLP GWVKE+  R   +G IR+D +Y DP+  Y FR+KR    Y+ETG +
Sbjct: 144 NPEGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV 196



 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 71/280 (25%), Positives = 106/280 (37%), Gaps = 5/280 (1%)
 Frame = +3

Query: 414  LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAANSNTPIXXXXXX 590
            LP GW +E+        +G+ Y+ YI P SGR F  K++V  +L S              
Sbjct: 8    LPDGWIMEVYL----GDDGTIYRYYICPVSGRTFTMKSEVLHYLFS-------------- 49

Query: 591  XXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK 770
                             + +Q  T  K ++V  N T             + + LP GW+ 
Sbjct: 50   -----------------EMDQCFTESKNRAVGSNLTR------------THEWLPKGWLV 80

Query: 771  ELRTRTCPSGIRKDP---YYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASK 941
            E+R      G   D    +Y+ P +     SK DV+ Y     IK+  I     D   + 
Sbjct: 81   EIRA----GGDNMDKMYKFYVYPPNRVRLFSKDDVLLY-----IKEMKISGFDTDGQCNT 131

Query: 942  DIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYK 1121
                NI                                  +A+   +   LP GW+KE  
Sbjct: 132  STQENI----------------------------------LAILEFNPEGLPQGWVKEVV 157

Query: 1122 TRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS 1238
             R+   G IR+D +YTDP+  YVFR+K+ A  Y+ETG ++
Sbjct: 158  FRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKVT 197



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 3/51 (5%)
 Frame = +3

Query: 1449 DGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYLETGDI 1592
            +GLP GW +E   RK  T   + D  Y DP+  + FR+K+ A  Y+ETG +
Sbjct: 146  EGLPQGWVKEVVFRKTHTGRIRRDRHYTDPIKSYVFRTKRSAAFYVETGKV 196



>gb:OSJN00120_1695232 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0033G08, complete sequence.
          Length = 418

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 48/173 (27%), Positives = 74/173 (42%), Gaps = 2/173 (1%)
 Frame = +3

Query: 381 LASNTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAAN 557
           + SN  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + +SK  V  ++     
Sbjct: 86  VGSNLTRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPNRVRLFSKDDVLIYIKEMKI 143

Query: 558 SNTPIXXXXXXXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDI 737
           S                            + Q  T+             T    +A  + 
Sbjct: 144 SGFDT------------------------DGQCNTN-------------TQENILAILEF 166

Query: 738 SADGLPAGWVKELRTRTCPSG-IRKDPYYIDPVSGYEFRSKRDVMRYLETGDI 893
           + +GLP GWVKE+  R   +G IR+D +Y DP+  Y F +KR    Y+ETG +
Sbjct: 167 NPEGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV 219



 Score = 60.5 bits (145), Expect = 1e-07
 Identities = 50/206 (24%), Positives = 90/206 (43%), Gaps = 35/206 (16%)
 Frame = +3

Query: 726  AQDISADG----LPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI 893
            + D   DG    LP GW+ E              YYI P+SG  F +K +V+ YL + ++
Sbjct: 30   SDDDDVDGRPGWLPDGWIME--------------YYICPLSGTTFTTKSEVLDYLFS-EM 74

Query: 894  KKCVIKPKKRDESASKDIHHN------IEEVSPNEKSVE----------DNSQISKRRKS 1025
             +C ++ K     ++    H       + E+     +++          +  ++  +   
Sbjct: 75   DQCFLESKNHAVGSNLTRTHEWLPKGWLVEIRAGGDNMDKMYKFYVYPPNRVRLFSKDDV 134

Query: 1026 VVDKRPAKIV--------------SPVAVQNGSESELPAGWIKEYKTRRLGHG-IRKDPY 1160
            ++  +  KI               + +A+   +   LP GW+KE   R+   G IR+D +
Sbjct: 135  LIYIKEMKISGFDTDGQCNTNTQENILAILEFNPEGLPQGWVKEVVFRKTNTGKIRRDRH 194

Query: 1161 YTDPVSGYVFRSKKDAFRYIETGDIS 1238
            YTDP+  YVF +K+ A  Y+ETG ++
Sbjct: 195  YTDPIKNYVFHTKRSAALYVETGKVT 220



 Score = 44.7 bits (104), Expect = 0.006
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 3/51 (5%)
 Frame = +3

Query: 1449 DGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYLETGDI 1592
            +GLP GW +E   RK  T   + D  Y DP+  + F +K+ A  Y+ETG +
Sbjct: 169  EGLPQGWVKEVVFRKTNTGKIRRDRHYTDPIKNYVFHTKRSAALYVETGKV 219



>gb:OSJN00120_1695238 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0033G08, complete
           sequence.>gb:OSJN00167_1696059 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0040D17, complete
           sequence.
          Length = 336

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 50/170 (29%), Positives = 71/170 (41%), Gaps = 2/170 (1%)
 Frame = +3

Query: 390 NTNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISPSGR-KFYSKAQVSQFLNSAANSNT 566
           N  ++ +WLP GW VE+  R+ G +    YK Y+ P  R + YSK  V  ++     S  
Sbjct: 89  NLMRTHEWLPKGWLVEI--RAGGDNMDKMYKFYVYPPHRVRLYSKDDVLLYIKEMKISG- 145

Query: 567 PIXXXXXXXXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISAD 746
                                     + Q  TS             T    +A  + +  
Sbjct: 146 -----------------------FDTDGQCNTS-------------TQENILAILEFNPK 169

Query: 747 GLPAGWVKELRTR-TCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI 893
           GLP GWVKE+  R T   GIR+D +Y DP+  Y FR+ R    Y+ETG +
Sbjct: 170 GLPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV 219



 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 58/223 (26%), Positives = 88/223 (39%), Gaps = 39/223 (17%)
 Frame = +3

Query: 687  DNQTPKTVSPAVAAQDISADG---------LPAGWVKELRTRTCPSGIRKDPYYIDPVSG 839
            DN   +  S   A +++ +D          LP GW+ E              YYI PVSG
Sbjct: 12   DNDCDEVESSEEATKNLQSDDDDVDDRPGWLPDGWIME--------------YYICPVSG 57

Query: 840  YEFRSKRDVMRYLETG------DIKKCVIK----------PKK-----RDESASKDIHHN 956
              F  K +V+ YL +       + K C +           PK      R    + D  + 
Sbjct: 58   STFTMKSEVLHYLFSEMDQRFMESKNCAVGCNLMRTHEWLPKGWLVEIRAGGDNMDKMYK 117

Query: 957  IEEVSPNEKSVEDNSQ----ISKRRKSVVDKRPAKIVSP----VAVQNGSESELPAGWIK 1112
                 P+   +         I + + S  D       S     +A+   +   LP GW+K
Sbjct: 118  FYVYPPHRVRLYSKDDVLLYIKEMKISGFDTDGQCNTSTQENILAILEFNPKGLPQGWVK 177

Query: 1113 EYKTRRLGHG-IRKDPYYTDPVSGYVFRSKKDAFRYIETGDIS 1238
            E   R+   G IR+D +YTDP+  YVFR+ + A  Y+ETG ++
Sbjct: 178  EVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKVT 220



 Score = 43.5 bits (101), Expect = 0.013
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +3

Query: 1452 GLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYLETGDI 1592
            GLP GW +E   RK  T   + D  Y DP+  + FR+ + A  Y+ETG +
Sbjct: 170  GLPQGWVKEVVFRKTNTGGIRRDRHYTDPIKNYVFRTMRSAALYVETGKV 219



>gb:AB025603_1516244 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F17P19.
          Length = 746

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +3

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYK-TRRLGHGIRK 1151
            N + + D   +S  RK  +  R       V V+  +   LP GWIK+ + T R G   R+
Sbjct: 2    NGEGISDG--LSAERKVEIRVRKNGRKDKVIVEKSAAQGLPEGWIKKLEITNRSGRKTRR 59

Query: 1152 DPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMK 1253
            DP++ DP S Y+F+S KDA RY+ETG+I   A K
Sbjct: 60   DPFFIDPKSEYIFQSFKDASRYVETGNIGHYARK 93



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 15/132 (11%)
 Frame = +3

Query: 720  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK 896
            V  +  +A GLP GW+K+L  T       R+DP++IDP S Y F+S +D  RY+ETG+I 
Sbjct: 29   VIVEKSAAQGLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNIG 88

Query: 897  KCVIKPKKR-----DESASKDI-------HHNIEEVSPNEKSVEDNSQISKRRKSVVDK- 1037
                K K+      D    K +         + ++V   EK+++D  +  +R  S  D+ 
Sbjct: 89   HYARKLKESDIEDDDSGNGKTVLRLEYVDKRSADDVLEKEKTIDDVRRSKRRNLSSSDEH 148

Query: 1038 -RPAKIVSPVAV 1070
             +  K+ S +++
Sbjct: 149  SKNCKMTSDLSI 160



 Score = 50.8 bits (120), Expect = 8e-05
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query: 1392 SGKRPAKVVSNAEGQTESVDGLPPGWTREFR-ARKCG--TKSDPFYVDPVSGFGFRSKKD 1562
            +G++   +V  +  Q     GLP GW ++     + G  T+ DPF++DP S + F+S KD
Sbjct: 23   NGRKDKVIVEKSAAQ-----GLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKD 77

Query: 1563 AQRYLETGDI 1592
            A RY+ETG+I
Sbjct: 78   ASRYVETGNI 87



>gb:AY136403_1581904 Arabidopsis thaliana unknown protein (At5g52230)
            mRNA, complete cds.>gb:BT000226_1634504 Arabidopsis
            thaliana unknown protein (At5g52230) mRNA, complete cds.
          Length = 746

 Score = 65.1 bits (157), Expect = 4e-09
 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = +3

Query: 1005 ISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYK-TRRLGHGIRKDPYYTDPVSG 1181
            +S  RK  +  R       V V+  +   LP GWIK+ + T R G   R+DP++ DP S 
Sbjct: 10   LSAERKVEIRVRKNGRKDKVIVEKSAAQGLPEGWIKKLEITNRSGRKTRRDPFFIDPKSE 69

Query: 1182 YVFRSKKDAFRYIETGDISKCAMK 1253
            Y+F+S KDA RY+ETG+I   A K
Sbjct: 70   YIFQSFKDASRYVETGNIGHYARK 93



 Score = 60.1 bits (144), Expect = 1e-07
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 15/132 (11%)
 Frame = +3

Query: 720  VAAQDISADGLPAGWVKELR-TRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIK 896
            V  +  +A GLP GW+K+L  T       R+DP++IDP S Y F+S +D  RY+ETG+I 
Sbjct: 29   VIVEKSAAQGLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKDASRYVETGNIG 88

Query: 897  KCVIKPKKR-----DESASKDI-------HHNIEEVSPNEKSVEDNSQISKRRKSVVDK- 1037
                K K+      D    K +         + ++V   EK+++D  +  +R  S  D+ 
Sbjct: 89   HYARKLKESDIEDDDSGNGKTVLRLEYVDKRSADDVLEKEKTIDDVRRSKRRNLSSSDEH 148

Query: 1038 -RPAKIVSPVAV 1070
             +  K+ S +++
Sbjct: 149  SKNCKMTSDLSI 160



 Score = 50.8 bits (120), Expect = 8e-05
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query: 1392 SGKRPAKVVSNAEGQTESVDGLPPGWTREFR-ARKCG--TKSDPFYVDPVSGFGFRSKKD 1562
            +G++   +V  +  Q     GLP GW ++     + G  T+ DPF++DP S + F+S KD
Sbjct: 23   NGRKDKVIVEKSAAQ-----GLPEGWIKKLEITNRSGRKTRRDPFFIDPKSEYIFQSFKD 77

Query: 1563 AQRYLETGDI 1592
            A RY+ETG+I
Sbjct: 78   ASRYVETGNI 87



>gb:AY863050_1630984 Zea mays methyl-binding domain protein MBD113
           mRNA, complete cds.
          Length = 292

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 31/67 (46%), Positives = 42/67 (62%)
 Frame = +3

Query: 720 VAAQDISADGLPAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKK 899
           +A  + + DGLP GWVKE  +R    GIRKD YY DPVS   FR+ + V+ YL TG+I +
Sbjct: 20  LAHVEFNPDGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR 79

Query: 900 CVIKPKK 920
               P++
Sbjct: 80  HSYLPRR 86



 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 29/55 (52%), Positives = 37/55 (67%)
 Frame = +3

Query: 1092 LPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKP 1256
            LP GW+KE  +R+   GIRKD YYTDPVS  VFR+ K    Y+ TG+IS+ +  P
Sbjct: 30   LPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISRHSYLP 84



 Score = 48.1 bits (113), Expect = 5e-04
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +3

Query: 1449 DGLPPGWTREFRARKC--GTKSDPFYVDPVSGFGFRSKKDAQRYLETGDIAK 1598
            DGLP GW +E  +RK   G + D +Y DPVS   FR+ K    YL TG+I++
Sbjct: 28   DGLPDGWVKETISRKFNDGIRKDQYYTDPVSHRVFRTLKSVLSYLGTGEISR 79



>gb:AY086606_1571653 Arabidopsis thaliana clone 261609 mRNA,
           complete sequence.
          Length = 182

 Score = 50.8 bits (120), Expect = 8e-05
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
 Frame = +3

Query: 627 QNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIR 806
           Q Q P EN +       + +D+++ K  +P         + LP  W  E+R RT  SG +
Sbjct: 7   QAQPPPENPA-------TPVDSKSRKRATPG------DDNWLPPDWRTEIRVRT--SGTK 51

Query: 807 K---DPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASK 941
               D +Y +P++G +FRSK +V+ YLE G  KK  +K  +  +S S+
Sbjct: 52  AGTVDKFYYEPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHSE 99



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGTKS---DPFYVDPVSGFGFRSKKDAQRYLETGDIAKCIMKPTKRE 1625
            LPP W  E R R  GTK+   D FY +P++G  FRSK +   YLE G        P K+ 
Sbjct: 35   LPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHG-------TPKKKS 87

Query: 1626 PGSAFNDKPHN 1658
              +A N   H+
Sbjct: 88   VKTAENGDSHS 98



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 393 TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL 542
           T    +WLPP W  E++ R++G+  G+  K Y  P +GRKF SK +V  +L
Sbjct: 28  TPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYL 78



 Score = 39.7 bits (91), Expect = 0.19
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +3

Query: 1029 VDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKD 1205
            VD +  K  +P     G ++ LP  W  E + R  G      D +Y +P++G  FRSK +
Sbjct: 19   VDSKSRKRATP-----GDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNE 73

Query: 1206 AFRYIETGDISKCAMK 1253
               Y+E G   K ++K
Sbjct: 74   VLYYLEHGTPKKKSVK 89



>pir|T45595|T45595 hypothetical protein F12A12.100 - Arabidopsis
           thaliana>gb:ATF12A12_1548299 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F12A12.>gb:AY063849_1565797
           Arabidopsis thaliana unknown protein (At3g46580) mRNA,
           complete cds.>gb:AY142653_1583069 Arabidopsis thaliana
           unknown protein (At3g46580) mRNA, complete cds.
          Length = 182

 Score = 50.8 bits (120), Expect = 8e-05
 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 3/108 (2%)
 Frame = +3

Query: 627 QNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIR 806
           Q Q P EN +       + +D+++ K  +P         + LP  W  E+R RT  SG +
Sbjct: 7   QAQPPPENPA-------TPVDSKSRKRATPG------DDNWLPPDWRTEIRVRT--SGTK 51

Query: 807 K---DPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASK 941
               D +Y +P++G +FRSK +V+ YLE G  KK  +K  +  +S S+
Sbjct: 52  AGTVDKFYYEPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHSE 99



 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 3/71 (4%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGTKS---DPFYVDPVSGFGFRSKKDAQRYLETGDIAKCIMKPTKRE 1625
            LPP W  E R R  GTK+   D FY +P++G  FRSK +   YLE G        P K+ 
Sbjct: 35   LPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHG-------TPKKKS 87

Query: 1626 PGSAFNDKPHN 1658
              +A N   H+
Sbjct: 88   VKTAENGDSHS 98



 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +3

Query: 393 TNQSSDWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL 542
           T    +WLPP W  E++ R++G+  G+  K Y  P +GRKF SK +V  +L
Sbjct: 28  TPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYL 78



 Score = 39.7 bits (91), Expect = 0.19
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 1/76 (1%)
 Frame = +3

Query: 1029 VDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKD 1205
            VD +  K  +P     G ++ LP  W  E + R  G      D +Y +P++G  FRSK +
Sbjct: 19   VDSKSRKRATP-----GDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNE 73

Query: 1206 AFRYIETGDISKCAMK 1253
               Y+E G   K ++K
Sbjct: 74   VLYYLEHGTPKKKSVK 89



>gb:AB025604_1516253 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F2O15.>gb:BT004606_1637640 Arabidopsis
           thaliana At5g59380 gene, complete cds.
          Length = 225

 Score = 48.1 bits (113), Expect = 5e-04
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query: 408 DWLPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFL 542
           +WLPPGW VE K R++G+  GS  K Y  P +GRKF S+ +V  +L
Sbjct: 79  NWLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYL 124



 Score = 39.7 bits (91), Expect = 0.19
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +3

Query: 750 LPAGWVKELRTRTCPSGIRK-DPYYIDPVSGYEFRSKRDVMRYLETGDIKK 899
           LP GW  E + RT  +     D YY +P +G +FRS+ +V+ YLE G  K+
Sbjct: 81  LPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYLEHGTSKR 131



 Score = 38.1 bits (87), Expect = 0.54
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 3/66 (4%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGTKS---DPFYVDPVSGFGFRSKKDAQRYLETGDIAKCIMKPTKRE 1625
            LPPGW  E + R  G  +   D +Y +P +G  FRS+ +   YLE G       + TK+ 
Sbjct: 81   LPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYLEHG----TSKRGTKKA 136

Query: 1626 PGSAFN 1643
              + FN
Sbjct: 137  ENTYFN 142



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +3

Query: 1092 LPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYIETG 1229
            LP GW  E K R  G      D YY +P +G  FRS+ +   Y+E G
Sbjct: 81   LPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYLEHG 127



>gb:AY888006_2547649 Gallus gallus methyl-CpG-binding domain protein
           2 (MBD2) mRNA, complete cds.
          Length = 257

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SPSG+KF SK Q++++L +A +
Sbjct: 12  LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVD 59



 Score = 39.7 bits (91), Expect = 0.19
 Identities = 25/53 (47%), Positives = 30/53 (56%), Gaps = 3/53 (5%)
 Frame = +3

Query: 1428 EGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYL 1577
            +G+T+    LPPGW +E   RK G    KSD +Y  P SG  FRSK    RYL
Sbjct: 4    QGRTDC-PALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQLARYL 54



 Score = 38.1 bits (87), Expect = 0.54
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 8/111 (7%)
 Frame = +3

Query: 750  LPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETG------DIKKCV 905
            LP GW KE  +R     +G + D YY  P SG +FRSK  + RYL         D +   
Sbjct: 12   LPPGWKKEEVIRKSGLSAG-KSDVYYFSP-SGKKFRSKPQLARYLGNAVDLSCFDFRTGK 69

Query: 906  IKPKKRDESASKDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVS 1058
            + P K  ++  +      E + PN+   + N+ +  R+ + + K+P   V+
Sbjct: 70   MMPSKLQKNKQR---LRNESLHPNKGKPDLNTALPIRQTASIFKQPVTKVT 117



>gb:AF072245_2053358 Mus musculus testis specific methyl-CpG binding
           protein MBD2 (Mbd2) mRNA, complete
           cds.>gb:MM2MBD1_2113737 Mus musculus methyl-CpG binding
           protein 2 (Mbd2) gene, exons 1 and 2; and alternatively
           spliced product, testis-specific methyl-CpG binding
           protein 2 (Mbd2) gene, complete cds.
          Length = 249

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SPSG+KF SK Q++++L +A +
Sbjct: 158 LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVD 205



 Score = 42.0 bits (97), Expect = 0.038
 Identities = 27/65 (41%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +3

Query: 1392 SGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKD 1562
            SG  P    +   G+      LPPGW +E   RK G    KSD +Y  P SG  FRSK  
Sbjct: 137  SGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQ 195

Query: 1563 AQRYL 1577
              RYL
Sbjct: 196  LARYL 200



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/58 (41%), Positives = 29/58 (50%), Gaps = 4/58 (6%)
 Frame = +3

Query: 1059 PVAVQNGSESELPA---GWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYI 1220
            P A ++G   + PA   GW KE   R+ G    K D YY  P SG  FRSK    RY+
Sbjct: 144  PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQLARYL 200



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 699 PKTVSPAVAAQDISADGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMR 872
           P+      + + +    LP GW KE  +R     +G + D YY  P SG +FRSK  + R
Sbjct: 141 PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAG-KSDVYYFSP-SGKKFRSKPQLAR 198

Query: 873 YL 878
           YL
Sbjct: 199 YL 200



>gb:AF072243_2053356 Mus musculus methyl-CpG binding protein MBD2
           (Mbd2) mRNA, complete cds.>gb:BC046607_2099310 Mus
           musculus methyl-CpG binding domain protein 2, mRNA (cDNA
           clone MGC:54585 IMAGE:6399206), complete
           cds.>gb:MM2MBD4_2113738 Mus musculus methyl-CpG binding
           protein 2 (Mbd2) gene, exon 6 and complete cds.
          Length = 414

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 21/48 (43%), Positives = 30/48 (62%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SPSG+KF SK Q++++L +A +
Sbjct: 158 LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNAVD 205



 Score = 42.0 bits (97), Expect = 0.038
 Identities = 27/65 (41%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +3

Query: 1392 SGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKD 1562
            SG  P    +   G+      LPPGW +E   RK G    KSD +Y  P SG  FRSK  
Sbjct: 137  SGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQ 195

Query: 1563 AQRYL 1577
              RYL
Sbjct: 196  LARYL 200



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/58 (41%), Positives = 29/58 (50%), Gaps = 4/58 (6%)
 Frame = +3

Query: 1059 PVAVQNGSESELPA---GWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYI 1220
            P A ++G   + PA   GW KE   R+ G    K D YY  P SG  FRSK    RY+
Sbjct: 144  PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQLARYL 200



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 699 PKTVSPAVAAQDISADGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMR 872
           P+      + + +    LP GW KE  +R     +G + D YY  P SG +FRSK  + R
Sbjct: 141 PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAG-KSDVYYFSP-SGKKFRSKPQLAR 198

Query: 873 YL 878
           YL
Sbjct: 199 YL 200



>gb:AB015475_1512570 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MMN10.>gb:BT014975_1641945 Arabidopsis thaliana
            At5g59800 gene, complete cds.>gb:BT015848_1642466
            Arabidopsis thaliana At5g59800 gene, complete cds.
          Length = 306

 Score = 45.1 bits (105), Expect = 0.004
 Identities = 56/273 (20%), Positives = 94/273 (34%)
 Frame = +3

Query: 759  GWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESAS 938
            GW    R R+  +G+  D Y+I+P +G +F S   + R+L  G++         R  + +
Sbjct: 34   GWTVVNRPRSSNNGV-VDTYFIEPGTGRQFSSLEAIHRHL-AGEVND-------RRLTRA 84

Query: 939  KDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEY 1118
                 +   V    ++ +D+  +    K                       LP GW  E 
Sbjct: 85   GSFFQDKTRVYEGSRTKQDHCGVEYASKGF--------------------RLPRGWSVEE 124

Query: 1119 KTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIETGDISKCAMKPTLREPGPTSTDLSY 1298
              R+  H I  D YY +  +G  FRS     RY+                          
Sbjct: 125  VPRKNSHYI--DKYYVERKTGKRFRSLVSVERYL-------------------------- 156

Query: 1299 DTGXXXXXXXXXXXXXXXXXXRHVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTRE 1478
                                      ++   S ++  +V+ N  G ++    LP GW  E
Sbjct: 157  --------------------------RESRNSIEQQLRVLQNRRGHSKDFR-LPDGWIVE 189

Query: 1479 FRARKCGTKSDPFYVDPVSGFGFRSKKDAQRYL 1577
             + R+  +  D  Y++P +G  FRS    +RYL
Sbjct: 190  EKPRRSSSHIDRSYIEPGTGNKFRSMAAVERYL 222



 Score = 37.4 bits (85), Expect = 0.93
 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 381 LASNTNQSSDW-LPPGWTVELKTRSTGSHNGSTYKCYISP-SGRKFYSKAQVSQFLNSAA 554
           L +    S D+ LP GW VE K R + SH     + YI P +G KF S A V ++L S  
Sbjct: 170 LQNRRGHSKDFRLPDGWIVEEKPRRSSSH---IDRSYIEPGTGNKFRSMAAVERYLISVG 226

Query: 555 N 557
           N
Sbjct: 227 N 227



 Score = 35.8 bits (81), Expect = 2.7
 Identities = 43/156 (27%), Positives = 60/156 (38%), Gaps = 1/156 (0%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYIS-PSGRKFYSKAQVSQFLNSAANSNTPIXXXXXX 590
           LP GW+VE   R   SH    Y  Y+   +G++F S   V ++L  + NS          
Sbjct: 116 LPRGWSVEEVPRKN-SHYIDKY--YVERKTGKRFRSLVSVERYLRESRNSI--------- 163

Query: 591 XXXXXXXXXXVPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVK 770
                             E Q R  + R+                ++D     LP GW+ 
Sbjct: 164 ------------------EQQLRVLQNRRG--------------HSKDFR---LPDGWIV 188

Query: 771 ELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYL 878
           E + R   S I  D  YI+P +G +FRS   V RYL
Sbjct: 189 EEKPRRSSSHI--DRSYIEPGTGNKFRSMAAVERYL 222



>gb:AB084168_2463710 Xenopus laevis mRNA for methyl-CpG binding
           protein MBD3, complete cds.
          Length = 283

 Score = 43.9 bits (102), Expect = 0.010
 Identities = 21/51 (41%), Positives = 32/51 (62%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           LP GW  E  TR +G   G +   Y SPSG+KF SK Q++++L ++ + +T
Sbjct: 11  LPQGWKKEEVTRRSGLSAGKSDVYYYSPSGKKFRSKPQLARYLGNSMDLST 61



 Score = 37.7 bits (86), Expect = 0.71
 Identities = 24/46 (52%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 1086 SELPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYI 1220
            S LP GW KE  TRR G    K D YY  P SG  FRSK    RY+
Sbjct: 9    SALPQGWKKEEVTRRSGLSAGKSDVYYYSP-SGKKFRSKPQLARYL 53



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 22/44 (50%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +3

Query: 750 LPAGWVKELRTRTCP-SGIRKDPYYIDPVSGYEFRSKRDVMRYL 878
           LP GW KE  TR    S  + D YY  P SG +FRSK  + RYL
Sbjct: 11  LPQGWKKEEVTRRSGLSAGKSDVYYYSP-SGKKFRSKPQLARYL 53



>gb:HSMETHYL2_2018714 Homo sapiens methyl-CpG binding protein 2
           (MBD2) gene, exon 2 and alternatively spliced
           testis-specific methyl-CpG binding protein 2, complete
           cds.
          Length = 302

 Score = 43.9 bits (102), Expect = 0.010
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SPSG+KF SK Q++++L +  +
Sbjct: 155 LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVD 202



 Score = 42.7 bits (99), Expect = 0.022
 Identities = 34/93 (36%), Positives = 42/93 (45%), Gaps = 5/93 (5%)
 Frame = +3

Query: 1386 SGS-GKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRS 1553
            SGS G  P    +   G+      LPPGW +E   RK G    KSD +Y  P SG  FRS
Sbjct: 131  SGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRS 189

Query: 1554 KKDAQRYL-ETGDIAKCIMKPTKREPGSAFNDK 1649
            K    RYL  T D++    +  K  P     +K
Sbjct: 190  KPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNK 222



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 27/65 (41%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +3

Query: 1059 PVAVQNGSESELPA---GWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYI-E 1223
            P A ++G   + PA   GW KE   R+ G    K D YY  P SG  FRSK    RY+  
Sbjct: 141  PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQLARYLGN 199

Query: 1224 TGDIS 1238
            T D+S
Sbjct: 200  TVDLS 204



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 699 PKTVSPAVAAQDISADGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMR 872
           P+      + + +    LP GW KE  +R     +G + D YY  P SG +FRSK  + R
Sbjct: 138 PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAG-KSDVYYFSP-SGKKFRSKPQLAR 195

Query: 873 YL 878
           YL
Sbjct: 196 YL 197



>gb:AF072242_1880853 Homo sapiens methyl-CpG binding protein MBD2
           (MBD2) mRNA, complete cds.>gb:BC032638_1980587 Homo
           sapiens methyl-CpG binding domain protein 2, transcript
           variant 1, mRNA (cDNA clone MGC:45085 IMAGE:5496721),
           complete cds.>gb:HSMETHYL6_2018715 Homo sapiens
           methyl-CpG binding protein 2 (MBD2) gene, exon 6 and
           complete cds.
          Length = 411

 Score = 43.9 bits (102), Expect = 0.010
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SPSG+KF SK Q++++L +  +
Sbjct: 155 LPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVD 202



 Score = 42.7 bits (99), Expect = 0.022
 Identities = 34/93 (36%), Positives = 42/93 (45%), Gaps = 5/93 (5%)
 Frame = +3

Query: 1386 SGS-GKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRS 1553
            SGS G  P    +   G+      LPPGW +E   RK G    KSD +Y  P SG  FRS
Sbjct: 131  SGSAGPGPRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRS 189

Query: 1554 KKDAQRYL-ETGDIAKCIMKPTKREPGSAFNDK 1649
            K    RYL  T D++    +  K  P     +K
Sbjct: 190  KPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNK 222



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 27/65 (41%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +3

Query: 1059 PVAVQNGSESELPA---GWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYI-E 1223
            P A ++G   + PA   GW KE   R+ G    K D YY  P SG  FRSK    RY+  
Sbjct: 141  PRATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSP-SGKKFRSKPQLARYLGN 199

Query: 1224 TGDIS 1238
            T D+S
Sbjct: 200  TVDLS 204



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 5/125 (4%)
 Frame = +3

Query: 699  PKTVSPAVAAQDISADGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMR 872
            P+      + + +    LP GW KE  +R     +G + D YY  P SG +FRSK  + R
Sbjct: 138  PRGPRATESGKRMDCPALPPGWKKEEVIRKSGLSAG-KSDVYYFSP-SGKKFRSKPQLAR 195

Query: 873  YL-ETGDIKKCVIKPKKRDESASKDIHHNI--EEVSPNEKSVEDNSQISKRRKSVVDKRP 1043
            YL  T D+     +  K   S  +     +  + ++ N+   + N+ +  R+ + + K+P
Sbjct: 196  YLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQP 255

Query: 1044 AKIVS 1058
               V+
Sbjct: 256  VTKVT 260



>gb:AY238336_2521387 Danio rerio methyl-CpG binding protein 2 (mbd2)
           mRNA, complete cds.
          Length = 256

 Score = 43.1 bits (100), Expect = 0.017
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           LPPGW  E   R +G   G +   Y SP G+KF SK Q+S++L +  +
Sbjct: 11  LPPGWKKEEVIRKSGLSAGKSDVYYYSPKGKKFRSKPQLSRYLGNTVD 58



 Score = 39.7 bits (91), Expect = 0.19
 Identities = 28/69 (40%), Positives = 32/69 (46%), Gaps = 4/69 (5%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYL-ETGDIAKCIMKPTKR 1622
            LPPGW +E   RK G    KSD +Y  P  G  FRSK    RYL  T D+     +  K 
Sbjct: 11   LPPGWKKEEVIRKSGLSAGKSDVYYYSP-KGKKFRSKPQLSRYLGNTVDLGCFDFRTGKM 69

Query: 1623 EPGSAFNDK 1649
             PG     K
Sbjct: 70   MPGKMQKSK 78



>gb:HSMECP2X_2018698 H.sapiens mRNA for methyl-CpG-binding protein 2.
          Length = 486

 Score = 42.0 bits (97), Expect = 0.038
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 17/149 (11%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIE----------EVSP 974
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E          E S 
Sbjct: 10   EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 69

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD 1154
            +  +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K 
Sbjct: 70   SAPAVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKY 120

Query: 1155 PYYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
              Y     G  FRSK +   Y E  GD S
Sbjct: 121  DVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 100 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 73   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 130

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 131  AFRSKVELIAYFE 143



>gb:HSMECP2_2018697 H.sapiens MeCP-2 gene.
          Length = 477

 Score = 42.0 bits (97), Expect = 0.038
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 17/149 (11%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIE----------EVSP 974
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E          E S 
Sbjct: 1    EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 60

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD 1154
            +  +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K 
Sbjct: 61   SAPAVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKY 111

Query: 1155 PYYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
              Y     G  FRSK +   Y E  GD S
Sbjct: 112  DVYLINPQGKAFRSKVELIAYFEKVGDTS 140



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 91  LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 140



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 64   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 121

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 122  AFRSKVELIAYFE 134



>gb:HSM806231_2018245 Homo sapiens mRNA; cDNA DKFZp686A24160 (from
            clone DKFZp686A24160).
          Length = 516

 Score = 42.0 bits (97), Expect = 0.038
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 17/149 (11%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIE----------EVSP 974
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E          E S 
Sbjct: 40   EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 99

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD 1154
            +  +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K 
Sbjct: 100  SAPAVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKY 150

Query: 1155 PYYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
              Y     G  FRSK +   Y E  GD S
Sbjct: 151  DVYLINPQGKAFRSKVELIAYFEKVGDTS 179



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 130 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 179



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 103  AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 160

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 161  AFRSKVELIAYFE 173



>gb:AY541280_1956333 Homo sapiens methyl CpG binding protein 2 isoform
            B (MECP2) mRNA, complete cds.
          Length = 498

 Score = 42.0 bits (97), Expect = 0.038
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 17/149 (11%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIE----------EVSP 974
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E          E S 
Sbjct: 22   EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 81

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD 1154
            +  +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K 
Sbjct: 82   SAPAVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKY 132

Query: 1155 PYYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
              Y     G  FRSK +   Y E  GD S
Sbjct: 133  DVYLINPQGKAFRSKVELIAYFEKVGDTS 161



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 112 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 161



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 85   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 142

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 143  AFRSKVELIAYFE 155



>sp|P51608|MEC2_HUMAN Methyl-CpG-binding protein 2 (MeCP-2 protein)
            (MeCP2).>gb:AF030876_1877681 Homo sapiens chromosome X
            clone Qc-8D3, RP4-671D9, I104-219D, L110-C1837 map q28,
            complete sequence.>gb:AF158180_1886771 Homo sapiens
            methyl CpG binding protein 2 (MECP2) mRNA, complete
            cds.>gb:BC011612_1973077 Homo sapiens methyl CpG binding
            protein 2 (Rett syndrome), mRNA (cDNA clone MGC:10245
            IMAGE:3956518), complete cds.>gb:HSA132917_2000341 Homo
            sapiens mRNA for methyl-CpG-binding protein
            2.>gb:HSMECPG2_2018699 H.sapiens mRNA for
            methyl-CpG-binding protein 2.>gb:HUMMECP_2034254 Homo
            sapiens methyl-CpG-binding protein (MeCP-2) mRNA,
            complete cds.
          Length = 486

 Score = 42.0 bits (97), Expect = 0.038
 Identities = 39/149 (26%), Positives = 60/149 (40%), Gaps = 17/149 (11%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIE----------EVSP 974
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E          E S 
Sbjct: 10   EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 69

Query: 975  NEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKD 1154
            +  +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K 
Sbjct: 70   SAPAVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKY 120

Query: 1155 PYYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
              Y     G  FRSK +   Y E  GD S
Sbjct: 121  DVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 100 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 73   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 130

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 131  AFRSKVELIAYFE 143



>gb:AF051768_2470747 Xenopus laevis methyl-CpG-binding protein 2 mRNA,
            complete cds.>gb:AF106951_2473965 Xenopus laevis
            methyl-CpG-binding protein MeCP2 (MECP2) mRNA, complete
            cds.
          Length = 467

 Score = 41.6 bits (96), Expect = 0.049
 Identities = 33/127 (25%), Positives = 51/127 (40%), Gaps = 16/127 (12%)
 Frame = +3

Query: 906  IKPKKRDESASKDIHHNIE---------------EVSPNEKSVEDNSQISKRRKSVVDKR 1040
            +K  K+DE   ++  H+ E               E +    +V ++S   K+R+SV+  R
Sbjct: 33   VKKDKKDEEEKQEPFHSSEHQPGEPADEGKADMSESAEENLAVPESSASPKQRRSVIRDR 92

Query: 1041 PAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYI 1220
                  P          LP GW ++ K R+ G    K   Y    +G  FRSK +   Y 
Sbjct: 93   GPMYEDPT---------LPEGWTRKLKQRKSGRSAGKFDVYLINPNGKAFRSKVELIAYF 143

Query: 1221 E-TGDIS 1238
            +  GD S
Sbjct: 144  QKVGDTS 150



 Score = 36.2 bits (82), Expect = 2.1
 Identities = 41/166 (24%), Positives = 68/166 (40%), Gaps = 1/166 (0%)
 Frame = +3

Query: 654  SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRK-DPYYIDP 830
            S + ++R+SV+ ++ P    P           LP GW ++L+ R       K D Y I+P
Sbjct: 79   SASPKQRRSVIRDRGPMYEDPT----------LPEGWTRKLKQRKSGRSAGKFDVYLINP 128

Query: 831  VSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDNSQIS 1010
             +G  FRSK +++ Y +           K  D S           + PN+       + S
Sbjct: 129  -NGKAFRSKVELIAYFQ-----------KVGDTS-----------LDPNDFDFTVTGRGS 165

Query: 1011 KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIR 1148
              R+    K+P K  +P +  +G     P G IK+ K      G++
Sbjct: 166  PSRRE--QKQPKKPKAPKSSVSGRGRGRPKGSIKKVKPPVKSEGVQ 209



 Score = 35.8 bits (81), Expect = 2.7
 Identities = 16/50 (32%), Positives = 27/50 (54%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P+G+ F SK ++  +     +++
Sbjct: 101 LPEGWTRKLKQRKSGRSAGKFDVYLINPNGKAFRSKVELIAYFQKVGDTS 150



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
 Frame = +3

Query: 1365 HVAKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVS 1535
            ++A  + S S K+   V+ +  G       LP GWTR+ + RK G    K D + ++P +
Sbjct: 72   NLAVPESSASPKQRRSVIRD-RGPMYEDPTLPEGWTRKLKQRKSGRSAGKFDVYLINP-N 129

Query: 1536 GFGFRSKKDAQRYLE 1580
            G  FRSK +   Y +
Sbjct: 130  GKAFRSKVELIAYFQ 144



>gb:AB061672_2462906 Xenopus laevis mRNA for methyl-CpG binding
           protein MBD2, complete cds.
          Length = 267

 Score = 41.6 bits (96), Expect = 0.049
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           LP GW  E   R +G   G +   Y SP+G+KF SK Q++++L ++ + N+
Sbjct: 11  LPAGWKKEEVIRKSGLSAGKSDVYYYSPNGKKFRSKPQLARYLGNSVDLNS 61



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 8/111 (7%)
 Frame = +3

Query: 735  ISADGLPAGWVKE--LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRY------LETGD 890
            +    LPAGW KE  +R     +G + D YY  P +G +FRSK  + RY      L + D
Sbjct: 6    LECPALPAGWKKEEVIRKSGLSAG-KSDVYYYSP-NGKKFRSKPQLARYLGNSVDLNSFD 63

Query: 891  IKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRP 1043
             +   + P K  ++  +      + ++ N+   + N+ +  R+ + + K+P
Sbjct: 64   FRTGKMMPSKLQKNKQR---LRNDPLNQNKSKPDLNTTLPIRQTASIFKQP 111



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 21/44 (47%), Positives = 24/44 (54%), Gaps = 3/44 (6%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYL 1577
            LP GW +E   RK G    KSD +Y  P +G  FRSK    RYL
Sbjct: 11   LPAGWKKEEVIRKSGLSAGKSDVYYYSP-NGKKFRSKPQLARYL 53



>gb:AF295597_1895484 Macaca fascicularis methyl-CpG-binding protein 2
            (MECP2) mRNA, complete cds.
          Length = 486

 Score = 41.6 bits (96), Expect = 0.049
 Identities = 38/130 (29%), Positives = 50/130 (38%), Gaps = 16/130 (12%)
 Frame = +3

Query: 897  KCVIKPKKRD-----ESASKDIHHNIE----------EVSPNEKSVEDNSQISKRRKSVV 1031
            K V K KK D     E      HH+ E          E S +  +V + S   K+R+S++
Sbjct: 29   KKVKKDKKEDKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSII 88

Query: 1032 DKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAF 1211
              R      P          LP GW ++ K R+ G    K   Y     G  FRSK +  
Sbjct: 89   RDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELI 139

Query: 1212 RYIE-TGDIS 1238
             Y E  GD S
Sbjct: 140  AYFEKVGDTS 149



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 100 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 73   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 130

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 131  AFRSKVELIAYFE 143



>sp|Q00566|MEC2_RAT Methyl-CpG-binding protein 2 (MeCP-2 protein)
            (MeCP2).>pir|A41907|A41907 methyl-CpG-binding protein 2 -
            rat>gb:RATMECP2A_2132918 Rat MeCP-2 mRNA, complete cds.
          Length = 492

 Score = 41.6 bits (96), Expect = 0.049
 Identities = 37/130 (28%), Positives = 51/130 (39%), Gaps = 16/130 (12%)
 Frame = +3

Query: 897  KCVIKPKKRDESASKD-----IHHNIE----------EVSPNEKSVEDNSQISKRRKSVV 1031
            K V K KK D+    +      HH+ E          E S +  +V + S   K+R+S++
Sbjct: 29   KKVKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSII 88

Query: 1032 DKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAF 1211
              R      P          LP GW ++ K R+ G    K   Y     G  FRSK +  
Sbjct: 89   RDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELI 139

Query: 1212 RYIE-TGDIS 1238
             Y E  GD S
Sbjct: 140  AYFEKVGDTS 149



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 100 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 73   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 130

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 131  AFRSKVELIAYFE 143



>gb:BC071531_2556267 Danio rerio methyl-CpG binding domain protein
           3a, mRNA (cDNA clone MGC:86913 IMAGE:6905673), complete
           cds.
          Length = 273

 Score = 41.2 bits (95), Expect = 0.064
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSA 551
           LP GW +E  TR +G   G +   Y SP+G+KF SK Q+ ++L  +
Sbjct: 11  LPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKS 56



 Score = 35.0 bits (79), Expect = 4.6
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 3/106 (2%)
 Frame = +3

Query: 750  LPAGW-VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYL-ETGDIKKCVIKPKKR 923
            LP GW ++E+  ++  S  + D YY  P +G +FRSK  ++RYL ++ D+     +  K 
Sbjct: 11   LPNGWKMEEVTRKSGLSAGKSDVYYFSP-TGKKFRSKPQLVRYLGKSMDLSSFDFRTGKM 69

Query: 924  DES-ASKDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVS 1058
              S  +K+      + S N+   + N+ ++ R+ + + K+P   V+
Sbjct: 70   LMSKLNKNRQRIRSDHSQNKGKPDLNTSLTVRQTASIFKQPVTKVT 115



>gb:AY398379_2531909 Danio rerio clone RK121A1A12 methyl-CpG binding
           domain protein 3 (MBD3) mRNA, complete cds.
          Length = 273

 Score = 41.2 bits (95), Expect = 0.064
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSA 551
           LP GW +E  TR +G   G +   Y SP+G+KF SK Q+ ++L  +
Sbjct: 11  LPNGWKMEEVTRKSGLSAGKSDVYYFSPTGKKFRSKPQLVRYLGKS 56



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 29/106 (27%), Positives = 55/106 (51%), Gaps = 3/106 (2%)
 Frame = +3

Query: 750  LPAGW-VKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYL-ETGDIKKCVIKPKKR 923
            LP GW ++E+  ++  S  + D YY  P +G +FRSK  ++RYL ++ D+     +  K 
Sbjct: 11   LPNGWKMEEVTRKSGLSAGKSDVYYFSP-TGKKFRSKPQLVRYLGKSMDLSSFDFRTGKM 69

Query: 924  DES-ASKDIHHNIEEVSPNEKSVEDNSQISKRRKSVVDKRPAKIVS 1058
              S  +K+      + S N+   + N+ +  R+ + + K+P   V+
Sbjct: 70   LMSKLNKNRQRIRSDHSQNKGKPDLNTSLPVRQTASIFKQPVTKVT 115



>gb:AX886192_1481645 Sequence 2055 from Patent EP1033401.
          Length = 219

 Score = 41.2 bits (95), Expect = 0.064
 Identities = 37/147 (25%), Positives = 57/147 (38%), Gaps = 17/147 (11%)
 Frame = +3

Query: 849  RSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIEEV----------SPNE 980
            +S+   +  L+   +K   +K  K++E   K        HH+ E            S + 
Sbjct: 24   KSEDQDLZGLKDXPLKFXXVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSXGSGSA 83

Query: 981  KSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPY 1160
             +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K   
Sbjct: 84   PAVPEASASPKQRRSIIRDRGXMXDDPT---------LPEGWTRKLKQRKSGRSAGKYDV 134

Query: 1161 YTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
            Y     G  FRSK +   Y E  GD S
Sbjct: 135  YLINPQGKAFRSKVELIAYFEKVGDTS 161



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 112 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 161



 Score = 35.0 bits (79), Expect = 4.6
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 85   AVPEASASPKQRRSIIRD-RGXMXDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 142

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 143  AFRSKVELIAYFE 155



>sp|Q9Z2D6|MEC2_MOUSE Methyl-CpG-binding protein 2 (MeCP-2 protein)
            (MeCP2).>gb:AF072251_2053361 Mus musculus methyl-CpG
            binding protein 2 (MeCP2) mRNA, partial
            cds.>gb:AF158181_2057194 Mus musculus methyl CpG binding
            protein 2 (Mecp2) mRNA, complete cds.>gb:BC027153_2095785
            Mus musculus methyl CpG binding protein 2, mRNA (cDNA
            clone MGC:35595 IMAGE:4948925), complete
            cds.>gb:MMU132922_2118447 Mus musculus mRNA for protein
            encoded by methyl-CpG-binding protein 2.
          Length = 484

 Score = 40.4 bits (93), Expect = 0.11
 Identities = 35/126 (27%), Positives = 49/126 (38%), Gaps = 16/126 (12%)
 Frame = +3

Query: 909  KPKKRDESASKD-----IHHNIE----------EVSPNEKSVEDNSQISKRRKSVVDKRP 1043
            K KK D+    +      HH+ E          E S +  +V + S   K+R+S++  R 
Sbjct: 33   KDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRG 92

Query: 1044 AKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYYTDPVSGYVFRSKKDAFRYIE 1223
                 P          LP GW ++ K R+ G    K   Y     G  FRSK +   Y E
Sbjct: 93   PMYDDPT---------LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFE 143

Query: 1224 -TGDIS 1238
              GD S
Sbjct: 144  KVGDTS 149



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 100 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 149



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 73   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 130

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 131  AFRSKVELIAYFE 143



>gb:AF170346_2478291 Xenopus laevis methyl-CpG binding protein MBD3
           (MBD3) mRNA, complete cds.
          Length = 282

 Score = 40.0 bits (92), Expect = 0.14
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +3

Query: 423 GWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           GW  E  TR +G   G +   Y SPSG+KF SK Q++++L ++ + +T
Sbjct: 13  GWKKEEVTRRSGLSAGKSDVYYYSPSGKKFRSKPQLARYLGNSMDLST 60



>gb:HSRNACPGB_2020035 H.sapiens mRNA for methyl CpG binding protein 2.
          Length = 476

 Score = 40.0 bits (92), Expect = 0.14
 Identities = 36/148 (24%), Positives = 57/148 (38%), Gaps = 16/148 (10%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIEEVSPNEKSVEDNSQ 1004
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E     +    + S 
Sbjct: 1    EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 60

Query: 1005 IS---------KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP 1157
             +         K+R+S++  R      P          LP GW ++ K R+ G    K  
Sbjct: 61   SARLCEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKYD 111

Query: 1158 YYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
             Y     G  FRSK +   Y E  GD S
Sbjct: 112  VYLINPQGKAFRSKVELIAYFEKVGDTS 139



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 90  LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 139



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYLE 1580
            LP GWTR+ + RK G    K D + ++P  G  FRSK +   Y E
Sbjct: 90   LPEGWTRKLKQRKSGRSAGKYDVYLINP-QGKAFRSKVELIAYFE 133



>pir|S57963|S57963 methyl CpG binding protein 2 - human (fragment)
          Length = 476

 Score = 40.0 bits (92), Expect = 0.14
 Identities = 36/148 (24%), Positives = 57/148 (38%), Gaps = 16/148 (10%)
 Frame = +3

Query: 843  EFRSKRDVMRYLETGDIKKCVIKPKKRDESASK------DIHHNIEEVSPNEKSVEDNSQ 1004
            E +S+   ++ L+   +K   +K  K++E   K        HH+ E     +    + S 
Sbjct: 1    EEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSG 60

Query: 1005 IS---------KRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDP 1157
             +         K+R+S++  R      P          LP GW ++ K R+ G    K  
Sbjct: 61   SARLCEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKYD 111

Query: 1158 YYTDPVSGYVFRSKKDAFRYIE-TGDIS 1238
             Y     G  FRSK +   Y E  GD S
Sbjct: 112  VYLINPQGKAFRSKVELIAYFEKVGDTS 139



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 90  LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 139



 Score = 34.3 bits (77), Expect = 7.9
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%)
 Frame = +3

Query: 1455 LPPGWTREFRARKCGT---KSDPFYVDPVSGFGFRSKKDAQRYLE 1580
            LP GWTR+ + RK G    K D + ++P  G  FRSK +   Y E
Sbjct: 90   LPEGWTRKLKQRKSGRSAGKYDVYLINP-QGKAFRSKVELIAYFE 133



>gb:AF072248_2053359 Mus musculus methyl-CpG binding
           domain-containing protein MBD3 (Mbd3) mRNA, complete
           cds.>gb:AF120995_2055352 Mus musculus domesticus
           methyl-CpG binding domain-containing protein 3 (Mbd3)
           gene, complete cds.>gb:BC086183_2564763 Xenopus laevis
           hypothetical LOC495785, mRNA (cDNA clone MGC:98642
           IMAGE:7200216), complete cds.
          Length = 285

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           LP GW  E   R +G   G     Y SPSG+KF SK Q++++L  + + +T
Sbjct: 11  LPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLST 61



>gb:AF072246_1880854 Homo sapiens testis specific methyl-CpG binding
           protein MBD2 (MBD2) mRNA, partial cds.
          Length = 146

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 18/46 (39%), Positives = 27/46 (58%)
 Frame = +3

Query: 420 PGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           PGW  E   R +G   G +   Y SPSG+KF SK Q++++L +  +
Sbjct: 1   PGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVD 46



>gb:AC005943_1875060 Homo sapiens chromosome 19, cosmid R30538,
           complete sequence.>gb:AF072247_1880855 Homo sapiens
           methyl-CpG binding domain-containing protein MBD3 (MBD3)
           mRNA, complete cds.
          Length = 291

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 20/51 (39%), Positives = 29/51 (56%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           LP GW  E   R +G   G     Y SPSG+KF SK Q++++L  + + +T
Sbjct: 11  LPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLST 61



>gb:AY050816_1562320 Arabidopsis thaliana unknown protein
           (At1g63240) mRNA, complete cds.>gb:AY114080_1578491
           Arabidopsis thaliana unknown protein (At1g63240) mRNA,
           complete cds.
          Length = 548

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = +3

Query: 48  MVAGKSPEPLPPGWIEHVQV-KNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQNQ 224
           + A  +P+ LP GWI H  V K GR  + YT    GKK  ++  V+  +K   +   +  
Sbjct: 9   ITADATPDWLPVGWIAHSTVLKRGRQTRTYTQLRTGKKLSTKDQVLEYIKMEKIREKREA 68

Query: 225 GINNGE 242
           GI   +
Sbjct: 69  GIKRNK 74



>gb:AY238339_1312188 Branchiostoma floridae methyl-CpG binding
           protein 2/3 (Mbd2/3) mRNA, complete cds.
          Length = 326

 Score = 39.7 bits (91), Expect = 0.19
 Identities = 35/144 (24%), Positives = 50/144 (34%), Gaps = 29/144 (20%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQF-----------------L 542
           LP  W  E  TR +G   G +   Y SPSG+KF SK Q++++                 L
Sbjct: 11  LPKEWKREEVTRKSGLSAGKSDVYYYSPSGKKFRSKPQLARYLGDTFDLSCFDFRTGKML 70

Query: 543 NSAANSNTPIXXXXXXXXXXXXXXXXVPQNQT------------PKENQSRTSRKRKSVM 686
           +S  N N  +                +P  QT             K N+   +R      
Sbjct: 71  SSKVNKNKKVATRALDSNKKYDAGLVLPIRQTASIFKQPVTHVRSKANKGSETRNDPKSA 130

Query: 687 DNQTPKTVSPAVAAQDISADGLPA 758
           + + PK + P       SA   PA
Sbjct: 131 NQEQPKQMGPKSGTTPKSARPPPA 154



>gb:BC066079_2105708 Mus musculus RIKEN cDNA 6330407J23 gene, mRNA
            (cDNA clone MGC:91342 IMAGE:30355520), complete cds.
          Length = 919

 Score = 37.7 bits (86), Expect = 0.71
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 4/100 (4%)
 Frame = +3

Query: 849  RSKRDVMRYLETGDIKKCVIKPKKRDESASKDI----HHNIEEVSPNEKSVEDNSQISKR 1016
            +++R  +RY +TG+I   +++  ++D   +KD+    HH +E V     + ED ++  K 
Sbjct: 413  KAERKRLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENE--KL 470

Query: 1017 RKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLG 1136
            R+ +++   AK     A+QN  E       +KE   +R G
Sbjct: 471  RQQLIEVEIAK----QALQNELEK------MKELSLKRRG 500



>gb:HSJ403A15_2016113 Human DNA sequence from clone RP3-403A15 on
            chromosome 6q22.31-23.1 Contains the 3' end of a novel
            gene, the gene KIAA0408, a 60S Ribosomal protein L23
            (RPL23) pseudogene and two CpG islands, complete
            sequence.
          Length = 947

 Score = 37.7 bits (86), Expect = 0.71
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 4/100 (4%)
 Frame = +3

Query: 849  RSKRDVMRYLETGDIKKCVIKPKKRDESASKDI----HHNIEEVSPNEKSVEDNSQISKR 1016
            +++R  +RY +TG+I   +++  ++D   +KD+    HH +E V     + ED ++  K 
Sbjct: 415  KAERKRLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENE--KL 472

Query: 1017 RKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLG 1136
            R+ +++   AK     A+QN  E       +KE   +R G
Sbjct: 473  RQQLIEVEIAK----QALQNELEK------MKELSLKRRG 502



>gb:AK018139_1159459 Mus musculus adult male medulla oblongata cDNA,
            RIKEN full-length enriched library, clone:6330407J23
            product:hypothetical Glycine-rich region containing
            protein, full insert sequence.
          Length = 633

 Score = 37.7 bits (86), Expect = 0.71
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 4/100 (4%)
 Frame = +3

Query: 849  RSKRDVMRYLETGDIKKCVIKPKKRDESASKDI----HHNIEEVSPNEKSVEDNSQISKR 1016
            +++R  +RY +TG+I   +++  ++D   +KD+    HH +E V     + ED ++  K 
Sbjct: 101  KAERKRLRYAQTGEIDGELLRSLEQDLKVAKDVSVRLHHELENVEEKRTTTEDENE--KL 158

Query: 1017 RKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLG 1136
            R+ +++   AK     A+QN  E       +KE   +R G
Sbjct: 159  RQQLIEVEIAK----QALQNELEK------MKELSLKRRG 188



>gb:BC024812_2094733 Mus musculus methyl-CpG binding domain protein
           4, mRNA (cDNA clone MGC:36060 IMAGE:5356016), complete
           cds.
          Length = 554

 Score = 37.4 bits (85), Expect = 0.93
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +3

Query: 663 SRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRK-DPYYIDPVSG 839
           S +R S++   T  T+S   A +      +P GW + ++ R       K D Y+I P  G
Sbjct: 46  SSERSSLLQEPTASTLSSTTATEGHKP--VPCGWERVVKQRLSGKTAGKFDVYFISP-QG 102

Query: 840 YEFRSKRDVMRYL 878
            +FRSKR +  YL
Sbjct: 103 LKFRSKRSLANYL 115



>gb:AF072249_2053360 Mus musculus methyl-CpG binding protein MBD4
           (Mbd4) mRNA, complete cds.>gb:AF120996_2055353 Mus
           musculus domesticus methyl-CpG binding protein 4 (Mbd4)
           gene, complete cds.
          Length = 554

 Score = 37.4 bits (85), Expect = 0.93
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +3

Query: 663 SRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRK-DPYYIDPVSG 839
           S +R S++   T  T+S   A +      +P GW + ++ R       K D Y+I P  G
Sbjct: 46  SSERSSLLQEPTASTLSSTTATEGHKP--VPCGWERVVKQRLSGKTAGKFDVYFISP-QG 102

Query: 840 YEFRSKRDVMRYL 878
            +FRSKR +  YL
Sbjct: 103 LKFRSKRSLANYL 115



>gb:GGARBP_2572927 Gallus gallus mRNA for attachment region binding
            protein (ARBP).
          Length = 344

 Score = 37.0 bits (84), Expect = 1.2
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 1/86 (1%)
 Frame = +3

Query: 984  SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY 1163
            +V + S   K+R+S++  R      P          LP GW ++ K R+ G    K   Y
Sbjct: 74   AVPEASASPKQRRSIIRDRGPMYDDPT---------LPEGWTRKLKQRKSGRSAGKYDVY 124

Query: 1164 TDPVSGYVFRSKKDAFRYIE-TGDIS 1238
                 G  FRSK +   Y E  GD S
Sbjct: 125  LINPQGKAFRSKVELIAYFEKVGDTS 150



 Score = 35.4 bits (80), Expect = 3.5
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSN 563
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     +++
Sbjct: 101 LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTS 150



 Score = 34.7 bits (78), Expect = 6.0
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = +3

Query: 1371 AKKQKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGF 1541
            A  + S S K+   ++ +  G       LP GWTR+ + RK G    K D + ++P  G 
Sbjct: 74   AVPEASASPKQRRSIIRD-RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINP-QGK 131

Query: 1542 GFRSKKDAQRYLE 1580
             FRSK +   Y E
Sbjct: 132  AFRSKVELIAYFE 144



>gb:AY298900_2525767 Danio rerio methyl-cytosine binding protein 2
            (mecp2) mRNA, complete cds.
          Length = 524

 Score = 37.0 bits (84), Expect = 1.2
 Identities = 23/80 (28%), Positives = 34/80 (42%)
 Frame = +3

Query: 984  SVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTRRLGHGIRKDPYY 1163
            S  ++S  +K+R+SV+  R      P          LP GW ++ K R+ G    K   Y
Sbjct: 82   SAPESSASAKQRRSVIRDRGPMYEDP---------SLPQGWTRKLKQRKSGRSAGKFDVY 132

Query: 1164 TDPVSGYVFRSKKDAFRYIE 1223
                 G  FRSK +   Y +
Sbjct: 133  LINPEGKAFRSKVELMAYFQ 152



 Score = 36.6 bits (83), Expect = 1.6
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 3/70 (4%)
 Frame = +3

Query: 1380 QKSGSGKRPAKVVSNAEGQTESVDGLPPGWTREFRARKCGT---KSDPFYVDPVSGFGFR 1550
            + S S K+   V+ +  G       LP GWTR+ + RK G    K D + ++P  G  FR
Sbjct: 85   ESSASAKQRRSVIRD-RGPMYEDPSLPQGWTRKLKQRKSGRSAGKFDVYLINP-EGKAFR 142

Query: 1551 SKKDAQRYLE 1580
            SK +   Y +
Sbjct: 143  SKVELMAYFQ 152



 Score = 36.2 bits (82), Expect = 2.1
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANSNT 566
           LP GWT +LK R +G   G      I+P G+ F SK ++  +     ++ T
Sbjct: 109 LPQGWTRKLKQRKSGRSAGKFDVYLINPEGKAFRSKVELMAYFQKVGDTIT 159



 Score = 36.2 bits (82), Expect = 2.1
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +3

Query: 654 SRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSGIRK-DPYYIDP 830
           S ++++R+SV+ ++ P    P+          LP GW ++L+ R       K D Y I+P
Sbjct: 87  SASAKQRRSVIRDRGPMYEDPS----------LPQGWTRKLKQRKSGRSAGKFDVYLINP 136

Query: 831 VSGYEFRSKRDVMRYLE 881
             G  FRSK ++M Y +
Sbjct: 137 -EGKAFRSKVELMAYFQ 152



>gb:AP005907_1859888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1151D08.
          Length = 254

 Score = 37.0 bits (84), Expect = 1.2
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
 Frame = +3

Query: 753 PAGWVKELRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDI----KKCVIKPKK 920
           P GWV E+  R       KD YY      ++FRSK +V  +L+TG +      C+++ + 
Sbjct: 178 PDGWVVEIHLRNDQK--TKDKYYRHKDYNHKFRSKPEVKSFLDTGKVIIRKVPCILQKRS 235

Query: 921 RDES 932
            D S
Sbjct: 236 ADAS 239



>gb:NCB9G16_1690435 Neurospora crassa DNA linkage group II BAC clone
            B9G16.
          Length = 325

 Score = 37.0 bits (84), Expect = 1.2
 Identities = 22/97 (22%), Positives = 45/97 (46%)
 Frame = +3

Query: 792  PSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVS 971
            P G RK   +ID V  +     +  +R  E  +++K     K   +S   DI    ++ S
Sbjct: 168  PQGARKSKPFIDHVMSFSIADGKIWVRNYEIREVEKA----KGEKDSEGNDIVPESDKSS 223

Query: 972  PNEKSVEDNSQISKRRKSVVDKRPAKIVSPVAVQNGS 1082
              ++    N+++     S+V+  P  +++P+ +Q G+
Sbjct: 224  SKKRKGAPNAELKDTDVSLVEIGPRFVLTPIIIQEGA 260



>gb:CP000019_870174 Haemophilus somnus 129PT plasmid pHS129, complete
            sequence.
          Length = 323

 Score = 36.6 bits (83), Expect = 1.6
 Identities = 36/118 (30%), Positives = 52/118 (44%), Gaps = 15/118 (12%)
 Frame = +3

Query: 870  RYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDNSQISKRRKS-VVDKRP- 1043
            +Y E  +  K V+KP   D +   D+  NIE V    K V    QI+K+ KS   +  P 
Sbjct: 174  KYPEYKEFNKFVLKPSLSDINEKSDLLLNIEPVKRGRKIVALEFQIAKKAKSKKAEPTPE 233

Query: 1044 ---------AKIVSPVAVQNGSESELPAGWIKEYKTRRLGH----GIRKDPYYTDPVS 1178
                     A+I  P  V+ GS++E    W+ E  TR +      GI K  +  D +S
Sbjct: 234  GTRKIHGVFAEIPRPQVVK-GSQAE--TDWVNENYTRAVKQMREKGILKSRFIEDELS 288



>gb:BC043835_2548291 Xenopus laevis methyl-CpG binding domain
           protein 1, mRNA (cDNA clone MGC:53260 IMAGE:5569883),
           complete cds.
          Length = 321

 Score = 36.2 bits (82), Expect = 2.1
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +3

Query: 408 DW--LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAAN 557
           DW  L PGW      R +G+  G +   Y SP+G+K  S+ +++++L SA +
Sbjct: 7   DWPLLGPGWKRRNVVRKSGATCGHSDTYYRSPAGKKIRSRIELAKYLGSAVD 58



>gb:BA000026_693508 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 801

 Score = 35.8 bits (81), Expect = 2.7
 Identities = 24/96 (25%), Positives = 46/96 (47%)
 Frame = +3

Query: 813  PYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVE 992
            P  +D +   +++SK+D   Y++   +KK   + +K DE+   +    + E++   K + 
Sbjct: 649  PDVLDEIIEQKYKSKKDEYDYVD--GLKKIEEERRKIDETLELERLRLLAEINLGTKKLT 706

Query: 993  DNSQISKRRKSVVDKRPAKIVSPVAVQNGSESELPA 1100
            D  + S+   + V   P  I  PV  Q  + +E PA
Sbjct: 707  DLQEKSQMNAAPVAPTPIIIQQPVVQQPAAPAETPA 742



>sp|Q09685|YA12_SCHPO Hypothetical protein C13C5.02 in chromosome
           I.>pir|S58094|S58094 hypothetical WW domain protein
           SPAC13C5.02 - fission yeast  (Schizosaccharomyces
           pombe)>gb:AY227798_1591118 Schizosaccharomyces pombe
           hyphal growth protein 1 (hgp1) gene, complete
           cds.>gb:SPAC13C5_1716436 S.pombe chromosome I cosmid
           c13C5.
          Length = 411

 Score = 35.8 bits (81), Expect = 2.7
 Identities = 20/50 (40%), Positives = 23/50 (46%)
 Frame = +3

Query: 69  EPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           +PLPPGW EH   K    I YY N E  K  Y R + I    +  V   Q
Sbjct: 3   QPLPPGWTEH---KAPSGIPYYWNAELKKSTYQRPSFIEKNHSSSVTASQ 49



>gb:AY080662_1568394 Arabidopsis thaliana unknown protein
           (At1g22310) mRNA, complete cds.>gb:AY133726_1581546
           Arabidopsis thaliana clone U19801 unknown protein
           (At1g22310) mRNA, complete cds.
          Length = 425

 Score = 35.0 bits (79), Expect = 4.6
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +3

Query: 411 WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANS 560
           +LP GW + L  +  GS+     + YISP G++F +  +VS +L S   S
Sbjct: 244 YLPRGWRLMLYIKRKGSNLLLACRRYISPDGQQFETCKEVSTYLRSLLES 293



>gb:AE014297_1139181 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003695_1221174 Drosophila melanogaster
           chromosome 3R, section 33 of 118 of the complete
           sequence.>gb:AY113647_1299595 Drosophila melanogaster
           SD10773 full insert cDNA.
          Length = 1081

 Score = 35.0 bits (79), Expect = 4.6
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +3

Query: 408 DW-LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNS 548
           DW LPPGW   +  RS     G      +SPSG++F SK+ +  FL S
Sbjct: 364 DWRLPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFLES 409



>gb:AE014297_1139180 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003695_1221173 Drosophila melanogaster
           chromosome 3R, section 33 of 118 of the complete
           sequence.
          Length = 1169

 Score = 35.0 bits (79), Expect = 4.6
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = +3

Query: 408 DW-LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNS 548
           DW LPPGW   +  RS     G      +SPSG++F SK+ +  FL S
Sbjct: 452 DWRLPPGWIKHMYQRSNVL--GKWDVILVSPSGKRFRSKSDLKLFLES 497



>pir|A86356|A86356 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_891186 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T16E15_1723535 Sequence of BAC T16E15 from
           Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AK118852_1816809 Arabidopsis thaliana
           At1g22310 mRNA for unknown protein, complete cds, clone:
           RAFL21-18-B12.
          Length = 524

 Score = 35.0 bits (79), Expect = 4.6
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +3

Query: 411 WLPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANS 560
           +LP GW + L  +  GS+     + YISP G++F +  +VS +L S   S
Sbjct: 343 YLPRGWRLMLYIKRKGSNLLLACRRYISPDGQQFETCKEVSTYLRSLLES 392



>gb:BC074695_2558189 Xenopus tropicalis methyl-CpG binding domain
            protein 3, mRNA (cDNA clone MGC:69548 IMAGE:5336695),
            complete cds.
          Length = 301

 Score = 34.7 bits (78), Expect = 6.0
 Identities = 28/72 (38%), Positives = 30/72 (41%), Gaps = 2/72 (2%)
 Frame = +3

Query: 1086 SELPAGWIKEYKTRRLGHGIRK-DPYYTDPVSGYVFRSKKDAFRYIETGDI-SKCAMKPT 1259
            S LP GW KE  TRR G    K D YY         RS +D   Y+ T     K   KP 
Sbjct: 9    SALPQGWKKEEVTRRSGLSAGKSDVYYYSSSPSRYNRSLRDRVGYLNTNPSGKKFRSKPQ 68

Query: 1260 LREPGPTSTDLS 1295
            L      S DLS
Sbjct: 69   LARYLGNSMDLS 80



>pir|T04274|T04274 hypothetical protein F20B18.300 - Arabidopsis
            thaliana>gb:ATCHRIV64_1546500 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 64.>gb:ATF20B18_1549467
            Arabidopsis thaliana DNA chromosome 4, BAC clone F20B18
            (ESSA project).
          Length = 1067

 Score = 34.7 bits (78), Expect = 6.0
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 1/135 (0%)
 Frame = +3

Query: 621  VPQNQTPKENQSRTSRKRKSVMDNQTPKTVSPAVAAQDISADGLPAGWVKELRTRTCPSG 800
            + ++ T +++  + S KRK +  ++  ++   A+ A+ +S DG      K      C S 
Sbjct: 575  IEKSATREKSGVQKSGKRKEMTKDKNIESNQDALDAEGVSDDGHKREKRKIKNKTNCESV 634

Query: 801  IRKDPYYIDPVSGYEFRSKRD-VMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPN 977
               D    + V    ++S  + V  Y    D            E ASKD+  NIE+ +  
Sbjct: 635  ATMDS---ESVQSLLYQSNGEGVKNYEGNAD-----------GEIASKDLASNIEDSATK 680

Query: 978  EKSVEDNSQISKRRK 1022
             +SV+D+    KR+K
Sbjct: 681  GESVQDDKNTKKRKK 695



>gb:BC080900_2561815 Xenopus tropicalis MBD1 protein, mRNA (cDNA
           clone IMAGE:6977305), partial cds.
          Length = 640

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +3

Query: 414 LPPGWTVELKTRSTGSHNGSTYKCYISPSGRKFYSKAQVSQFLNSAANS 560
           L PGW   +  R +G   G T   Y SP+G K  S+ +++++ ++  +S
Sbjct: 19  LGPGWKRRIAVRKSGVSCGHTDTYYKSPTGEKIRSRIELAKYFDALGSS 67



>gb:AF412121_2492683 Gallus gallus late domain-interacting protein 1
           mRNA, partial cds.
          Length = 965

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 21/51 (41%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R ++I++    D N  Q
Sbjct: 182 PPPLPPGWEEKVD-NLGRT--YYVNHNNRTTQWHRPSLIDVGSDSDNNIRQ 229



>gb:BC082281_2108348 Mus musculus neural precursor cell expressed,
           developmentally down-regulated gene 4-like, mRNA (cDNA
           clone IMAGE:5401533), partial cds.
          Length = 875

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R +++++    D N  Q
Sbjct: 195 PPPLPPGWEEKVD-NLGRT--YYVNHNNRSTQWHRPSLMDVSSESDNNIRQ 242



>gb:BC039746_2098420 Mus musculus neural precursor cell expressed,
           developmentally down-regulated gene 4-like, mRNA (cDNA
           clone MGC:49433 IMAGE:3157137), complete
           cds.>gb:BC071210_2106438 Mus musculus neural precursor
           cell expressed, developmentally down-regulated gene
           4-like, mRNA (cDNA clone MGC:78116 IMAGE:4972426),
           complete cds.
          Length = 855

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R +++++    D N  Q
Sbjct: 71  PPPLPPGWEEKVD-NLGRT--YYVNHNNRSTQWHRPSLMDVSSESDNNIRQ 118



>gb:AK122283_2068948 Mus musculus mRNA for mKIAA0439 protein.
          Length = 442

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R +++++    D N  Q
Sbjct: 170 PPPLPPGWEEKVD-NLGRT--YYVNHNNRSTQWHRPSLMDVSSESDNNIRQ 217



>gb:AF277232_2061265 Mus musculus ubiquitin-protein ligase Nedd4-2
           mRNA, complete cds.
          Length = 855

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R +++++    D N  Q
Sbjct: 71  PPPLPPGWEEKVD-NLGRT--YYVNHNNRSTQWHRPSLMDVSSESDNNIRQ 118



>gb:BC065234_1986769 Homo sapiens KIAA0423, mRNA (cDNA clone
            IMAGE:6161345), partial cds.
          Length = 798

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +3

Query: 822  IDPVSGYEFRS-KRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDN 998
            I+P SG   RS ++++  YL+  + K   +       S SK  ++ + +    EK +  N
Sbjct: 167  IEPPSGIYGRSVQQNISSYLDVENEKDAKV-------SISKSTYNKMRQKRKEEKELFHN 219

Query: 999  SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTR 1127
                K+ K+  ++        +A    SESE P G I +YK R
Sbjct: 220  KDCEKKEKNSWERMRHTGTEKMA----SESETPTGAISQYKER 258



>gb:AB007883_1864009 Homo sapiens KIAA0423 mRNA, partial cds.
          Length = 1723

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +3

Query: 822  IDPVSGYEFRS-KRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDN 998
            I+P SG   RS ++++  YL+  + K   +       S SK  ++ + +    EK +  N
Sbjct: 1145 IEPPSGIYGRSVQQNISSYLDVENEKDAKV-------SISKSTYNKMRQKRKEEKELFHN 1197

Query: 999  SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTR 1127
                K+ K+  ++        +A    SESE P G I +YK R
Sbjct: 1198 KDCEKKEKNSWERMRHTGTEKMA----SESETPTGAISQYKER 1236



>gb:CR382133_1666276 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 452

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +3

Query: 774 LRTRTCPSGIRKDPYYIDPVSGYEFRSKRDVMRYLETGDIKKCVIKPKK 920
           L+ R  P+   +DP+YI P  G+E +S  DV+++ E  ++   V+ P+K
Sbjct: 24  LKPRGLPTKPSEDPFYIAP-EGFESKSPGDVLKHREMNNLFGIVVIPEK 71



>gb:CR749557_1181127 Homo sapiens mRNA; cDNA DKFZp686D12126 (from
            clone DKFZp686D12126).
          Length = 1504

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +3

Query: 822  IDPVSGYEFRS-KRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDN 998
            I+P SG   RS ++++  YL+  + K   +       S SK  ++ + +    EK +  N
Sbjct: 1086 IEPPSGIYGRSVQQNISSYLDVENEKDAKV-------SISKSTYNKMRQKRKEEKELFHN 1138

Query: 999  SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTR 1127
                K+ K+  ++        +A    SESE P G I +YK R
Sbjct: 1139 KDCEKKEKNSWERMRHTGTEKMA----SESETPTGAISQYKER 1177



>gb:AK042621_1166353 Mus musculus 7 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:A730011F13
           product:neural precursor cell expressed, developmentally
           down-regulated gene 4b, full insert sequence.
          Length = 835

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 20/51 (39%), Positives = 26/51 (50%)
 Frame = +3

Query: 66  PEPLPPGWIEHVQVKNGRTIKYYTNGENGKKFYSRKAVINLVKAGDVNYGQ 218
           P PLPPGW E V    GRT  YY N  N    + R +++++    D N  Q
Sbjct: 71  PPPLPPGWEEKVD-NLGRT--YYVNHNNRSTQWHRPSLMDVSSESDNNIRQ 118



>pir|T00057|T00057 hypothetical protein KIAA0423 - human (fragment)
          Length = 1696

 Score = 34.3 bits (77), Expect = 7.9
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 1/103 (0%)
 Frame = +3

Query: 822  IDPVSGYEFRS-KRDVMRYLETGDIKKCVIKPKKRDESASKDIHHNIEEVSPNEKSVEDN 998
            I+P SG   RS ++++  YL+  + K   +       S SK  ++ + +    EK +  N
Sbjct: 1118 IEPPSGIYGRSVQQNISSYLDVENEKDAKV-------SISKSTYNKMRQKRKEEKELFHN 1170

Query: 999  SQISKRRKSVVDKRPAKIVSPVAVQNGSESELPAGWIKEYKTR 1127
                K+ K+  ++        +A    SESE P G I +YK R
Sbjct: 1171 KDCEKKEKNSWERMRHTGTEKMA----SESETPTGAISQYKER 1209


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,693,212,553
Number of Sequences: 1806583
Number of extensions: 36115676
Number of successful extensions: 93897
Number of sequences better than 10.0: 74
Number of HSP's better than 10.0 without gapping: 86311
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 93762
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 146460242070
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)