BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3368
         (1192 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|A84649|A84649 probable glucose regulated repressor protein [...   256   5e-67   Arabidopsis thaliana [mouse-ear cress]
gb:AY485830_1608507 Arabidopsis thaliana EIN3-binding F-box prot...   238   2e-61   
pir|T08604|T08604 hypothetical protein GRR1 - soybean>gb:AF01991...   230   4e-59   Glycine max [soybeans]
gb:AP004869_1846301 Oryza sativa (japonica cultivar-group) genom...   182   2e-44   
gb:AP003629_1831741 Oryza sativa (japonica cultivar-group) genom...   134   4e-30   
gb:AP004869_1846300 Oryza sativa (japonica cultivar-group) genom...    78   3e-13   
gb:AP003227_1825684 Oryza sativa (japonica cultivar-group) genom...    70   8e-11   
gb:AC135419_1742238 Oryza sativa (japonica cultivar-group) chrom...    69   2e-10   
gb:AY085898_1570961 Arabidopsis thaliana clone 19486 mRNA, compl...    69   2e-10   
pir|B86347|B86347 hypothetical protein F24J8.5 [imported] - Arab...    69   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY463017_1607670 Musa acuminata putative F-box protein family...    69   2e-10   
gb:BC077969_2560613 Xenopus laevis MGC81000 protein, mRNA (cDNA ...    67   7e-10   
pir|A96799|A96799 hypothetical protein F22K20.10 [imported] - Ar...    67   9e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY084229_1569322 Arabidopsis thaliana clone 100411 mRNA, comp...    66   2e-09   
gb:AK012109_1156775 Mus musculus 10 days embryo whole body cDNA,...    66   2e-09   
sp|Q9CZV8|FL2L_MOUSE|FL2L_MOUSE F-box/LRR-repeat protein 2-like.                  66   2e-09   Mus musculus [mouse]
sp|Q96IG2|FL2L_HUMAN|FL2L_HUMAN F-box/LRR-repeat protein 2-like.>gb:BC00755...    66   2e-09   Homo sapiens [man]
gb:AY091103_1574327 Arabidopsis thaliana putative F-box protein ...    65   3e-09   
pir|T48193|T48193 hypothetical protein F7A7.240 - Arabidopsis th...    65   3e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY056338_1563648 Arabidopsis thaliana putative F-box protein ...    64   6e-09   
sp|Q9QZH7|FL2L_RAT|FL2L_RAT F-box/LRR-repeat protein 2-like.>pir|T52349|T...    64   6e-09   Rattus norvegicus [brown rat]
sp|Q8BH16|FL2_MOUSE|FL2_MOUSE F-box/LRR-repeat protein 2 (F-box and leucin...    62   2e-08   Mus musculus [mouse]
gb:AB007648_1510210 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-08   
gb:BC086357_2109548 Rattus norvegicus similar to F-box protein F...    61   4e-08   
gb:HSM800297_2017131 Homo sapiens mRNA; cDNA DKFZp564P0622 (from...    61   4e-08   
gb:CR457121_1993328 Homo sapiens full open reading frame cDNA cl...    61   4e-08   
gb:AF186273_1888623 Homo sapiens leucine-rich repeats containing...    61   4e-08   
gb:AF176518_1888019 Homo sapiens leucine-rich repeat-containing ...    61   4e-08   
gb:AX876746_1476674 Sequence 11651 from Patent EP1074617.>gb:AK0...    61   4e-08   
gb:AX876382_1476504 Sequence 11287 from Patent EP1074617.              61   4e-08   
gb:CR861462_1185457 Pongo pygmaeus mRNA; cDNA DKFZp459E062 (from...    61   4e-08   
pir|C71419|C71419 hypothetical protein - Arabidopsis thaliana>gb...    61   4e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T08680|T08680 hypothetical protein DKFZp564P0622.1 - human (...    61   4e-08   Homo sapiens [man]
sp|Q9UKC9|FL2_HUMAN|FL2_HUMAN F-box/LRR-repeat protein 2 (F-box and leucin...    61   4e-08   Homo sapiens [man]
gb:AF174589_1887907 Homo sapiens F-box protein Fbl2 (FBL2) mRNA,...    61   5e-08   
gb:CR861354_1185354 Pongo pygmaeus mRNA; cDNA DKFZp459A1011 (fro...    61   5e-08   
gb:BC045831_1983645 Homo sapiens, clone IMAGE:5265088, mRNA, par...    60   7e-08   
gb:BC037897_1982248 Homo sapiens hypothetical protein LOC196394,...    60   7e-08   
gb:AK044693_1167082 Mus musculus adult retina cDNA, RIKEN full-l...    60   9e-08   
gb:BC059683_2552655 Danio rerio F-box and leucine-rich repeat pr...    60   1e-07   
gb:BC067906_1987553 Homo sapiens hypothetical protein LOC196394,...    60   1e-07   
gb:L14745_1386893 Caenorhabditis elegans cosmid C02F5, complete ...    60   1e-07   
pir|S44609|S44609 hypothetical protein C02F5.7 - Caenorhabditis ...    60   1e-07   Caenorhabditis elegans [roundworm]
sp|P34284|YKK7_CAEEL|YKK7_CAEEL Hypothetical F-box/LRR-repeat protein C02F5...    60   1e-07   Caenorhabditis elegans [roundworm]
gb:AE013599_1131302 Drosophila melanogaster chromosome 2R, compl...    59   1e-07   
gb:AF176701_1888028 Homo sapiens F-box protein FBL9 mRNA, partia...    57   6e-07   
gb:AK175607_1817595 Arabidopsis thaliana mRNA, partial cds, clon...    57   6e-07   
gb:AE014297_1139799 Drosophila melanogaster chromosome 3R, compl...    57   6e-07   
sp|Q8WV35|FXL9_HUMAN|FXL9_HUMAN F-box/LRR-repeat protein 9 (F-box and leuci...    57   6e-07   Homo sapiens [man]
gb:NC18F11_1688417 Neurospora crassa DNA linkage group V Cosmid ...    57   7e-07   
gb:BT005940_1638862 Arabidopsis thaliana At5g27920 gene, complet...    57   7e-07   
gb:CR859619_1183726 Pongo pygmaeus mRNA; cDNA DKFZp459G1413 (fro...    57   7e-07   
gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chrom...    57   7e-07   
pir|T48752|T48752 GRR1 related protein [imported] - Neurospora c...    57   7e-07   Neurospora crassa
gb:AP004067_1837165 Oryza sativa (japonica cultivar-group) genom...    56   1e-06   
gb:AY087448_1572479 Arabidopsis thaliana clone 35534 mRNA, compl...    56   2e-06   
gb:AY054560_1563214 Arabidopsis thaliana putative protein (At3g5...    56   2e-06   
gb:AK126722_1916426 Homo sapiens cDNA FLJ44768 fis, clone BRACE3...    55   2e-06   
gb:HSM801456_1186185 Homo sapiens mRNA; cDNA DKFZp434C1715 (from...    55   2e-06   
gb:AE013599_1133354 Drosophila melanogaster chromosome 2R, compl...    55   2e-06   
pir|T43444|T43444 hypothetical protein DKFZp434C1715.1 - human (...    55   2e-06   Homo sapiens [man]
sp|Q9UF56|FX13_HUMAN|FX13_HUMAN F-box only protein 13 (Fragment).                 55   2e-06   Homo sapiens [man]
gb:AE016959_1020937 Oryza sativa (japonica cultivar-group) chrom...    55   3e-06   
gb:AF174593_1887911 Homo sapiens F-box protein Fbl7 (FBL7) mRNA,...    54   6e-06   
gb:AB020647_1865245 Homo sapiens mRNA for KIAA0840 protein, part...    54   6e-06   
gb:AK032391_1162894 Mus musculus adult male olfactory brain cDNA...    54   6e-06   
pir|E85358|E85358 hypothetical protein AT4g30640 [imported] - Ar...    54   6e-06   Arabidopsis thaliana [mouse-ear cress]
sp|Q9UJT9|FXL7_HUMAN|FXL7_HUMAN F-box/LRR-repeat protein 7 (F-box and leuci...    54   6e-06   Homo sapiens [man]
gb:AK129227_2069458 Mus musculus mRNA for mKIAA0840 protein.           54   8e-06   
gb:BC033265_2097424 Mus musculus F-box and leucine-rich repeat p...    53   1e-05   
gb:AF176529_2057845 Mus musculus F-box protein FBX13 mRNA, parti...    53   1e-05   
sp|Q9QZN1|FX13_MOUSE|FX13_MOUSE F-box only protein 13 (Fragment).                 53   1e-05   Mus musculus [mouse]
gb:AB023482_1515588 Oryza sativa (japonica cultivar-group) genom...    53   1e-05   
gb:AF199355_1889695 Homo sapiens F-box protein FBL5 (FBL5) mRNA,...    52   2e-05   
gb:AF176699_1888026 Homo sapiens F-box protein FBL4 mRNA, comple...    52   2e-05   
gb:AP004650_1842658 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
sp|Q9UKA2|FXL4_HUMAN|FXL4_HUMAN F-box/LRR-repeat protein 4 (F-box and leuci...    52   2e-05   Homo sapiens [man]
gb:FRU90880_2572188 Takifugu rubripes isotocin and vasotocin locus.    51   4e-05   
gb:BC067674_2554845 Danio rerio zgc:85882, mRNA (cDNA clone MGC:...    51   4e-05   
gb:AK175307_1817295 Arabidopsis thaliana mRNA for hypothetical p...    51   4e-05   
gb:AB013396_1512190 Arabidopsis thaliana genomic DNA, chromosome...    51   4e-05   
gb:BT010706_1640652 Arabidopsis thaliana At2g06030 mRNA, complet...    51   5e-05   
gb:AE013599_1130713 Drosophila melanogaster chromosome 2R, compl...    51   5e-05   
gb:AP005398_1851132 Oryza sativa (japonica cultivar-group) genom...    50   9e-05   
pir|G88523|G88523 truncated hypothetical protein C02F5.7 - Caeno...    50   1e-04   Caenorhabditis elegans [roundworm]
gb:BC085657_2564534 Danio rerio zgc:92297, mRNA (cDNA clone MGC:...    49   2e-04   
gb:AF467464_2496361 Gallus gallus PPA (PPA) gene, partial cds.         49   2e-04   
gb:AP005709_1856455 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:ATAC009853_1543062 Arabidopsis thaliana chromosome III BAC F2...    48   3e-04   
gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map 10...    48   3e-04   
gb:AE017348_1758146 Cryptococcus neoformans var. neoformans JEC2...    48   4e-04   
gb:AB020742_1514567 Arabidopsis thaliana genomic DNA, chromosome...    48   4e-04   
gb:AE014297_1139487 Drosophila melanogaster chromosome 3R, compl...    48   4e-04   
gb:BC021329_2093374 Mus musculus F-box and leucine-rich repeat p...    47   6e-04   
gb:BC006913_2090478 Mus musculus F-box and leucine-rich repeat p...    47   6e-04   
gb:AF467463_2066642 Mus musculus PPA (Ppa) mRNA, partial cds.          47   6e-04   
sp|Q8BID8|FXLE_MOUSE|FXLE_MOUSE F-box/LRR-repeat protein 14 (F-box and leuc...    47   6e-04   Mus musculus [mouse]
sp|Q8N1E6|FXLE_HUMAN|FXLE_HUMAN F-box/LRR-repeat protein 14 (F-box and leuc...    47   6e-04   Homo sapiens [man]
gb:CR382129_1661907 Yarrowia lipolytica chromosome C of strain C...    47   8e-04   
gb:AY220479_1590513 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    47   8e-04   
gb:AY089649_1297305 Drosophila melanogaster RH06780 full insert ...    47   8e-04   
gb:AE014296_1135872 Drosophila melanogaster chromosome 3L, compl...    47   8e-04   
gb:BC087158_2110046 Rattus norvegicus cDNA clone MGC:95282 IMAGE...    47   0.001   
pir|B85072|B85072 hypothetical protein AT4g07400 [imported] - Ar...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
pir|D96512|D96512 hypothetical protein F2G19.16 [imported] - Ara...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:BC036680_1982003 Homo sapiens F-box and leucine-rich repeat p...    46   0.001   
gb:AE006464_1875628 Homo sapiens 16p13.3 sequence section 3 of 8.      46   0.001   
gb:OSJN00054_1693991 Oryza sativa genomic DNA, chromosome 4, BAC...    46   0.001   
gb:CR382139_1673111 Debaryomyces hansenii chromosome G of strain...    46   0.001   
gb:AK030172_1161864 Mus musculus adult male testis cDNA, RIKEN f...    46   0.001   
gb:BT002473_1636076 Arabidopsis thaliana SKP1 interacting partne...    46   0.002   
gb:AY056152_1563483 Arabidopsis thaliana putative SKP1 interacti...    46   0.002   
gb:AF467462_2496360 Danio rerio PpaB (ppaB) mRNA, partial cds.         45   0.002   
gb:AK117866_1815876 Arabidopsis thaliana At1g77000 mRNA for unkn...    45   0.002   
gb:AC114261_1205586 Dictyostelium discoideum chromosome 2 map 12...    45   0.002   
gb:AY823669_2088564 Rattus norvegicus spinal cord injury and reg...    45   0.003   
pir|T45861|T45861 hypothetical protein F3A4.160 - Arabidopsis th...    45   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:BX649324_2567750 Zebrafish DNA sequence from clone DKEY-85M15...    45   0.004   
gb:BX908798_830310 Parachlamydia-related symbiont UWE25, complet...    45   0.004   
pir|T00403|T00403 hypothetical protein At2g44900 [imported] - Ar...    45   0.004   Arabidopsis thaliana [mouse-ear cress]
pir|T52139|T52139 LRR-containing F-box protein [imported] - Arab...    45   0.004   Arabidopsis thaliana [mouse-ear cress]
pir|T05201|T05201 hypothetical protein F4I10.140 - Arabidopsis t...    44   0.005   Arabidopsis thaliana [mouse-ear cress]
pir|F86261|F86261 F13K23.7 protein - Arabidopsis thaliana>gb:AE0...    44   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:AF139835_1771452 Populus tremula x Populus tremuloides F-box ...    44   0.006   
gb:CR382125_1657482 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.006   
gb:CER05H5_1366508 Caenorhabditis elegans cosmid R05H5, complete...    44   0.006   
gb:AC116979_1207101 Dictyostelium discoideum chromosome 2 map 64...    44   0.006   
pir|T23945|T23945 hypothetical protein T01E8.1 - Caenorhabditis ...    44   0.006   Caenorhabditis elegans [roundworm]
gb:AB016889_1513188 Arabidopsis thaliana genomic DNA, chromosome...    44   0.008   
gb:AF026206_1234219 Caenorhabditis elegans cosmid T28B4, complet...    44   0.008   
gb:AF026206_1234218 Caenorhabditis elegans cosmid T28B4, complet...    44   0.008   
gb:AF026206_1234217 Caenorhabditis elegans cosmid T28B4, complet...    44   0.008   
pir|T32441|T32441 hypothetical protein T28B4.1 - Caenorhabditis ...    44   0.008   Caenorhabditis elegans [roundworm]
gb:AY398381_2531911 Danio rerio clone RK131A2B02 hypothetical pr...    43   0.011   
gb:AF467461_2496359 Danio rerio PpaA (ppaA) mRNA, partial cds.         43   0.011   
gb:AY359238_1948007 Homo sapiens F-box and leucine-rich repeat p...    43   0.011   
pir|T45673|T45673 hypothetical protein F14P22.120 - Arabidopsis ...    43   0.011   Arabidopsis thaliana [mouse-ear cress]
gb:BC077430_2560140 Xenopus laevis F-box leucine-rich repeat pro...    43   0.014   
gb:AC084218_1733375 Oryza sativa (japonica cultivar-group) chrom...    43   0.014   
gb:CR382134_1667309 Debaryomyces hansenii chromosome B of strain...    43   0.014   
pir|E96838|E96838 hypothetical protein T21F11.4 [imported] - Ara...    43   0.014   Arabidopsis thaliana [mouse-ear cress]
gb:BC053821_2550768 Xenopus laevis hypothetical protein MGC64561...    42   0.019   
gb:AP003873_1834620 Oryza sativa (japonica cultivar-group) genom...    42   0.019   
gb:AK117894_1815902 Arabidopsis thaliana At4g33210 mRNA for unkn...    42   0.019   
gb:AC116979_1207102 Dictyostelium discoideum chromosome 2 map 64...    42   0.019   
gb:BX908798_830230 Parachlamydia-related symbiont UWE25, complet...    42   0.019   
pir|T47846|T47846 Arm repeat containing protein-like - Arabidops...    42   0.019   Arabidopsis thaliana [mouse-ear cress]
gb:HSBA18I14_2010886 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:HSBA18I14_2010885 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:HSBA18I14_2010884 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:HSBA18I14_2010883 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:HSBA18I14_2010882 Human DNA sequence from clone RP11-18I14 on...    42   0.024   
gb:CR380959_1654044 Candida glabrata strain CBS138 chromosome M ...    42   0.024   
pir|G96837|G96837 unknown protein T21F11.10 [imported] - Arabido...    42   0.032   Arabidopsis thaliana [mouse-ear cress]
gb:BC031285_1980114 Homo sapiens F-box and leucine-rich repeat p...    41   0.042   
gb:AK097537_1914904 Homo sapiens cDNA FLJ40218 fis, clone TESTI2...    41   0.042   
gb:OSJN00271_1697717 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.042   
gb:ATT6G21_1556302 Arabidopsis thaliana DNA chromosome 5, BAC cl...    41   0.042   
gb:AY359239_1948008 Homo sapiens F-box and leucine-rich repeat p...    41   0.054   
gb:OSJN00275_1697800 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.054   
gb:OSJN00253_1697441 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.054   
gb:AY428737_1605824 Nicotiana tabacum coronatine-insensitive 1 (...    41   0.054   
gb:ATH303346_1552436 Arabidopsis thaliana partial mRNA for hypot...    41   0.054   
pir|E96598|E96598 protein F20N2.2 [imported] - Arabidopsis thali...    41   0.054   Arabidopsis thaliana [mouse-ear cress]
gb:BC016499_2092332 Mus musculus F-box and leucine-rich repeat p...    40   0.071   
gb:AC130602_1740771 Oryza sativa (japonica cultivar-group) chrom...    40   0.071   
gb:CRU303349_1673663 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...    40   0.071   
gb:CR382139_1672396 Debaryomyces hansenii chromosome G of strain...    40   0.071   
gb:AY423549_1605476 Lycopersicon esculentum coronatine-insensiti...    40   0.071   
gb:OSJN00216_1696884 Oryza sativa genomic DNA, chromosome 4, BAC...    40   0.093   
gb:AK085980_1174634 Mus musculus 16 days neonate heart cDNA, RIK...    40   0.093   
gb:AK084845_1174342 Mus musculus 13 days embryo heart cDNA, RIKE...    40   0.093   
gb:AK052175_1169918 Mus musculus 13 days embryo heart cDNA, RIKE...    40   0.093   
gb:AE014134_1127557 Drosophila melanogaster chromosome 2L, compl...    40   0.093   
gb:BC084522_2563893 Xenopus tropicalis hypothetical LOC496536, m...    40   0.12    
gb:BC020572_1977069 Homo sapiens F-box and leucine-rich repeat p...    40   0.12    
gb:AP004159_1838375 Oryza sativa (japonica cultivar-group) genom...    40   0.12    
gb:AP004159_1838374 Oryza sativa (japonica cultivar-group) genom...    40   0.12    
gb:AC084884_1733896 Oryza sativa chromosome 10 clone OSJNBa0031A...    40   0.12    
gb:AY484589_1608337 Musa acuminata clone MuH9, genomic sequence.       40   0.12    
gb:AY168645_1586383 Oryza sativa (japonica cultivar-group) COI1 ...    40   0.12    
gb:AY070039_1566682 Arabidopsis thaliana unknown protein (At5g07...    40   0.12    
gb:AB010070_1510876 Arabidopsis thaliana genomic DNA, chromosome...    40   0.12    
gb:AP004798_1845254 Oryza sativa (japonica cultivar-group) genom...    39   0.16    
gb:AC121489_1740221 Oryza sativa (japonica cultivar-group) chrom...    39   0.16    
gb:LES303342_1684552 Lycopersicon esculentum mRNA for hypothetic...    39   0.16    
gb:CR382122_1655008 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.16    
gb:AC007087_1535212 Arabidopsis thaliana chromosome 2 clone F14N...    39   0.16    
gb:AK029566_1161558 Mus musculus adult male testis cDNA, RIKEN f...    39   0.16    
pir|A85046|A85046 probable nodulin [imported] - Arabidopsis thal...    39   0.21    Arabidopsis thaliana [mouse-ear cress]
gb:AC135205_1742015 Oryza sativa (japonica cultivar-group) chrom...    39   0.27    
gb:AC099399_1737109 Oryza sativa (japonica cultivar-group) chrom...    39   0.27    
pir|T48087|T48087 transport inhibitor response protein TIR1 [imp...    39   0.27    Arabidopsis thaliana [mouse-ear cress]
gb:BC020575_1977070 Homo sapiens F-box and leucine-rich repeat p...    38   0.35    
gb:AK095387_1914352 Homo sapiens cDNA FLJ38068 fis, clone CTONG2...    38   0.35    
gb:AE016817_1747445 Ashbya gossypii (= Eremothecium gossypii) AT...    38   0.35    
gb:HSM803079_1186896 Homo sapiens mRNA; cDNA DKFZp434L2422 (from...    38   0.35    
sp|P24814|GRR1_YEAST|GRR1_YEAST Ubiquitin ligase complex F-box protein GRR1...    38   0.35    Saccharomyces cerevisiae [brewer's yeast]
gb:AP004586_1841932 Oryza sativa (japonica cultivar-group) genom...    38   0.46    
gb:CR382132_1665004 Yarrowia lipolytica chromosome F of strain C...    38   0.46    
gb:CR382122_1655229 Kluyveromyces lactis strain NRRL Y-1140 chro...    38   0.46    
gb:AB025621_1516430 Arabidopsis thaliana genomic DNA, chromosome...    38   0.46    
gb:AE017329_444476 Listeria monocytogenes str. 4b F2365, section...    38   0.46    
pir|B85069|B85069 hypothetical protein AT4g05500 [imported] - Ar...    38   0.46    Arabidopsis thaliana [mouse-ear cress]
pir|H86453|H86453 avr9 homolog F9L11.10 [imported] - Arabidopsis...    38   0.46    Arabidopsis thaliana [mouse-ear cress]
sp|O13695|YEN1_SCHPO|YEN1_SCHPO Hypothetical serine-rich protein C11G7.01 i...    38   0.46    Schizosaccharomyces pombe
gb:AC145780_1744491 Oryza sativa chromosome 3 BAC OSJNBb0069P02 ...    37   0.60    
gb:AY069367_1294097 Drosophila melanogaster LD07444 full length ...    37   0.60    
gb:BX908798_831011 Parachlamydia-related symbiont UWE25, complet...    37   0.60    
gb:AP005295_1850048 Oryza sativa (japonica cultivar-group) genom...    37   0.79    
gb:OSJN00275_1697802 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.79    
gb:CR382131_1663636 Yarrowia lipolytica chromosome E of strain C...    37   0.79    
gb:AB025621_1516429 Arabidopsis thaliana genomic DNA, chromosome...    37   0.79    
sp|O74783|POF2_SCHPO|POF2_SCHPO F-box/LRR-repeat protein 2 (F-box and leuci...    37   0.79    Schizosaccharomyces pombe
gb:OSJN00053_1693973 Oryza sativa genomic DNA, chromosome 4, BAC...    37   1.0     
gb:CR382134_1667128 Debaryomyces hansenii chromosome B of strain...    37   1.0     
gb:BC084456_2563830 Xenopus tropicalis hypothetical LOC496483, m...    36   1.3     
gb:AC005250_1874894 Homo sapiens BAC clone CTA-318M5 from 7, com...    36   1.3     
gb:AP005295_1850049 Oryza sativa (japonica cultivar-group) genom...    36   1.3     
gb:AP004746_1844284 Oryza sativa (japonica cultivar-group) genom...    36   1.3     
gb:AP004560_1841592 Oryza sativa (japonica cultivar-group) genom...    36   1.3     
gb:AF536527_1809667 Glycine max putative coronatine-insensitive ...    36   1.3     
gb:T1J24_1723616 Arabidopsis thaliana BAC T1J24.                       36   1.3     
gb:CR382130_1663187 Yarrowia lipolytica chromosome D of strain C...    36   1.3     
gb:BX908798_829820 Parachlamydia-related symbiont UWE25, complet...    36   1.3     
gb:AE016818_1748541 Ashbya gossypii (= Eremothecium gossypii) AT...    36   1.7     
pir|B84547|B84547 hypothetical protein At2g17020 [imported] - Ar...    36   1.7     Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00216_1696873 Oryza sativa genomic DNA, chromosome 4, BAC...    35   2.3     
gb:AY045799_1561315 Arabidopsis thaliana putative F-box protein ...    35   2.3     
gb:BX908798_830697 Parachlamydia-related symbiont UWE25, complet...    35   2.3     
pir|H85068|H85068 N7-like protein [imported] - Arabidopsis thali...    35   2.3     Arabidopsis thaliana [mouse-ear cress]
pir|E85040|E85040 hypothetical protein AT4g03190 [imported] - Ar...    35   2.3     Arabidopsis thaliana [mouse-ear cress]
gb:AP004740_1844148 Oryza sativa (japonica cultivar-group) genom...    35   3.0     
gb:AP003488_1829887 Oryza sativa (japonica cultivar-group) genom...    35   3.0     
gb:AF291816_1783718 Arabidopsis thaliana GRR1-like protein 1 (GR...    35   3.0     
gb:AC149287_1744901 Solanum demissum chromosome 5 clone PGEC568D...    35   3.0     
gb:AC114474_1739151 Genomic sequence for Oryza sativa, Nipponbar...    35   3.0     
gb:AC092748_1735594 Genomic sequence for Oryza sativa, Nipponbar...    35   3.0     
gb:AE016959_1022269 Oryza sativa (japonica cultivar-group) chrom...    35   3.0     
sp|Q12196|RIO1_YEAST|RIO1_YEAST RIO1 protein.>pir|S61006|S61006 RIO1 protei...    35   3.0     Saccharomyces cerevisiae [brewer's yeast]
gb:BC072202_2556461 Xenopus laevis hypothetical protein MGC81139...    35   3.9     
gb:AY057563_1563980 Arabidopsis thaliana AT5g56420/MCD7_18 mRNA,...    35   3.9     
gb:AB009049_1510609 Arabidopsis thaliana genomic DNA, chromosome...    35   3.9     
gb:BTA518953_1436722 Bos taurus partial fbxl6 gene for F-box and...    35   3.9     
gb:AE014298_1125616 Drosophila melanogaster chromosome X, comple...    35   3.9     
pir|F85090|F85090 hypothetical protein AT4g08980 [imported] - Ar...    35   3.9     Arabidopsis thaliana [mouse-ear cress]
gb:AK095556_1914384 Homo sapiens cDNA FLJ38237 fis, clone FCBBF2...    34   5.1     
gb:AP003898_1834962 Oryza sativa (japonica cultivar-group) genom...    34   5.1     
gb:AC151815_1745152 Solanum demissum chromosome 5 clone PGEC472P...    34   5.1     
gb:AC149301_1744993 Solanum demissum chromosome 5 clone PGEC517A...    34   5.1     
gb:CR380954_1651382 Candida glabrata strain CBS138 chromosome H ...    34   5.1     
gb:AP005388_1850873 Oryza sativa (japonica cultivar-group) genom...    34   6.6     
gb:AF454544_1801103 Pichia angusta strain DL-1 GTP-binding prote...    34   6.6     
gb:AC137616_1743611 Oryza sativa (japonica cultivar-group) chrom...    34   6.6     
gb:AE016959_1020915 Oryza sativa (japonica cultivar-group) chrom...    34   6.6     
pir|AH1447|AH1447 probable tape-measure (Bacteriophage A118) lin...    34   6.6     Listeria innocua
pir|D75503|D75503 hypothetical protein - Deinococcus radiodurans...    34   6.6     Deinococcus radiodurans
gb:AX647483_1472367 Sequence 1675 from Patent EP1270724.               21   7.8     
gb:AP004746_1844280 Oryza sativa (japonica cultivar-group) genom...    33   8.7     
gb:CR382131_1663816 Yarrowia lipolytica chromosome E of strain C...    33   8.7     
gb:AE017323_442929 Listeria monocytogenes str. 4b F2365, section...    33   8.7     
gb:AE016762_326473 Escherichia coli CFT073 section 8 of 18 of th...    33   8.7     


>pir|A84649|A84649 probable glucose regulated repressor protein
            [imported] - Arabidopsis thaliana>gb:AC006300_1534039
            Arabidopsis thaliana chromosome 2 clone F13B15 map mi238,
            complete sequence.>gb:AY072205_1567093 Arabidopsis
            thaliana putative F-box protein family, AtFBL6
            (At2g25490) mRNA, complete cds.>gb:AY091333_1574537
            Arabidopsis thaliana unknown protein (At2g25490) mRNA,
            complete cds.>gb:AJ609238_1811998 Arabidopsis thaliana
            mRNA for F-box protein (ebf1 gene).
          Length = 628

 Score =  256 bits (655), Expect = 5e-67
 Identities = 151/274 (55%), Positives = 183/274 (66%), Gaps = 6/274 (2%)
 Frame = +1

Query: 388  MSKLLEFSGGDDFC------PSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVD 549
            MS++  F+G +DF       P+P D+ L LSLG   DVYFP  KRSR+ AP +FS     
Sbjct: 1    MSQIFSFAGENDFYRRGAIYPNPKDASLLLSLGSFADVYFPPSKRSRVVAPTIFSAF--- 57

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            EKK  SI+VLPDECLFEIFRRL  G QERSACA VSK+WL L+S+I + E+         
Sbjct: 58   EKKPVSIDVLPDECLFEIFRRLS-GPQERSACAFVSKQWLTLVSSIRQKEID-------- 108

Query: 730  EPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIA 909
                                    V S ++E  D ++ +G LSR LDGKKATDVRLAAIA
Sbjct: 109  ------------------------VPSKITE--DGDDCEGCLSRSLDGKKATDVRLAAIA 142

Query: 910  VGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            VGTA RGGLGKLSIRG+NS + V+D GL++IGR CPSL +LSLWN+S+I+D GL EIA G
Sbjct: 143  VGTAGRGGLGKLSIRGSNSAK-VSDLGLRSIGRSCPSLGSLSLWNVSTITDNGLLEIAEG 201

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            C QLEKL+L +C  ITDK L+AIAKSCPNL  +T
Sbjct: 202  CAQLEKLELNRCSTITDKGLVAIAKSCPNLTELT 235



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 26/80 (32%), Positives = 41/80 (51%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL KL+     + +GVTD GL+++G+GCP+++   +     +SD GL   A     LE L
Sbjct: 333  GLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASLSLESL 392

Query: 1111 DLCQCPGITDKSLMAIAKSC 1170
             L +C  +T         +C
Sbjct: 393  QLEECHRVTQFGFFGSLLNC 412



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 2/84 (2%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC--HQLEK 1107
            L KL ++  N    VTD  L  +G    S+  L L  +S +S++G + + +G    +L  
Sbjct: 284  LAKLKLQMLN----VTDVSLAVVGHYGLSITDLVLAGLSHVSEKGFWVMGNGVGLQKLNS 339

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L +  C G+TD  L ++ K CPN+
Sbjct: 340  LTITACQGVTDMGLESVGKGCPNM 363



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 26/68 (38%), Positives = 36/68 (52%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S R +T +GL A    C +LR+LS+ N     D  L  I   C QLE +DLC   GIT+ 
Sbjct: 426  SIRDLT-TGLPASSH-CSALRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITES 483

Query: 1144 SLMAIAKS 1167
              + + +S
Sbjct: 484  GFLHLIQS 491



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            TD  ++AI   TAR G    L +   +    +TD+ L +I   C  L  L + +  +ISD
Sbjct: 505  TDRVISAI---TARNGWT--LEVLNIDGCSNITDASLVSIAANCQILSDLDI-SKCAISD 558

Query: 1063 EGLFEIASGCH-QLEKLDLCQCPGITDKSLMAI 1158
             G+  +AS    +L+ L +  C  +TDKSL AI
Sbjct: 559  SGIQALASSDKLKLQILSVAGCSMVTDKSLPAI 591



>gb:AY485830_1608507 Arabidopsis thaliana EIN3-binding F-box protein 2
            (EBF2) mRNA, complete cds.>gb:AJ609239_1811999
            Arabidopsis thaliana mRNA for F-box protein (ebf2 gene).
          Length = 623

 Score =  238 bits (607), Expect = 2e-61
 Identities = 138/268 (51%), Positives = 169/268 (63%)
 Frame = +1

Query: 388  MSKLLEFSGGDDFCPSPMDSILFLSLGHQVDVYFPSRKRSRINAPFVFSGEKVDEKKQAS 567
            MS +  FSG +D     +   ++LS G    VY+P+RKR R+ A   +SG    E+KQ S
Sbjct: 1    MSGIFRFSGDEDCL---LGGSMYLSPGSCPGVYYPARKRLRVAATSFYSGF---EEKQTS 54

Query: 568  IEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGD 747
            I+VLP+ECLFEI RRLP  GQERSACA VSK WL LLS+I R E+               
Sbjct: 55   IDVLPEECLFEILRRLP-SGQERSACACVSKHWLNLLSSISRSEV--------------- 98

Query: 748  NATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARR 927
                                 N S VQD EEG+GFLSR L+GKKATD+RLAAIAVGT+ R
Sbjct: 99   ---------------------NESSVQDVEEGEGFLSRSLEGKKATDLRLAAIAVGTSSR 137

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGLGKL IRG+     VTD GL A+  GCPSLR +SLWN+ ++SD GL EIA  C  +EK
Sbjct: 138  GGLGKLQIRGSGFESKVTDVGLGAVAHGCPSLRIVSLWNLPAVSDLGLSEIARSCPMIEK 197

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            LDL +CPGITD  L+AIA++C NL+ +T
Sbjct: 198  LDLSRCPGITDSGLVAIAENCVNLSDLT 225



 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 32/80 (40%), Positives = 42/80 (52%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL KL      S RG+TD GL+A+G GCP L+ +SL     +S +GL  +A     LE L
Sbjct: 323  GLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESL 382

Query: 1111 DLCQCPGITDKSLMAIAKSC 1170
             L +C  I    LM    +C
Sbjct: 383  KLEECHRINQFGLMGFLMNC 402



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 2/78 (2%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIG--RGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            +  +GV + G   +G  +G   L++LS+ +   ++D GL  + +GC  L+ + L +C  +
Sbjct: 305  HGLQGVNEKGFWVMGNAKGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLV 364

Query: 1135 TDKSLMAIAKSCPNLASV 1188
            + K L+A+AKS  +L S+
Sbjct: 365  SGKGLVALAKSALSLESL 382



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
            C SLR+LS+       D  L  +   CHQL+ ++LC   G+TD  +  + +S
Sbjct: 431  CSSLRSLSIRCCPGFGDASLAFLGKFCHQLQDVELCGLNGVTDAGVRELLQS 482



>pir|T08604|T08604 hypothetical protein GRR1 -
            soybean>gb:AF019910_1761610 Glycine max grr1 (grr1) mRNA,
            complete cds.
          Length = 690

 Score =  230 bits (587), Expect = 4e-59
 Identities = 122/220 (55%), Positives = 149/220 (67%)
 Frame = +1

Query: 532  SGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTI 711
            +G      ++ SIE LPDECLFEI RRLP G Q+RS CA VSKRWLMLLS+IC+ E+ + 
Sbjct: 98   NGLSRSRSQRTSIESLPDECLFEILRRLPAG-QDRSVCASVSKRWLMLLSSICKTEIHSY 156

Query: 712  KSGEASEPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDV 891
             S      E  D                                +G+LSR L+GKKATDV
Sbjct: 157  GSTGNENQEISD--------------------------------EGYLSRSLEGKKATDV 184

Query: 892  RLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGL 1071
            RLAAIAVGTA RGGLGKL+IRG NS RGVT+ GLKAI  GCPSL+  SLW+++++ D GL
Sbjct: 185  RLAAIAVGTASRGGLGKLTIRGCNSDRGVTNVGLKAIAHGCPSLKVCSLWDVATVGDVGL 244

Query: 1072 FEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
             EIASGCHQLEKLDLC+CP I+DK+L+A+AK+CPNLA ++
Sbjct: 245  IEIASGCHQLEKLDLCKCPNISDKTLIAVAKNCPNLAELS 284



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL KL+    N  +GVTD GL+ IGRGCP+++ L L   + +SD+GL   A     +E L
Sbjct: 381  GLQKLTSITINCCQGVTDVGLEPIGRGCPNVQNLKLRKSAFLSDKGLVSFARAAPSVESL 440

Query: 1111 DLCQ-CPGITDKSLMAIAKSC 1170
             L +    IT   L  +  +C
Sbjct: 441  QLAKSAHRITQIGLFGVFFNC 461



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 35/98 (35%), Positives = 47/98 (47%), Gaps = 6/98 (6%)
 Frame = +1

Query: 913  GTARRGGLGKLSIRGNN----SFRGVTDSG-LKAIGRGCPSLRALSLWNISSISDEGLFE 1077
            G A    LGKL  R  +      +GVTD+G L  +      L  ++L    ++SD  +  
Sbjct: 504  GNANLALLGKLCPRLQHVELSGLQGVTDAGFLPLLESSEAGLVKVNLNGCVNLSDRVVLS 563

Query: 1078 IA-SGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            +  S    LE L L  C  + D SLMAIA SCP LA +
Sbjct: 564  MVNSHGWTLEVLSLDGCKRVGDASLMAIAGSCPLLADL 601



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 19/73 (26%), Positives = 40/73 (54%), Gaps = 2/73 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGR--GCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            V++ G   +G   G   L ++++     ++D GL  I  GC  ++ L L +   ++DK L
Sbjct: 368  VSEKGFWVMGNAHGLQKLTSITINCCQGVTDVGLEPIGRGCPNVQNLKLRKSAFLSDKGL 427

Query: 1150 MAIAKSCPNLASV 1188
            ++ A++ P++ S+
Sbjct: 428  VSFARAAPSVESL 440



>gb:AP004869_1846301 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0419A09.
          Length = 660

 Score =  182 bits (461), Expect = 2e-44
 Identities = 108/241 (44%), Positives = 149/241 (61%), Gaps = 9/241 (3%)
 Frame = +1

Query: 496  RKRSRINAPFVFSGEKV--------DEKKQASIEVLPDECLFEIFRRLPVGGQERSACAG 651
            RKRS + A  V + + V         +++  S++ LPDECLFE+ RRLP GG+ER A A 
Sbjct: 36   RKRSLVAASAVAAADCVVRAAKRQRQQRQPPSLDALPDECLFEVLRRLP-GGRERGASAC 94

Query: 652  VSKRWLMLLSTICRDELSTIKSGEASEPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQD 831
            VS+RWL LL +I   EL+   +  A+         A  P L   D  + FV     E ++
Sbjct: 95   VSRRWLALLCSIRASELNQATAAAAA---------AAPPSL--PDLNEEFVMEEDDEEEE 143

Query: 832  NEEG-DGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGR 1008
            +    D  + R L+GK+ATDVRLAA+AV    R GL KL++RG++  RGVTD GL A+ R
Sbjct: 144  SSPVVDPCVERVLEGKEATDVRLAAMAVVAGSRRGLEKLAVRGSHPTRGVTDRGLLAVAR 203

Query: 1009 GCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            G P+L +L+LW++  ++D GL EIA+GC  LE+LD+ +CP ITDK L A+A  CPNL S+
Sbjct: 204  GSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNLLSL 263

Query: 1189 T 1191
            T
Sbjct: 264  T 264



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 37/108 (34%), Positives = 48/108 (44%), Gaps = 8/108 (7%)
 Frame = +1

Query: 871  GKKATDVRLAAIAVGTARRG--------GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            GK  TD+ L  + V  A RG        GL  L      S  GVT+  L AI + CPSLR
Sbjct: 335  GKAVTDLTLVRLPV-VAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLR 393

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
             LS      ++D GL         LE L L +C G+T   ++    +C
Sbjct: 394  QLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNC 441



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 2/88 (2%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS--GCHQLEK 1107
            L K+ ++G N    +TD+ L  IG    ++  L+L  +  +++ G + +A+  G   L  
Sbjct: 313  LTKIRLQGLN----ITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRC 368

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            + +  CPG+T+ +L AIAK CP+L  ++
Sbjct: 369  MSVTSCPGVTNLALAAIAKFCPSLRQLS 396



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +1

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH-QLEKLDLCQCPGITDKSLMA 1155
            TD+ L  +G  CP L  + L  +  ++D GL  + +     L K+DL  C  ITD ++  
Sbjct: 484  TDASLAVVGMVCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVST 543

Query: 1156 IAK 1164
            + K
Sbjct: 544  LVK 546



>gb:AP003629_1831741 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0481H08.
          Length = 627

 Score =  134 bits (337), Expect = 4e-30
 Identities = 88/220 (40%), Positives = 120/220 (54%), Gaps = 3/220 (1%)
 Frame = +1

Query: 538  EKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKS 717
            ++  +++  S++ LPDECLFEI RR+  G + R A A VS+RWL LL  I   E+     
Sbjct: 67   QQQQQREAPSLDALPDECLFEILRRVK-GARARCASAAVSRRWLALLGGIRSSEIKR--- 122

Query: 718  GEASEPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEE--GDGFLS-RCLDGKKATD 888
                EP     A A  P+L        FV  +  E  + E   G G  S RCL+G++ATD
Sbjct: 123  ----EP-----AAAAVPDL-----NQVFVDEDEEEEDEFEVPLGGGCSSERCLEGREATD 168

Query: 889  VRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEG 1068
            V L A+AV  A RG L  L IRG++  RGVTD+G+ A  RGCPSL +L+LW+        
Sbjct: 169  VGLMAVAVADALRGSLESLVIRGSHPTRGVTDAGISAAARGCPSLLSLALWH-------- 220

Query: 1069 LFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
               +  GC  L+ + +  CPG+ D+ L AI + C  L SV
Sbjct: 221  ---VPQGCPDLKVVTVEACPGVADEGLKAIGRCCAKLQSV 257



 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/107 (35%), Positives = 53/107 (49%), Gaps = 7/107 (6%)
 Frame = +1

Query: 871  GKKATDVRLAAI-AVGT------ARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRA 1029
            GK  TD+ LA + AVG       A   GL KL     +S  GVTD  L +I + CPSL+ 
Sbjct: 303  GKAITDLTLARLPAVGERGFWVMANALGLQKLRFMSVSSCPGVTDLALASIAKFCPSLKQ 362

Query: 1030 LSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            L+L     +SD  L + A     LE L + +C  +T   ++A   +C
Sbjct: 363  LNLKKCGQVSDGRLKDFAESAKVLESLQIEECNKVTLMGILAFLLNC 409



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 26/84 (30%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS--GCHQLEK 1107
            L K+ ++G +    +TD+ L  IG    ++  L+L  + ++ + G + +A+  G  +L  
Sbjct: 281  LAKVRLQGLS----ITDASLSVIGYYGKAITDLTLARLPAVGERGFWVMANALGLQKLRF 336

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            + +  CPG+TD +L +IAK CP+L
Sbjct: 337  MSVSSCPGVTDLALASIAKFCPSL 360



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 28/100 (28%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEI------------ASGCH------- 1095
            G TD+ L  +G  CP L  + L  + +++D GL  +             +GC        
Sbjct: 450  GFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKSSESGLVHVDLNGCENLTDATV 509

Query: 1096 ---------QLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                      L +L L  C  ITD SL AI++ C +LA +
Sbjct: 510  SALVKAHGSSLARLSLEGCSRITDASLFAISEGCTDLAEL 549



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 1/80 (1%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GL  + + G  +    T S L KA G    SL  LSL   S I+D  LF I+ GC  L +
Sbjct: 492  GLVHVDLNGCENLTDATVSALVKAHGS---SLARLSLEGCSRITDASLFAISEGCTDLAE 548

Query: 1108 LDLCQCPGITDKSLMAIAKS 1167
            LDL  C  ++D  +  +A +
Sbjct: 549  LDLSNCM-VSDYGVAVLASA 567



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
            C SLR+L++ +    +D  L  +   C QLE +DL     +TD  L+ + KS
Sbjct: 437  CKSLRSLTIKDCPGFTDASLAVVGMICPQLENVDLSGLGAVTDNGLLPLIKS 488



>gb:AP004869_1846300 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0419A09.
          Length = 511

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 34/64 (53%), Positives = 48/64 (75%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            + RG P+L +L+LW++  ++D GL EIA+GC  LE+LD+ +CP ITDK L A+A  CPNL
Sbjct: 52   VARGSPNLCSLALWDVPLVTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNL 111

Query: 1180 ASVT 1191
             S+T
Sbjct: 112  LSLT 115



 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 28/71 (39%), Positives = 40/71 (56%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD+GL  I  GCPSL  L +     I+D+GL  +A GC  L  L +  C G+ +  L A
Sbjct: 70   VTDAGLAEIAAGCPSLERLDITRCPLITDKGLAAVAHGCPNLLSLTVESCSGVGNDGLRA 129

Query: 1156 IAKSCPNLASV 1188
            I +SC  + ++
Sbjct: 130  IGRSCSKIQAL 140



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 37/108 (34%), Positives = 48/108 (44%), Gaps = 8/108 (7%)
 Frame = +1

Query: 871  GKKATDVRLAAIAVGTARRG--------GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            GK  TD+ L  + V  A RG        GL  L      S  GVT+  L AI + CPSLR
Sbjct: 186  GKAVTDLTLVRLPV-VAERGFWVMANAAGLQNLRCMSVTSCPGVTNLALAAIAKFCPSLR 244

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
             LS      ++D GL         LE L L +C G+T   ++    +C
Sbjct: 245  QLSFRKCGHMTDAGLKAFTESARLLESLQLEECNGVTLVGILDFLVNC 292



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 33/103 (32%), Positives = 54/103 (52%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            TD  LA IA G      L +L I        +TD GL A+  GCP+L +L++ + S + +
Sbjct: 71   TDAGLAEIAAGCP---SLERLDI---TRCPLITDKGLAAVAHGCPNLLSLTVESCSGVGN 124

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            +GL  I   C +++ L++  C  I D+ + ++   C   AS+T
Sbjct: 125  DGLRAIGRSCSKIQALNIKNCARIGDQGISSLV--CSATASLT 165



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 2/88 (2%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS--GCHQLEK 1107
            L K+ ++G N    +TD+ L  IG    ++  L+L  +  +++ G + +A+  G   L  
Sbjct: 164  LTKIRLQGLN----ITDASLALIGYYGKAVTDLTLVRLPVVAERGFWVMANAAGLQNLRC 219

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            + +  CPG+T+ +L AIAK CP+L  ++
Sbjct: 220  MSVTSCPGVTNLALAAIAKFCPSLRQLS 247



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +1

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH-QLEKLDLCQCPGITDKSLMA 1155
            TD+ L  +G  CP L  + L  +  ++D GL  + +     L K+DL  C  ITD ++  
Sbjct: 335  TDASLAVVGMVCPYLEQVDLSGLREVTDRGLLPLINSSEGGLVKVDLSGCKNITDAAVST 394

Query: 1156 IAK 1164
            + K
Sbjct: 395  LVK 397



>gb:AP003227_1825684 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0018C10.>gb:AP003561_1830785 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1065E10.
          Length = 379

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 39/97 (40%), Positives = 62/97 (63%)
 Frame = +1

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFE 1077
            AA+A  +++   L  L++ G    R V+D  L+AI   C  L++L+L    S++D+G+  
Sbjct: 173  AALAYLSSQCKNLKCLNLCG--CVRAVSDRALQAIACNCGQLQSLNLGWCDSVTDKGVTS 230

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            +ASGC +L  LDLC C  ITD+S++A+A  CP+L S+
Sbjct: 231  LASGCPELRALDLCGCVLITDESVVALANGCPHLRSL 267



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 38/111 (34%), Positives = 58/111 (52%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            L+ C   +  +D  L AIA      G L  L++   +S   VTD G+ ++  GCP LRAL
Sbjct: 188  LNLCGCVRAVSDRALQAIACNC---GQLQSLNLGWCDS---VTDKGVTSLASGCPELRAL 241

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLAS 1185
             L     I+DE +  +A+GC  L  L L  C  ITD+++ ++A +   + S
Sbjct: 242  DLCGCVLITDESVVALANGCPHLRSLGLYYCQNITDRAMYSLAANSRRVRS 292



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC-PGI 1134
            + SFR ++D  L A+  GCP L  L++   S+ SD  L  ++S C  L+ L+LC C   +
Sbjct: 139  SRSFR-LSDRSLYALAHGCPHLTRLNISGCSNFSDAALAYLSSQCKNLKCLNLCGCVRAV 197

Query: 1135 TDKSLMAIAKSCPNLASV 1188
            +D++L AIA +C  L S+
Sbjct: 198  SDRALQAIACNCGQLQSL 215



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 22/66 (33%), Positives = 35/66 (53%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            DS ++A+   C  LR L L     +SD  L+ +A GC  L +L++  C   +D +L  ++
Sbjct: 120  DSAVEAVANNCHDLRELDLSRSFRLSDRSLYALAHGCPHLTRLNISGCSNFSDAALAYLS 179

Query: 1162 KSCPNL 1179
              C NL
Sbjct: 180  SQCKNL 185



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +1

Query: 1021 LRALSLWNIS-SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            L+ LSL  I   + D  +  +A+ CH L +LDL +   ++D+SL A+A  CP+L
Sbjct: 106  LQVLSLRQIKPQLEDSAVEAVANNCHDLRELDLSRSFRLSDRSLYALAHGCPHL 159



>gb:AC135419_1742238 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0044P19, complete sequence.
          Length = 376

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 32/73 (43%), Positives = 48/73 (65%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +  TD  L+AI R C  L++L+L     ++D+G+  +ASGC  L  LDLC C  ITD+S+
Sbjct: 195  KAATDRALQAIARNCGQLQSLNLGWCEDVTDKGVTSLASGCPDLRALDLCGCVLITDESV 254

Query: 1150 MAIAKSCPNLASV 1188
            +A+A  CP+L S+
Sbjct: 255  IALATGCPHLRSL 267



 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 40/105 (38%), Positives = 54/105 (51%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            L+ C  GK ATD  L AIA         G+L          VTD G+ ++  GCP LRAL
Sbjct: 188  LNLCGCGKAATDRALQAIA------RNCGQLQSLNLGWCEDVTDKGVTSLASGCPDLRAL 241

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
             L     I+DE +  +A+GC  L  L L  C  ITD+++ ++A S
Sbjct: 242  DLCGCVLITDESVIALATGCPHLRSLGLYYCQNITDRAMYSLANS 286



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC-PGI 1134
            + SFR ++D  L A+ RGCP L  L++   S+ SD  L  +   C   + L+LC C    
Sbjct: 139  SRSFR-LSDRSLYALARGCPQLTKLNISGCSNFSDTALTYLTFHCKNFKCLNLCGCGKAA 197

Query: 1135 TDKSLMAIAKSCPNLASV 1188
            TD++L AIA++C  L S+
Sbjct: 198  TDRALQAIARNCGQLQSL 215



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            DS ++A+   C  LR L L     +SD  L+ +A GC QL KL++  C   +D +L  + 
Sbjct: 120  DSAVEAVSNYCHDLRELDLSRSFRLSDRSLYALARGCPQLTKLNISGCSNFSDTALTYLT 179

Query: 1162 KSCPN 1176
              C N
Sbjct: 180  FHCKN 184



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 17/49 (34%), Positives = 30/49 (61%)
 Frame = +1

Query: 1042 NISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            NI  + D  +  +++ CH L +LDL +   ++D+SL A+A+ CP L  +
Sbjct: 114  NIPQLEDSAVEAVSNYCHDLRELDLSRSFRLSDRSLYALARGCPQLTKL 162



>gb:AY085898_1570961 Arabidopsis thaliana clone 19486 mRNA, complete
            sequence.
          Length = 360

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 53/161 (32%), Positives = 80/161 (49%), Gaps = 24/161 (14%)
 Frame = +1

Query: 778  KSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRG 957
            K   +D  V++  +   + +E D  LS+ L   K TD  L A+A G      L KL++ G
Sbjct: 101  KPQLEDNAVEAIANHCHELQELD--LSKSL---KITDRSLYALAHGCP---DLTKLNLSG 152

Query: 958  NNSF------------------------RGVTDSGLKAIGRGCPSLRALSLWNISSISDE 1065
              SF                        + VTD+ L+AIG  C  +++L+L    +ISD+
Sbjct: 153  CTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDD 212

Query: 1066 GLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            G+  +A GC  L  LDLC C  ITD+S++A+A  C +L S+
Sbjct: 213  GVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSL 253



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 23/64 (35%), Positives = 37/64 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D G+ ++  GCP LR L L     I+DE +  +A  C  L  L L  C  ITD+++ +
Sbjct: 209  ISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYYCRNITDRAIYS 268

Query: 1156 IAKS 1167
            +A+S
Sbjct: 269  LAQS 272



>pir|B86347|B86347 hypothetical protein F24J8.5 [imported] -
            Arabidopsis thaliana>gb:AE005172_891093 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC015447_1537996 Arabidopsis thaliana
            chromosome I BAC F24J8 genomic sequence, complete
            sequence.>gb:AY058081_1564220 Arabidopsis thaliana
            At1g21410/F24J8_17 mRNA, complete
            cds.>gb:AY090308_1574060 Arabidopsis thaliana
            At1g21410/F24J8_17 mRNA, complete cds.
          Length = 360

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 53/161 (32%), Positives = 80/161 (49%), Gaps = 24/161 (14%)
 Frame = +1

Query: 778  KSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRG 957
            K   +D  V++  +   + +E D  LS+ L   K TD  L A+A G      L KL++ G
Sbjct: 101  KPQLEDNAVEAIANHCHELQELD--LSKSL---KITDRSLYALAHGCP---DLTKLNLSG 152

Query: 958  NNSF------------------------RGVTDSGLKAIGRGCPSLRALSLWNISSISDE 1065
              SF                        + VTD+ L+AIG  C  +++L+L    +ISD+
Sbjct: 153  CTSFSDTAIAYLTRFCRKLKVLNLCGCVKAVTDNALEAIGNNCNQMQSLNLGWCENISDD 212

Query: 1066 GLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            G+  +A GC  L  LDLC C  ITD+S++A+A  C +L S+
Sbjct: 213  GVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSL 253



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 23/64 (35%), Positives = 37/64 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D G+ ++  GCP LR L L     I+DE +  +A  C  L  L L  C  ITD+++ +
Sbjct: 209  ISDDGVMSLAYGCPDLRTLDLCGCVLITDESVVALADWCVHLRSLGLYYCRNITDRAMYS 268

Query: 1156 IAKS 1167
            +A+S
Sbjct: 269  LAQS 272



>gb:AY463017_1607670 Musa acuminata putative F-box protein family
            mRNA, partial cds.
          Length = 164

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 32/44 (72%), Positives = 35/44 (79%)
 Frame = +1

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            D GL EIA GC  LEKLDLCQCP ITDK L+A+AK CPNL S+T
Sbjct: 1    DAGLSEIADGCPLLEKLDLCQCPLITDKVLVAVAKKCPNLTSLT 44



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK---S 1146
            +TD  L A+ + CP+L +L++ + ++I +EGL  I   C +L+ L +  C  + D+   S
Sbjct: 25   ITDKVLVAVAKKCPNLTSLTIESCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVS 84

Query: 1147 LMAIAKSC 1170
            L++ A SC
Sbjct: 85   LVSSASSC 92



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEI---ASGCHQLEKLDLCQCPGI 1134
            S   + + GL+ IGR CP L++L++ +   + D+G+  +   AS C +  KL      GI
Sbjct: 47   SCANICNEGLQVIGRSCPKLKSLTIKDCLHVGDQGIVSLVSSASSCLERIKLQALNISGI 106



>gb:BC077969_2560613 Xenopus laevis MGC81000 protein, mRNA (cDNA clone
            MGC:81000 IMAGE:5543149), complete cds.
          Length = 436

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 33/83 (39%), Positives = 48/83 (57%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL     +    +TDS L A+G+ CP LR L +   S ++D G   +A  CH+LEK+
Sbjct: 245  GCHKLQSLCASGCANITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKNCHELEKM 304

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
            DL +C  ITD +L+ ++  CP L
Sbjct: 305  DLEECVQITDSTLIQLSIHCPRL 327



 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 36/84 (42%), Positives = 46/84 (54%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL  LS++G        D  LK IG  CP L  L+L   S I+D+GL  I  GCH+L+ 
Sbjct: 195  GGLRLLSLKGCTQLE---DEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQS 251

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L    C  ITD  L A+ ++CP L
Sbjct: 252  LCASGCANITDSILNALGQNCPRL 275



 Score = 56.6 bits (135), Expect = 1e-06
 Identities = 31/84 (36%), Positives = 47/84 (55%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV D+ L+   + C ++  L+L   + I+D     ++  C +L +
Sbjct: 91   GFLRKLSLRG---CLGVGDNALRTFAQNCRNIEVLNLNGCTKITDTTSTSLSKFCSKLRQ 147

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL AI++ CP L
Sbjct: 148  LDLASCTSITNLSLKAISEGCPQL 171



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 27/71 (38%), Positives = 40/71 (56%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++  G++A+ +GC  LR LSL   + + DE L  I S C +L  L+L  C  ITD  L+ 
Sbjct: 182  ISKDGVQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLIT 241

Query: 1156 IAKSCPNLASV 1188
            I + C  L S+
Sbjct: 242  ICRGCHKLQSL 252



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 26/75 (34%), Positives = 38/75 (50%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   +T+  LKAI  GCP L  L++     IS +G+  +  GC  L  L L  C  + D+
Sbjct: 152  SCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGVQALVKGCGGLRLLSLKGCTQLEDE 211

Query: 1144 SLMAIAKSCPNLASV 1188
            +L  I   CP L ++
Sbjct: 212  ALKFIGSHCPELVTL 226



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/73 (32%), Positives = 40/73 (54%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TD+   ++ + C  LR L L + +SI++  L  I+ GC QLE+L++  C  I+ 
Sbjct: 125  NGCTKITDTTSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISK 184

Query: 1141 KSLMAIAKSCPNL 1179
              + A+ K C  L
Sbjct: 185  DGVQALVKGCGGL 197



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC---HQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ LSL +   I+D+G+  + +G     +LE ++L  CP ITD S
Sbjct: 312  ITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDRLEVIELDNCPLITDAS 371

Query: 1147 LMAIAKSCPNLASV 1188
            L  + KSC +L  +
Sbjct: 372  LEHL-KSCQSLERI 384



>pir|A96799|A96799 hypothetical protein F22K20.10 [imported] -
            Arabidopsis thaliana>gb:AE005173_895230 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC002291_1530119 Arabidopsis thaliana
            chromosome I BAC F22K20 genomic sequence, complete
            sequence.>gb:AY087441_1572472 Arabidopsis thaliana clone
            3549 mRNA, complete sequence.
          Length = 360

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 52/170 (30%), Positives = 84/170 (49%), Gaps = 27/170 (15%)
 Frame = +1

Query: 760  MQPELIKSDK---KDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRG 930
            +Q  +++ DK   +D  V++  +   + ++ D  LS+     K TD  L ++A G     
Sbjct: 92   LQTLVLRQDKPQLEDNAVEAIANHCHELQDLD--LSK---SSKITDHSLYSLARGCTN-- 144

Query: 931  GLGKLSIRGNNSF------------------------RGVTDSGLKAIGRGCPSLRALSL 1038
             L KL++ G  SF                          V+D+ L+AIG  C  L++L+L
Sbjct: 145  -LTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCVEAVSDNTLQAIGENCNQLQSLNL 203

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                +ISD+G+  +A GC  L  LDLC C  ITD+S++A+A  C +L S+
Sbjct: 204  GWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSL 253



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D G+ ++  GCP LR L L +   I+DE +  +A+ C  L  L L  C  ITD+++ +
Sbjct: 209  ISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYS 268

Query: 1156 IAKS 1167
            +A+S
Sbjct: 269  LAQS 272



>gb:AY084229_1569322 Arabidopsis thaliana clone 100411 mRNA, complete
            sequence.
          Length = 610

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 63/218 (28%), Positives = 96/218 (44%), Gaps = 20/218 (9%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEE----- 741
            LP+E + EIFRRL      R AC+ V KRWL L     R   +T++ G +  P++     
Sbjct: 11   LPEELILEIFRRLE-SKPNRDACSLVCKRWLSLE----RFSRTTLRIGASFSPDDFISLL 65

Query: 742  ------------GDNATAMQPELIKSDK-KDGFVQSNVSEVQDNEEGDGFLSRC--LDGK 876
                         +  +   P L  S K K G   S+ S  +  +  D   S    ++  
Sbjct: 66   SRRFLHITSIHVDERISVSLPSLSPSPKRKRGRDSSSPSSSKRKKLTDKTQSGAENVESS 125

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
              TD  L A+A G  R   L  +          V+  GL ++ + C SL++L L     +
Sbjct: 126  SLTDTGLTALADGFPRIENLSLIWCPN------VSSVGLCSLAQKCTSLKSLDLQGCY-V 178

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
             D+GL  +   C QLE+L+L  C G+TD  ++ +A  C
Sbjct: 179  GDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLAVGC 216



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 30/72 (41%), Positives = 46/72 (63%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            SF+  TD G++AIG+G   L+ L+L +   +S +GL  IA GC +LE++++  C  I  +
Sbjct: 303  SFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTR 362

Query: 1144 SLMAIAKSCPNL 1179
             + AI KSCP L
Sbjct: 363  GIEAIGKSCPRL 374



 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 30/73 (41%), Positives = 40/73 (54%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +   G++AIG+ CP L+ L+L     I +  L EI  GC  LE L L  C GI D
Sbjct: 354  NGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD 413

Query: 1141 KSLMAIAKSCPNL 1179
             ++ +IAK C NL
Sbjct: 414  IAMCSIAKGCRNL 426



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 33/91 (36%), Positives = 49/91 (53%)
 Frame = +1

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFE 1077
            A IA+G  +   L +L++ G N    ++D+G+ AI RGCP L  L +  + +I D  L E
Sbjct: 467  ALIAIG--KGCSLQQLNVSGCNQ---ISDAGITAIARGCPQLTHLDISVLQNIGDMPLAE 521

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            +  GC  L+ L L  C  ITD  L  + + C
Sbjct: 522  LGEGCPMLKDLVLSHCHHITDNGLNHLVQKC 552



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/91 (31%), Positives = 44/91 (48%)
 Frame = +1

Query: 916  TARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH 1095
            TA   G  +L+    +  + + D  L  +G GCP L+ L L +   I+D GL  +   C 
Sbjct: 494  TAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCK 553

Query: 1096 QLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             LE   +  CPGIT   +  +  SCP++  V
Sbjct: 554  LLETCHMVYCPGITSAGVATVVSSCPHIKKV 584



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 34/99 (34%), Positives = 53/99 (53%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            TDV +  +AVG ++      L   G  +   +TD  L+A+G  C  L  L L +   I D
Sbjct: 205  TDVGVIDLAVGCSK-----SLKSIGVAASAKITDLSLEAVGSHCKLLEVLYL-DSEYIHD 258

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +GL  +A GC++L+ L L QC  +TD +  A+ + C +L
Sbjct: 259  KGLIAVAQGCNRLKNLKL-QCVSVTDVAFAAVGELCTSL 296



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 26/72 (36%), Positives = 42/72 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + +S L+ IG+GC SL  L L + S I D  +  IA GC  L+KL + +   I +K +++
Sbjct: 385  IGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRXYEIGNKGIIS 444

Query: 1156 IAKSCPNLASVT 1191
            I K C +L  ++
Sbjct: 445  IGKHCKSLTELS 456



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 34/98 (34%), Positives = 51/98 (52%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDE 1065
            D+ + +IA G      L KL IR       + + G+ +IG+ C SL  LSL     I ++
Sbjct: 413  DIAMCSIAKGCRN---LKKLHIRRXYE---IGNKGIISIGKHCKSLTELSLRFCDKIGNK 466

Query: 1066 GLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L  I  GC  L++L++  C  I+D  + AIA+ CP L
Sbjct: 467  ALIAIGKGC-SLQQLNVSGCNQISDAGITAIARGCPQL 503



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 35/108 (32%), Positives = 49/108 (45%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            LD +   D  L A+A G  R   L    +        VTD    A+G  C SL  L+L++
Sbjct: 251  LDSEYIHDKGLIAVAQGCNRLKNLKLQCV-------SVTDVAFAAVGELCTSLERLALYS 303

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                +D+G+  I  G  +L+ L L  C  ++ K L AIA  C  L  V
Sbjct: 304  FQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERV 351



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 27/68 (39%), Positives = 38/68 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + +  L AIG+GC SL+ L++   + ISD G+  IA GC QL  LD+     I D  L  
Sbjct: 463  IGNKALIAIGKGC-SLQQLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAE 521

Query: 1156 IAKSCPNL 1179
            + + CP L
Sbjct: 522  LGEGCPML 529



>gb:AK012109_1156775 Mus musculus 10 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2610511F20
            product:F-BOX PROTEIN FBL2 homolog [Rattus norvegicus],
            full insert sequence.
          Length = 422

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 32/83 (38%), Positives = 48/83 (57%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL     +    +TD+ L A+G+ CP LR L +   S ++D G   +A  CH+LEK+
Sbjct: 231  GCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKM 290

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
            DL +C  ITD +L+ ++  CP L
Sbjct: 291  DLEECVQITDSTLIQLSIHCPRL 313



 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL  L ++G        D  LK IG  CP L  L+L     I+DEGL  I  GCH+L+ 
Sbjct: 181  GGLKALFLKGCTQLE---DEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQS 237

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L    C  ITD  L A+ ++CP L
Sbjct: 238  LCASGCSNITDAILNALGQNCPRL 261



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV D+ L+   + C ++  LSL   +  +D     ++  C +L  
Sbjct: 77   GFLRKLSLRG---CLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRH 133

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL A+++ CP L
Sbjct: 134  LDLASCTSITNMSLKALSEGCPLL 157



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC---HQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ LSL +   I+D+G+  + +G     QLE ++L  CP ITD S
Sbjct: 298  ITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDAS 357

Query: 1147 LMAIAKSCPNLASV 1188
            L  + KSCP+   +
Sbjct: 358  LEHL-KSCPSFERI 370



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   +T+  LKA+  GCP L  L++     ++ +G+  +  GC  L+ L L  C  + D+
Sbjct: 138  SCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDE 197

Query: 1144 SLMAIAKSCPNLASV 1188
            +L  I   CP L ++
Sbjct: 198  ALKYIGAHCPELVTL 212



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 21/76 (27%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N     TD+   ++ + C  LR L L + +SI++  L  ++ GC  LE+L++  C  +T 
Sbjct: 111  NGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTK 170

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 171  DGIQALVRGCGGLKAL 186



>sp|Q9CZV8|FL2L_MOUSE F-box/LRR-repeat protein 2-like.
          Length = 436

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 32/83 (38%), Positives = 48/83 (57%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL     +    +TD+ L A+G+ CP LR L +   S ++D G   +A  CH+LEK+
Sbjct: 245  GCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKM 304

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
            DL +C  ITD +L+ ++  CP L
Sbjct: 305  DLEECVQITDSTLIQLSIHCPRL 327



 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL  L ++G        D  LK IG  CP L  L+L     I+DEGL  I  GCH+L+ 
Sbjct: 195  GGLKALFLKGCTQLE---DEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQS 251

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L    C  ITD  L A+ ++CP L
Sbjct: 252  LCASGCSNITDAILNALGQNCPRL 275



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV D+ L+   + C ++  LSL   +  +D     ++  C +L  
Sbjct: 91   GFLRKLSLRG---CLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRH 147

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL A+++ CP L
Sbjct: 148  LDLASCTSITNMSLKALSEGCPLL 171



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC---HQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ LSL +   I+D+G+  + +G     QLE ++L  CP ITD S
Sbjct: 312  ITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDAS 371

Query: 1147 LMAIAKSCPNLASV 1188
            L  + KSCP+   +
Sbjct: 372  LEHL-KSCPSFERI 384



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   +T+  LKA+  GCP L  L++     ++ +G+  +  GC  L+ L L  C  + D+
Sbjct: 152  SCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDE 211

Query: 1144 SLMAIAKSCPNLASV 1188
            +L  I   CP L ++
Sbjct: 212  ALKYIGAHCPELVTL 226



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 21/76 (27%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N     TD+   ++ + C  LR L L + +SI++  L  ++ GC  LE+L++  C  +T 
Sbjct: 125  NGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTK 184

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 185  DGIQALVRGCGGLKAL 200



>sp|Q96IG2|FL2L_HUMAN F-box/LRR-repeat protein
            2-like.>gb:BC007557_1970809 Homo sapiens F-box and
            leucine-rich repeat protein 20, mRNA (cDNA clone
            MGC:15482 IMAGE:2987858), complete cds.
          Length = 436

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 32/83 (38%), Positives = 48/83 (57%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL     +    +TD+ L A+G+ CP LR L +   S ++D G   +A  CH+LEK+
Sbjct: 245  GCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKM 304

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
            DL +C  ITD +L+ ++  CP L
Sbjct: 305  DLEECVQITDSTLIQLSIHCPRL 327



 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL  L ++G        D  LK IG  CP L  L+L     I+DEGL  I  GCH+L+ 
Sbjct: 195  GGLKALFLKGCTQLE---DEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQS 251

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L    C  ITD  L A+ ++CP L
Sbjct: 252  LCASGCSNITDAILNALGQNCPRL 275



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 29/84 (34%), Positives = 45/84 (53%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV D+ L+   + C ++  L+L   +  +D     ++  C +L  
Sbjct: 91   GFLRKLSLRG---CLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRH 147

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL A+++ CP L
Sbjct: 148  LDLASCTSITNMSLKALSEGCPLL 171



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC---HQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ LSL +   I+D+G+  + +G     QLE ++L  CP ITD S
Sbjct: 312  ITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDAS 371

Query: 1147 LMAIAKSCPNLASV 1188
            L  + KSC +L  +
Sbjct: 372  LEHL-KSCHSLERI 384



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   +T+  LKA+  GCP L  L++     ++ +G+  +  GC  L+ L L  C  + D+
Sbjct: 152  SCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDE 211

Query: 1144 SLMAIAKSCPNLASV 1188
            +L  I   CP L ++
Sbjct: 212  ALKYIGAHCPELVTL 226



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 21/76 (27%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N     TD+   ++ + C  LR L L + +SI++  L  ++ GC  LE+L++  C  +T 
Sbjct: 125  NGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTK 184

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 185  DGIQALVRGCGGLKAL 200



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGC---PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            +TD G++ +G G      L  + L N   I+D  L  + S CH LE+++L  C  IT   
Sbjct: 338  ITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKS-CHSLERIELYDCQQITRAG 396

Query: 1147 LMAIAKSCPNL 1179
            +  +    PN+
Sbjct: 397  IKRLRTHLPNI 407



>gb:AY091103_1574327 Arabidopsis thaliana putative F-box protein
            family, AtFBL3 (At5g01720) mRNA, complete
            cds.>gb:AY122938_1579816 Arabidopsis thaliana putative
            F-box family protein AtFBL3 (At5g01720) mRNA, complete
            cds.
          Length = 665

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 33/80 (41%), Positives = 46/80 (57%), Gaps = 10/80 (12%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GL  IG GC +LR L L+    I+D G+  IA GC  LE +++  C  ITDKSL++
Sbjct: 444  ITDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGCIHLETINISYCQDITDKSLVS 503

Query: 1156 IAK----------SCPNLAS 1185
            ++K           CPN+ S
Sbjct: 504  LSKCSLLQTFESRGCPNITS 523



 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 41/116 (35%), Positives = 57/116 (49%)
 Frame = +1

Query: 841  GDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS 1020
            G G+L R LD    + V     A    +   L  + + G +    VT  GLKAIG  C S
Sbjct: 276  GAGYLQR-LDLSHCSSVISLDFASSLKKVSALQSIRLDGCS----VTPDGLKAIGTLCNS 330

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            L+ +SL    S++DEGL  +      L KLD+  C  ++  S+  IA SCP L S+
Sbjct: 331  LKEVSLSKCVSVTDEGLSSLVMKLKDLRKLDITCCRKLSRVSITQIANSCPLLVSL 386



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 29/71 (40%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D GLK+I   C SL +L L    +I+D+GL  I  GC  L +LDL +  GITD  +  
Sbjct: 419  IDDEGLKSIS-SCLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGIST 477

Query: 1156 IAKSCPNLASV 1188
            IA+ C +L ++
Sbjct: 478  IAQGCIHLETI 488



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 34/157 (21%)
 Frame = +1

Query: 820  EVQDNE---EGDGFLSRCLDGKKATDVRLAAIAVGTARRG----GLGKLSIRGNNSFR-- 972
            ++ DNE   EG   +S CL     + ++L  I +    +G    G+G  ++R  + +R  
Sbjct: 413  DLTDNEIDDEGLKSISSCLS---LSSLKLG-ICLNITDKGLSYIGMGCSNLRELDLYRSV 468

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISD-------------------------EGLFE 1077
            G+TD G+  I +GC  L  +++     I+D                         +GL  
Sbjct: 469  GITDVGISTIAQGCIHLETINISYCQDITDKSLVSLSKCSLLQTFESRGCPNITSQGLAA 528

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            IA  C +L K+DL +CP I D  L+A+A    NL  +
Sbjct: 529  IAVRCKRLAKVDLKKCPSINDAGLLALAHFSQNLKQI 565



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/72 (29%), Positives = 34/72 (47%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            GV D  LK++   C SL+ L   +  +++  GL  + SG   L++LDL  C  +      
Sbjct: 238  GVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQRLDLSHCSSVISLDFA 297

Query: 1153 AIAKSCPNLASV 1188
            +  K    L S+
Sbjct: 298  SSLKKVSALQSI 309



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 33/100 (33%), Positives = 46/100 (46%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            +D   AT++R A  AV  A    L +L +      + +TD G+  I  GC  L  +SL  
Sbjct: 130  IDLSNATEMRDADAAV-VAEARSLERLKL---GRCKMLTDMGIGCIAVGCKKLNTVSLKW 185

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
               + D G+  +A  C  +  LDL   P IT K L  I K
Sbjct: 186  CVGVGDLGVGLLAVKCKDIRTLDLSYLP-ITGKCLHDILK 224



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 36/133 (27%), Positives = 52/133 (39%), Gaps = 24/133 (18%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            LS+C+     TD  L+++ +   +   L KL I      R ++   +  I   CP L +L
Sbjct: 336  LSKCVS---VTDEGLSSLVM---KLKDLRKLDI---TCCRKLSRVSITQIANSCPLLVSL 386

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQ------------------------CPGITD 1140
             + + S +S E  + I   C  LE+LDL                          C  ITD
Sbjct: 387  KMESCSLVSREAFWLIGQKCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGICLNITD 446

Query: 1141 KSLMAIAKSCPNL 1179
            K L  I   C NL
Sbjct: 447  KGLSYIGMGCSNL 459



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +1

Query: 976  VTDSGLKAIG-RGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            VTD  L  +G    P+LR+L L    S S  GL  +A  C  L ++DL     + D    
Sbjct: 85   VTDYALSVVGCLSGPTLRSLDLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDADAA 144

Query: 1153 AIAKS 1167
             +A++
Sbjct: 145  VVAEA 149



>pir|T48193|T48193 hypothetical protein F7A7.240 - Arabidopsis
            thaliana>gb:ATF7A7_1550924 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 618

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 33/80 (41%), Positives = 46/80 (57%), Gaps = 10/80 (12%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GL  IG GC +LR L L+    I+D G+  IA GC  LE +++  C  ITDKSL++
Sbjct: 397  ITDKGLSYIGMGCSNLRELDLYRSVGITDVGISTIAQGCIHLETINISYCQDITDKSLVS 456

Query: 1156 IAK----------SCPNLAS 1185
            ++K           CPN+ S
Sbjct: 457  LSKCSLLQTFESRGCPNITS 476



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 29/71 (40%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D GLK+I   C SL +L L    +I+D+GL  I  GC  L +LDL +  GITD  +  
Sbjct: 372  IDDEGLKSIS-SCLSLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGIST 430

Query: 1156 IAKSCPNLASV 1188
            IA+ C +L ++
Sbjct: 431  IAQGCIHLETI 441



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 34/157 (21%)
 Frame = +1

Query: 820  EVQDNE---EGDGFLSRCLDGKKATDVRLAAIAVGTARRG----GLGKLSIRGNNSFR-- 972
            ++ DNE   EG   +S CL     + ++L  I +    +G    G+G  ++R  + +R  
Sbjct: 366  DLTDNEIDDEGLKSISSCLS---LSSLKLG-ICLNITDKGLSYIGMGCSNLRELDLYRSV 421

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISD-------------------------EGLFE 1077
            G+TD G+  I +GC  L  +++     I+D                         +GL  
Sbjct: 422  GITDVGISTIAQGCIHLETINISYCQDITDKSLVSLSKCSLLQTFESRGCPNITSQGLAA 481

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            IA  C +L K+DL +CP I D  L+A+A    NL  +
Sbjct: 482  IAVRCKRLAKVDLKKCPSINDAGLLALAHFSQNLKQI 518



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 44/138 (31%), Positives = 55/138 (39%), Gaps = 25/138 (18%)
 Frame = +1

Query: 841  GDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS 1020
            G G+L R LD    + V     A    +   L  + + G +    VT  GLKAIG  C S
Sbjct: 280  GAGYLQR-LDLSHCSSVISLDFASSLKKVSALQSIRLDGCS----VTPDGLKAIGTLCNS 334

Query: 1021 LRALSLWNISSISDEGLF-EIASGCHQLEKLDLCQ------------------------C 1125
            L+ +SL    S++DE  F  I   C  LE+LDL                          C
Sbjct: 335  LKEVSLSKCVSVTDEEAFWLIGQKCRLLEELDLTDNEIDDEGLKSISSCLSLSSLKLGIC 394

Query: 1126 PGITDKSLMAIAKSCPNL 1179
              ITDK L  I   C NL
Sbjct: 395  LNITDKGLSYIGMGCSNL 412



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 33/100 (33%), Positives = 46/100 (46%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            +D   AT++R A  AV  A    L +L +      + +TD G+  I  GC  L  +SL  
Sbjct: 130  IDLSNATEMRDADAAV-VAEARSLERLKL---GRCKMLTDMGIGCIAVGCKKLNTVSLKW 185

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
               + D G+  +A  C  +  LDL   P IT K L  I K
Sbjct: 186  CVGVGDLGVGLLAVKCKDIRTLDLSYLP-ITGKCLHDILK 224



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 1/65 (1%)
 Frame = +1

Query: 976  VTDSGLKAIG-RGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            VTD  L  +G    P+LR+L L    S S  GL  +A  C  L ++DL     + D    
Sbjct: 85   VTDYALSVVGCLSGPTLRSLDLSRSGSFSAAGLLRLALKCVNLVEIDLSNATEMRDADAA 144

Query: 1153 AIAKS 1167
             +A++
Sbjct: 145  VVAEA 149



>gb:AY056338_1563648 Arabidopsis thaliana putative F-box protein
            family protein FBL4 (At4g15475) mRNA, complete
            cds.>gb:AF360328_1791274 Arabidopsis thaliana putative
            F-box protein family, AtFBL4 (At4g15475) mRNA, complete
            cds.>gb:AF361808_1791400 Arabidopsis thaliana
            AT4g15470/dl3775w mRNA, complete cds.
          Length = 610

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 62/218 (28%), Positives = 95/218 (43%), Gaps = 20/218 (9%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEE----- 741
            LP+E + EIFRRL      R AC+ V KRWL L     R   +T++ G +  P++     
Sbjct: 11   LPEELILEIFRRLE-SKPNRDACSLVCKRWLSLE----RFSRTTLRIGASFSPDDFISLL 65

Query: 742  ------------GDNATAMQPELIKSDK-KDGFVQSNVSEVQDNEEGDGFLSRC--LDGK 876
                         +  +   P L  S K K G   S+ S  +  +  D   S    ++  
Sbjct: 66   SRRFLYITSIHVDERISVSLPSLSPSPKRKRGRDSSSPSSSKRKKLTDKTHSGAENVESS 125

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
              TD  L A+A G  R   L  +          V+  GL ++ + C SL++L L     +
Sbjct: 126  SLTDTGLTALANGFPRIENLSLIWCPN------VSSVGLCSLAQKCTSLKSLDLQGCY-V 178

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
             D+GL  +   C QLE+L+L  C G+TD  ++ +   C
Sbjct: 179  GDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGC 216



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 30/72 (41%), Positives = 46/72 (63%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            SF+  TD G++AIG+G   L+ L+L +   +S +GL  IA GC +LE++++  C  I  +
Sbjct: 303  SFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTR 362

Query: 1144 SLMAIAKSCPNL 1179
             + AI KSCP L
Sbjct: 363  GIEAIGKSCPRL 374



 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 30/73 (41%), Positives = 40/73 (54%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +   G++AIG+ CP L+ L+L     I +  L EI  GC  LE L L  C GI D
Sbjct: 354  NGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLVDCSGIGD 413

Query: 1141 KSLMAIAKSCPNL 1179
             ++ +IAK C NL
Sbjct: 414  IAMCSIAKGCRNL 426



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 33/91 (36%), Positives = 49/91 (53%)
 Frame = +1

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFE 1077
            A IA+G  +   L +L++ G N    ++D+G+ AI RGCP L  L +  + +I D  L E
Sbjct: 467  ALIAIG--KGCSLQQLNVSGCNQ---ISDAGITAIARGCPQLTHLDISVLQNIGDMPLAE 521

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            +  GC  L+ L L  C  ITD  L  + + C
Sbjct: 522  LGEGCPMLKDLVLSHCHHITDNGLNHLVQKC 552



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 27/72 (37%), Positives = 43/72 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + +S L+ IG+GC SL  L L + S I D  +  IA GC  L+KL + +C  I +K +++
Sbjct: 385  IGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRRCYEIGNKGIIS 444

Query: 1156 IAKSCPNLASVT 1191
            I K C +L  ++
Sbjct: 445  IGKHCKSLTELS 456



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/91 (31%), Positives = 44/91 (48%)
 Frame = +1

Query: 916  TARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH 1095
            TA   G  +L+    +  + + D  L  +G GCP L+ L L +   I+D GL  +   C 
Sbjct: 494  TAIARGCPQLTHLDISVLQNIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCK 553

Query: 1096 QLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             LE   +  CPGIT   +  +  SCP++  V
Sbjct: 554  LLETCHMVYCPGITSAGVATVVSSCPHIKKV 584



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 34/99 (34%), Positives = 52/99 (52%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            TDV +  + VG ++      L   G  +   +TD  L+A+G  C  L  L L +   I D
Sbjct: 205  TDVGVIDLVVGCSK-----SLKSIGVAASAKITDLSLEAVGSHCKLLEVLYL-DSEYIHD 258

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +GL  +A GCH+L+ L L QC  +TD +  A+ + C +L
Sbjct: 259  KGLIAVAQGCHRLKNLKL-QCVSVTDVAFAAVGELCTSL 296



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 35/108 (32%), Positives = 49/108 (45%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            LD +   D  L A+A G  R   L    +        VTD    A+G  C SL  L+L++
Sbjct: 251  LDSEYIHDKGLIAVAQGCHRLKNLKLQCV-------SVTDVAFAAVGELCTSLERLALYS 303

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                +D+G+  I  G  +L+ L L  C  ++ K L AIA  C  L  V
Sbjct: 304  FQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERV 351



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDE 1065
            D+ + +IA G      L KL IR       + + G+ +IG+ C SL  LSL     + ++
Sbjct: 413  DIAMCSIAKGCRN---LKKLHIRRCYE---IGNKGIISIGKHCKSLTELSLRFCDKVGNK 466

Query: 1066 GLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L  I  GC  L++L++  C  I+D  + AIA+ CP L
Sbjct: 467  ALIAIGKGC-SLQQLNVSGCNQISDAGITAIARGCPQL 503



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 28/68 (41%), Positives = 38/68 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V +  L AIG+GC SL+ L++   + ISD G+  IA GC QL  LD+     I D  L  
Sbjct: 463  VGNKALIAIGKGC-SLQQLNVSGCNQISDAGITAIARGCPQLTHLDISVLQNIGDMPLAE 521

Query: 1156 IAKSCPNL 1179
            + + CP L
Sbjct: 522  LGEGCPML 529



>sp|Q9QZH7|FL2L_RAT F-box/LRR-repeat protein 2-like.>pir|T52349|T52349
            F-box protein FBL2 [imported] - rat>gb:AK036217_1164394
            Mus musculus 16 days neonate cerebellum cDNA, RIKEN
            full-length enriched library, clone:9630046G05
            product:F-BOX PROTEIN FBL2 homolog [Rattus norvegicus],
            full insert sequence.>gb:AF182443_2058104 Rattus
            norvegicus F-box protein FBL2 (FBL2) mRNA, complete cds.
          Length = 276

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 35/84 (41%), Positives = 44/84 (52%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL  L ++G        D  LK IG  CP L  L+L     I+DEGL  I  GCH+L+ 
Sbjct: 195  GGLKALFLKGCTQLE---DEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQS 251

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            L    C  ITD  L A+ ++CP L
Sbjct: 252  LCASGCSNITDAILNALGQNCPRL 275



 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 30/84 (35%), Positives = 45/84 (53%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV D+ L+   + C ++  LSL   +  +D     ++  C +L  
Sbjct: 91   GFLRKLSLRG---CLGVGDNALRTFAQNCRNIEVLSLNGCTKTTDATCTSLSKFCSKLRH 147

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL A+++ CP L
Sbjct: 148  LDLASCTSITNMSLKALSEGCPLL 171



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   +T+  LKA+  GCP L  L++     ++ +G+  +  GC  L+ L L  C  + D+
Sbjct: 152  SCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDE 211

Query: 1144 SLMAIAKSCPNLASV 1188
            +L  I   CP L ++
Sbjct: 212  ALKYIGAHCPELVTL 226



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 21/76 (27%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N     TD+   ++ + C  LR L L + +SI++  L  ++ GC  LE+L++  C  +T 
Sbjct: 125  NGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTK 184

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 185  DGIQALVRGCGGLKAL 200



>sp|Q8BH16|FL2_MOUSE F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2).>gb:AK039010_1165248 Mus
            musculus adult male hypothalamus cDNA, RIKEN full-length
            enriched library, clone:A230084N13 product:LEUCINE-RICH
            REPEATS CONTAINING F-BOX PROTEIN FBL3 homolog [Homo
            sapiens], full insert sequence.>gb:AK045742_1167524 Mus
            musculus adult male corpora quadrigemina cDNA, RIKEN
            full-length enriched library, clone:B230309A05
            product:LEUCINE-RICH REPEATS CONTAINING F-BOX PROTEIN
            FBL3 homolog [Homo sapiens], full insert
            sequence.>gb:AK089994_1176084 Mus musculus CRL-1751 WEHI
            164 cDNA, RIKEN full-length enriched library,
            clone:G430047M01 product:LEUCINE-RICH REPEATS CONTAINING
            F-BOX PROTEIN FBL3 homolog [Homo sapiens], full insert
            sequence.
          Length = 423

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 33/83 (39%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+D+G+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  +T+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNL 158



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD  ++ 
Sbjct: 169  ITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  S+++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
            + + A+ + C  L ++
Sbjct: 172  EGIEALVRGCRGLKAL 187



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/71 (36%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VT+S LK I  GC +L  L+L     I+ EG+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  VTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNHCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L +        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQVLEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD+ ++ ++ S
Sbjct: 294  EECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSS 336



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+DEG+  ++S   G  +L  L+L  C  +TD S
Sbjct: 299  ITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDAS 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>gb:AB007648_1510210 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MKD15.>gb:AY054268_1563088 Arabidopsis thaliana
            AT5g23340/MKD15_20 mRNA, complete
            cds.>gb:AY133522_1581345 Arabidopsis thaliana
            At5g23340/MKD15_20 mRNA, complete cds.
          Length = 405

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 61/213 (28%), Positives = 88/213 (41%), Gaps = 7/213 (3%)
 Frame = +1

Query: 571  EVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDN 750
            E L D+ L  +  RL    +++     V KRWL L ST  +      K    + P     
Sbjct: 8    EALTDDELRWVLSRLD-SDKDKEVFGLVCKRWLNLQSTDRK------KLAARAGPHMLRR 60

Query: 751  ATAMQPELIKSDKKDGFVQSNVSEVQDNE-----EGDGFLS--RCLDGKKATDVRLAAIA 909
              +   ++++ D      +S    V D++     EG  FL      + K  TD  LA+I 
Sbjct: 61   LASRFTQIVELDLSQSISRSFYPGVTDSDLAVISEGFKFLRVLNLHNCKGITDTGLASIG 120

Query: 910  VGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
                    L  L     +  R ++D GL A+  GC  LRAL L     I+DE L  ++  
Sbjct: 121  ------RCLSLLQFLDVSYCRKLSDKGLSAVAEGCHDLRALHLAGCRFITDESLKSLSER 174

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            C  LE L L  C  ITD  L  + K C  + S+
Sbjct: 175  CRDLEALGLQGCTNITDSGLADLVKGCRKIKSL 207



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 32/99 (32%), Positives = 55/99 (55%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            +K +D  L+A+A G      L  L + G    R +TD  LK++   C  L AL L   ++
Sbjct: 135  RKLSDKGLSAVAEGCH---DLRALHLAG---CRFITDESLKSLSERCRDLEALGLQGCTN 188

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            I+D GL ++  GC +++ LD+ +C  + D  + ++AK+C
Sbjct: 189  ITDSGLADLVKGCRKIKSLDINKCSNVGDAGVSSVAKAC 227



>gb:BC086357_2109548 Rattus norvegicus similar to F-box protein FBL2
            (predicted), mRNA (cDNA clone MGC:105998 IMAGE:7303722),
            complete cds.
          Length = 213

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 29/71 (40%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G+KA+   C  L  +SL    S++DEG+  +A  C  L+ +DL  C  ITD+SL A
Sbjct: 57   ITSEGIKAVASSCSDLHEISLKGCCSVTDEGVLALALNCQLLKIIDLGGCLSITDESLHA 116

Query: 1156 IAKSCPNLASV 1188
            + K+CP L  V
Sbjct: 117  LGKNCPFLQCV 127



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 23/70 (32%), Positives = 43/70 (61%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSL 1149
            +TD  L A+G+ CP L+ +  ++ + +SD G+  + SG    QLE++++  C  +TDK++
Sbjct: 109  ITDESLHALGKNCPFLQCVD-FSTTQVSDNGVVALVSGPCAKQLEEINMGYCINLTDKAV 167

Query: 1150 MAIAKSCPNL 1179
             A   +CP +
Sbjct: 168  EAALTACPQI 177



 Score = 41.2 bits (95), Expect = 0.042
 Identities = 25/81 (30%), Positives = 47/81 (58%), Gaps = 4/81 (4%)
 Frame = +1

Query: 940  KLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNI----SSISDEGLFEIASGCHQLEK 1107
            +L +R  N    ++D  L+ + + C  L+AL+L +     +SI+ EG+  +AS C  L +
Sbjct: 20   RLDLRSCN----ISDVALQHLCK-CRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHE 74

Query: 1108 LDLCQCPGITDKSLMAIAKSC 1170
            + L  C  +TD+ ++A+A +C
Sbjct: 75   ISLKGCCSVTDEGVLALALNC 95



>gb:HSM800297_2017131 Homo sapiens mRNA; cDNA DKFZp564P0622 (from
            clone DKFZp564P0622); partial cds.
          Length = 250

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 74   LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 133

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 134  LSIHCPKLQALS 145



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 10   GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 66

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 67   CLSGCSNLTDASLTALGLNCPRL 89



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +1

Query: 994  KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCP 1173
            +A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ I + C 
Sbjct: 2    EALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCH 61

Query: 1174 NLASV 1188
             L ++
Sbjct: 62   RLQAL 66



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 67   CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 120

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 121  EECILITDSTLIQLSIHCPKLQALSLPHCELITDDGILHLSNS 163



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 126  ITDSTLIQLSIHCPKLQALSLPHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 185

Query: 1147 L 1149
            L
Sbjct: 186  L 186



>gb:CR457121_1993328 Homo sapiens full open reading frame cDNA clone
            RZPDo834A0312D for gene FBXL2, F-box and leucine-rich
            repeat protein 2; complete cds, incl. stopcodon.
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV DS LK   + C ++  L+L   + I+D   + ++  C +L+ 
Sbjct: 78   GFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL  I++ C NL
Sbjct: 135  LDLTSCVSITNSSLKGISEGCRNL 158



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



>gb:AF186273_1888623 Homo sapiens leucine-rich repeats containing
            F-box protein FBL3 mRNA, complete
            cds.>gb:BC031556_1980160 Homo sapiens F-box and
            leucine-rich repeat protein 2, mRNA (cDNA clone MGC:34103
            IMAGE:5197151), complete cds.
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  IT+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNL 158



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>gb:AF176518_1888019 Homo sapiens leucine-rich repeat-containing F-box
            protein FBL2 mRNA, complete cds.
          Length = 425

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 249  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 308

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 309  LSIHCPKLQALS 320



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 185  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 241

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 242  CLSGCSNLTDASLTALGLNCPRL 264



 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV DS LK   + C ++  L+L   + I+D   + ++  C +L+ 
Sbjct: 80   GFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 136

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL  I++ C NL
Sbjct: 137  LDLTSCVSITNSSLKGISEGCRNL 160



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 171  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 230

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 231  ICRGCHRLQAL 241



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 114  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 173

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 174  DGIEALVRGCRGLKAL 189



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 145  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 204

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 205  IQNYCHELVSL 215



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 242  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 295

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 296  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 338



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 301  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 360

Query: 1147 L 1149
            L
Sbjct: 361  L 361



>gb:AX876746_1476674 Sequence 11651 from Patent
            EP1074617.>gb:AK001438_1908437 Homo sapiens cDNA FLJ10576
            fis, clone NT2RP2003329, weakly similar to PUTATIVE
            ADENYLATE CYCLASE REGULATORY PROTEIN.
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLKKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  IT+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNL 158



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>gb:AX876382_1476504 Sequence 11287 from Patent EP1074617.
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALPLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  IT+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNL 158



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALPLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALPLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>gb:CR861462_1185457 Pongo pygmaeus mRNA; cDNA DKFZp459E062 (from
            clone DKFZp459E062).
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 58.5 bits (140), Expect = 3e-07
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  IT+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNL 158



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>pir|C71419|C71419 hypothetical protein - Arabidopsis
            thaliana>gb:ATCHRIV41_1545349 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 41.>gb:ATFCA4_1551597
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 4.
          Length = 712

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 30/72 (41%), Positives = 46/72 (63%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            SF+  TD G++AIG+G   L+ L+L +   +S +GL  IA GC +LE++++  C  I  +
Sbjct: 509  SFQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERVEINGCHNIGTR 568

Query: 1144 SLMAIAKSCPNL 1179
             + AI KSCP L
Sbjct: 569  GIEAIGKSCPRL 580



 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 26/77 (33%), Positives = 40/77 (51%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            ++ F+ + D  L  +G GCP L+ L L +   I+D GL  +   C  LE   +  CPGIT
Sbjct: 610  DHKFQNIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCKLLETCHMVYCPGIT 669

Query: 1138 DKSLMAIAKSCPNLASV 1188
               +  +  SCP++  V
Sbjct: 670  SAGVATVVSSCPHIKKV 686



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 34/99 (34%), Positives = 52/99 (52%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            TDV +  + VG ++      L   G  +   +TD  L+A+G  C  L  L L +   I D
Sbjct: 411  TDVGVIDLVVGCSK-----SLKSIGVAASAKITDLSLEAVGSHCKLLEVLYL-DSEYIHD 464

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +GL  +A GCH+L+ L L QC  +TD +  A+ + C +L
Sbjct: 465  KGLIAVAQGCHRLKNLKL-QCVSVTDVAFAAVGELCTSL 502



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 35/108 (32%), Positives = 49/108 (45%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            LD +   D  L A+A G  R   L    +        VTD    A+G  C SL  L+L++
Sbjct: 457  LDSEYIHDKGLIAVAQGCHRLKNLKLQCV-------SVTDVAFAAVGELCTSLERLALYS 509

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                +D+G+  I  G  +L+ L L  C  ++ K L AIA  C  L  V
Sbjct: 510  FQHFTDKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHGCKELERV 557



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 26/68 (38%), Positives = 37/68 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+GL A+  G P +  LSL    ++S  GL  +A  C  L+ LDL  C  + D+ L A
Sbjct: 333  LTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGC-YVGDQGLAA 391

Query: 1156 IAKSCPNL 1179
            + K C  L
Sbjct: 392  VGKFCKQL 399



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 30/102 (29%), Positives = 49/102 (48%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            ++    TD  L A+A G  R   L  +          V+  GL ++ + C SL++L L  
Sbjct: 328  VESSSLTDTGLTALANGFPRIENLSLIWCPN------VSSVGLCSLAQKCTSLKSLDLQG 381

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
               + D+GL  +   C QLE+L+L  C G+TD  ++ +   C
Sbjct: 382  CY-VGDQGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGC 422



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 25/95 (26%), Positives = 36/95 (37%), Gaps = 25/95 (26%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSL-------------------------WNISSISDE 1065
            N    +   G++AIG+ CP L+ L+L                             +I D 
Sbjct: 560  NGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGYLKAGTFDHKFQNIGDM 619

Query: 1066 GLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
             L E+  GC  L+ L L  C  ITD  L  + + C
Sbjct: 620  PLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKC 654



>pir|T08680|T08680 hypothetical protein DKFZp564P0622.1 - human
            (fragment)
          Length = 250

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 74   LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 133

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 134  LSIHCPKLQALS 145



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 10   GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 66

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 67   CLSGCSNLTDASLTALGLNCPRL 89



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%)
 Frame = +1

Query: 994  KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCP 1173
            +A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ I + C 
Sbjct: 2    EALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCH 61

Query: 1174 NLASV 1188
             L ++
Sbjct: 62   RLQAL 66



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 67   CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 120

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 121  EECILITDSTLIQLSIHCPKLQALSLPHCELITDDGILHLSNS 163



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 126  ITDSTLIQLSIHCPKLQALSLPHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 185

Query: 1147 L 1149
            L
Sbjct: 186  L 186



>sp|Q9UKC9|FL2_HUMAN F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2) (F-box protein FBL2)
            (F-box protein FBL3).
          Length = 423

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 32/84 (38%), Positives = 47/84 (55%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+RG     GV DS LK   + C ++  L+L   + I+D   + ++  C +L+ 
Sbjct: 78   GFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKH 134

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  IT+ SL  I++ C NL
Sbjct: 135  LDLTSCVSITNSSLKGISEGCRNL 158



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 294  EECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 336



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



>gb:AF174589_1887907 Homo sapiens F-box protein Fbl2 (FBL2) mRNA,
            complete cds.
          Length = 423

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 28/72 (38%), Positives = 44/72 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL  C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEXCILITDSTLIQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 169  ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 23/68 (33%), Positives = 38/68 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G+  I RGC  L+AL L   S+++D  L  +   C +L+ L+  +C  +TD     
Sbjct: 221  ITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL 280

Query: 1156 IAKSCPNL 1179
            +A++C  L
Sbjct: 281  LARNCHEL 288



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 25/76 (32%), Positives = 39/76 (51%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  SI++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLXLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
              + A+ + C  L ++
Sbjct: 172  DGIEALVRGCRGLKAL 187



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/71 (33%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+S LK I  GC +L  L+L     I+ +G+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  ITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNYCHELVSL 213



 Score = 40.8 bits (94), Expect = 0.054
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  I D  ++ ++ S
Sbjct: 294  EXCILITDSTLIQLSIHCPKLQALSLSHCELIXDDGILHLSNS 336



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 299  ITDSTLIQLSIHCPKLQALSLSHCELIXDDGILHLSNSTCGHERLRVLELDNCLLITDVA 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 18/53 (33%), Positives = 26/53 (49%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LR LSL     + D  L   A  C  +E L+L  C  ITD +  ++++ C  L
Sbjct: 80   LRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKL 132



>gb:CR861354_1185354 Pongo pygmaeus mRNA; cDNA DKFZp459A1011 (from
            clone DKFZp459A1011).
          Length = 318

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 34/83 (40%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+DEG+ +I  GCH+L+ L
Sbjct: 78   GLKALLLRGCTQLE---DEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQAL 134

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 135  CLSGCSNLTDASLTALGLNCPRL 157



 Score = 60.5 bits (145), Expect = 7e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D G   +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 142  LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDGTLIQ 201

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 202  LSIHCPKLQALS 213



 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD+ ++ 
Sbjct: 64   ITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQ 123

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 124  ICRGCHRLQAL 134



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 23/68 (33%), Positives = 38/68 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G+  I RGC  L+AL L   S+++D  L  +   C +L+ L+  +C  +TD     
Sbjct: 116  ITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL 175

Query: 1156 IAKSCPNL 1179
            +A++C  L
Sbjct: 176  LARNCHEL 183



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 32/108 (29%), Positives = 50/108 (46%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            +D +K+  VRL   +   +      KL      S   +T+S LK I  GC +L  L+L  
Sbjct: 1    MDAQKSLTVRLLFFSTCYSLSRFCSKLKHLDLTSCVSITNSPLKGISEGCRNLEYLNLSW 60

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
               I+ +G+  +  GC  L+ L L  C  + D++L  I   C  L S+
Sbjct: 61   CDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSL 108



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L I        +TD+G   + R C  L  + L
Sbjct: 135  CLSGCSNLTDASLTALGLNCPR------LQILEAARCSHLTDAGFTLLARNCHELEKMDL 188

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD  ++ ++ S
Sbjct: 189  EECILITDGTLIQLSIHCPKLQALSLSHCELITDDGILHLSNS 231



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TD  L  +   CP L+ALSL +   I+D+G+  +++   G  +L  L+L  C  ITD +
Sbjct: 194  ITDGTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVA 253

Query: 1147 L 1149
            L
Sbjct: 254  L 254



>gb:BC045831_1983645 Homo sapiens, clone IMAGE:5265088, mRNA, partial
            cds.
          Length = 294

 Score = 60.5 bits (145), Expect = 7e-08
 Identities = 46/145 (31%), Positives = 70/145 (48%), Gaps = 2/145 (1%)
 Frame = +1

Query: 760  MQPELIKSDKKDGFV-QSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
            ++  LIK     G +  SN+SE+   E       + LD +       A + +   R+  L
Sbjct: 72   IKDRLIKIMSMQGQITDSNISEILHPEV------QTLDLRSCDISDAALLHLSNCRK--L 123

Query: 937  GKLSIRGNNSFR-GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
             KL++  +   R  VT  G+KA+   C  L   SL    +++DEG+  +A  C  L+ +D
Sbjct: 124  KKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIID 183

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            L  C  ITD SL A+ K+CP L  V
Sbjct: 184  LGGCLSITDVSLHALGKNCPFLQCV 208



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSL 1149
            +TD  L A+G+ CP L+ +  ++ + +SD G+  + SG    +LE++ +  C  +TD ++
Sbjct: 190  ITDVSLHALGKNCPFLQCVD-FSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAV 248

Query: 1150 MAIAKSCPNL 1179
             A+   CP +
Sbjct: 249  EAVLTYCPQI 258



>gb:BC037897_1982248 Homo sapiens hypothetical protein LOC196394, mRNA
            (cDNA clone IMAGE:5275850), partial cds.
          Length = 281

 Score = 60.5 bits (145), Expect = 7e-08
 Identities = 46/145 (31%), Positives = 70/145 (48%), Gaps = 2/145 (1%)
 Frame = +1

Query: 760  MQPELIKSDKKDGFV-QSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
            ++  LIK     G +  SN+SE+   E       + LD +       A + +   R+  L
Sbjct: 59   IKDRLIKIMSMQGQITDSNISEILHPEV------QTLDLRSCDISDAALLHLSNCRK--L 110

Query: 937  GKLSIRGNNSFR-GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
             KL++  +   R  VT  G+KA+   C  L   SL    +++DEG+  +A  C  L+ +D
Sbjct: 111  KKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIID 170

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            L  C  ITD SL A+ K+CP L  V
Sbjct: 171  LGGCLSITDVSLHALGKNCPFLQCV 195



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSL 1149
            +TD  L A+G+ CP L+ +  ++ + +SD G+  + SG    +LE++ +  C  +TD ++
Sbjct: 177  ITDVSLHALGKNCPFLQCVD-FSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAV 235

Query: 1150 MAIAKSCPNL 1179
             A+   CP +
Sbjct: 236  EAVLTYCPQI 245



>gb:AK044693_1167082 Mus musculus adult retina cDNA, RIKEN full-length
            enriched library, clone:A930033P03 product:LEUCINE-RICH
            REPEATS CONTAINING F-BOX PROTEIN FBL3 homolog [Homo
            sapiens], full insert sequence.
          Length = 423

 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 33/83 (39%), Positives = 46/83 (55%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL  L +RG        D  LK I   C  L +L+L + S I+D+G+ +I  GCH+L+ L
Sbjct: 183  GLKALLLRGCTQLE---DEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQAL 239

Query: 1111 DLCQCPGITDKSLMAIAKSCPNL 1179
             L  C  +TD SL A+  +CP L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPRL 262



 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 27/72 (37%), Positives = 44/72 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L A+G  CP L+ L     S ++D     +A  CH+LEK+DL +C  ITD +L+ 
Sbjct: 247  LTDASLTALGLNCPRLQVLEAARCSHLTDASFTLLARNCHELEKMDLEECVLITDSTLVQ 306

Query: 1156 IAKSCPNLASVT 1191
            ++  CP L +++
Sbjct: 307  LSIHCPKLQALS 318



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            TDV    +   + R GG L KLS+RG     GV DS LK   + C ++  L+L   + I+
Sbjct: 62   TDVEGRVVENISKRCGGFLRKLSLRG---CIGVGDSSLKTFAQNCRNIEHLNLNGCTKIT 118

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            D   + ++  C +L+ LDL  C  +T+ SL  I++ C NL
Sbjct: 119  DSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNL 158



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC  L+AL L   + + DE L  I + CH+L  L+L  C  ITD  ++ 
Sbjct: 169  ITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQ 228

Query: 1156 IAKSCPNLASV 1188
            I + C  L ++
Sbjct: 229  ICRGCHRLQAL 239



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 24/68 (35%), Positives = 39/68 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G+  I RGC  L+AL L   S+++D  L  +   C +L+ L+  +C  +TD S   
Sbjct: 221  ITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDASFTL 280

Query: 1156 IAKSCPNL 1179
            +A++C  L
Sbjct: 281  LARNCHEL 288



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TDS   ++ R C  L+ L L +  S+++  L  I+ GC  LE L+L  C  IT 
Sbjct: 112  NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITK 171

Query: 1141 KSLMAIAKSCPNLASV 1188
            + + A+ + C  L ++
Sbjct: 172  EGIEALVRGCRGLKAL 187



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/71 (36%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VT+S LK I  GC +L  L+L     I+ EG+  +  GC  L+ L L  C  + D++L  
Sbjct: 143  VTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKH 202

Query: 1156 IAKSCPNLASV 1188
            I   C  L S+
Sbjct: 203  IQNHCHELVSL 213



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            +TDS L  +   CP L+ALSL +   I+DEG+  ++S   G  +L  L+L  C  +TD S
Sbjct: 299  ITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDAS 358

Query: 1147 L 1149
            L
Sbjct: 359  L 359



 Score = 40.8 bits (94), Expect = 0.054
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 1/103 (0%)
 Frame = +1

Query: 862  CLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSL 1038
            CL G    TD  L A+ +   R      L +        +TD+    + R C  L  + L
Sbjct: 240  CLSGCSNLTDASLTALGLNCPR------LQVLEAARCSHLTDASFTLLARNCHELEKMDL 293

Query: 1039 WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
                 I+D  L +++  C +L+ L L  C  ITD+ ++ ++ S
Sbjct: 294  EECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSS 336



>gb:BC059683_2552655 Danio rerio F-box and leucine-rich repeat protein
            20, mRNA (cDNA clone MGC:73374 IMAGE:4199271), complete
            cds.
          Length = 432

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 28/87 (32%), Positives = 49/87 (56%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL +   +    +TD+ L A+G  C  L+ L     S ++D G   +A  CH++EK+
Sbjct: 241  GCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKM 300

Query: 1111 DLCQCPGITDKSLMAIAKSCPNLASVT 1191
            DL +C  +TD +L+ ++  CP L +++
Sbjct: 301  DLEECILVTDNTLVQLSIHCPRLQALS 327



 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 3/73 (4%)
 Frame = +1

Query: 970  RGVT---DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            RG T   D+ LK + + CP L  +++ + + I+D+G   +  GCH+L+ + +  C  ITD
Sbjct: 199  RGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCSNITD 258

Query: 1141 KSLMAIAKSCPNL 1179
             SL A+  +C  L
Sbjct: 259  ASLTALGLNCQRL 271



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 22/71 (30%), Positives = 38/71 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T  G++A+ RGC +LRAL L   + + D  L  +   C +L  +++  C  ITD   ++
Sbjct: 178  ITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVS 237

Query: 1156 IAKSCPNLASV 1188
            + + C  L  V
Sbjct: 238  LCRGCHKLQMV 248



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 55/204 (26%), Positives = 85/204 (41%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LP E L  IF  L V    R  CA VSK W +L                     +G N  
Sbjct: 24   LPKELLLRIFSYLDVVTLCR--CAQVSKAWNVLAL-------------------DGSNWQ 62

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
             +     ++D  +G V  N+S+        GFL R L  +    V  A++         +
Sbjct: 63   KIDLFNFQTDI-EGRVVENISK-----RCGGFL-RQLSLRGCLSVGDASMKTFAQNCRNI 115

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
              L++ G      +TDS   ++ + C  LR L L +  SI++  L  ++ GC  LE L+L
Sbjct: 116  EHLNLNGCTK---ITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNL 172

Query: 1117 CQCPGITDKSLMAIAKSCPNLASV 1188
              C  IT   + A+++ C  L ++
Sbjct: 173  SWCDQITSDGIEALSRGCTALRAL 196



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 19/65 (29%), Positives = 36/65 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G  ++ RGC  L+ + +   S+I+D  L  +   C +L+ L+  +C  +TD     
Sbjct: 230  ITDDGFVSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTV 289

Query: 1156 IAKSC 1170
            +A++C
Sbjct: 290  LARNC 294



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/71 (32%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+  LKA+  GC  L  L+L     I+ +G+  ++ GC  L  L L  C  + D +L  
Sbjct: 152  ITNHALKALSEGCRMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCTQLDDTALKH 211

Query: 1156 IAKSCPNLASV 1188
            + K CP L ++
Sbjct: 212  LQKHCPELMTI 222



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS---GCHQLEKLDLCQCPGITDKS 1146
            VTD+ L  +   CP L+ALSL +   I+D+G+  ++S   G  +L+ ++L  CP ITD +
Sbjct: 308  VTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLITDIT 367

Query: 1147 LMAIAKSCPNLASV 1188
            L  + K+C  L  +
Sbjct: 368  LEHL-KNCQRLERI 380



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 11/119 (9%)
 Frame = +1

Query: 844  DGFLSRCLDGKKA-----------TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSG 990
            DGF+S C    K            TD  L A+ +   R      L I        VTD+G
Sbjct: 233  DGFVSLCRGCHKLQMVCISGCSNITDASLTALGLNCQR------LKILEAARCSHVTDAG 286

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
               + R C  +  + L     ++D  L +++  C +L+ L L  C  ITD  +  ++ S
Sbjct: 287  FTVLARNCHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSS 345



>gb:BC067906_1987553 Homo sapiens hypothetical protein LOC196394, mRNA
            (cDNA clone MGC:87706 IMAGE:5314530), complete cds.
          Length = 213

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 42/128 (32%), Positives = 63/128 (49%), Gaps = 1/128 (0%)
 Frame = +1

Query: 808  SNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFR-GVTD 984
            SN+SE+   E       + LD +       A + +   R+  L KL++  +   R  VT 
Sbjct: 8    SNISEILHPEV------QTLDLRSCDISDAALLHLSNCRK--LKKLNLNASKGNRVSVTS 59

Query: 985  SGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
             G+KA+   C  L   SL    +++DEG+  +A  C  L+ +DL  C  ITD SL A+ K
Sbjct: 60   EGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGK 119

Query: 1165 SCPNLASV 1188
            +CP L  V
Sbjct: 120  NCPFLQCV 127



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSL 1149
            +TD  L A+G+ CP L+ +  ++ + +SD G+  + SG    +LE++ +  C  +TD ++
Sbjct: 109  ITDVSLHALGKNCPFLQCVD-FSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAV 167

Query: 1150 MAIAKSCPNL 1179
             A+   CP +
Sbjct: 168  EAVLTYCPQI 177



>gb:L14745_1386893 Caenorhabditis elegans cosmid C02F5, complete
            sequence.
          Length = 466

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            DV+ A +     R GG L +LS++G  +   V DS L+     CP+L  LSL+    ++D
Sbjct: 108  DVKTAVVENLARRCGGFLKELSLKGCEN---VHDSALRTFTSRCPNLEHLSLYRCKRVTD 164

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
                 +   CH+L  L+L  C  ITD+++  I   CPNL+
Sbjct: 165  ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLS 204



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 37/111 (33%), Positives = 55/111 (49%)
 Frame = +1

Query: 847  GFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            GFL   L  K   +V  +A+   T+R   L  LS+      + VTD+  + +GR C  L 
Sbjct: 123  GFLKE-LSLKGCENVHDSALRTFTSRCPNLEHLSLY---RCKRVTDASCENLGRYCHKLN 178

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L+L N SSI+D  +  I  GC  L  L++  C  I D+ +  I  +C +L
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSL 229



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 42/72 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L ++G+   +L+ L L   + + D G   +A GC QLE+LD+  C  I+D ++ +
Sbjct: 292  ISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINS 351

Query: 1156 IAKSCPNLASVT 1191
            +A +C  L  ++
Sbjct: 352  LANNCTALRELS 363



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 54/197 (27%), Positives = 84/197 (42%), Gaps = 8/197 (4%)
 Frame = +1

Query: 574  VLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLL---STICRDELSTIKSGEASEPEEG 744
            VLP E L ++F  L      RSA   V + W +L    S   R +L T +          
Sbjct: 59   VLPKEVLLKVFSFLDTKALCRSA--QVCRSWSILALDGSNWQRVDLFTFQR--------- 107

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDG---FLSRCLDGKKATDVRLAAIAVG 915
            D  TA+   L +  +  GF++    +  +N        F SRC + +  +  R   +   
Sbjct: 108  DVKTAVVENLAR--RCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDA 165

Query: 916  TARRGG--LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            +    G    KL+     +   +TD  +K IG GCP+L  L++    +I D G+  I S 
Sbjct: 166  SCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSN 225

Query: 1090 CHQLEKLDLCQCPGITD 1140
            C  L+ L L  C G+T+
Sbjct: 226  CKSLDTLILRGCEGLTE 242



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 12/82 (14%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D+G   + RGC  L  L + + S ISD  +  +A+ C  L +L L  C  ITD+S+  +A
Sbjct: 320  DNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA 379

Query: 1162 K------------SCPNLASVT 1191
                         +CP L   T
Sbjct: 380  SKHRETLNVLELDNCPQLTDST 401



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  ++ I  G  +L  L + N + ISD  L  +    H L+ L+L  C  + D   + 
Sbjct: 266  LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIP 325

Query: 1156 IAKSCPNL 1179
            +A+ C  L
Sbjct: 326  LARGCRQL 333



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ-LEKLDLCQCPGITDKSL 1149
            ++D  + ++   C +LR LSL +   I+DE +  +AS   + L  L+L  CP +TD +L
Sbjct: 344  ISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTL 402



>pir|S44609|S44609 hypothetical protein C02F5.7 - Caenorhabditis
            elegans
          Length = 489

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            DV+ A +     R GG L +LS++G  +   V DS L+     CP+L  LSL+    ++D
Sbjct: 108  DVKTAVVENLARRCGGFLKELSLKGCEN---VHDSALRTFTSRCPNLEHLSLYRCKRVTD 164

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
                 +   CH+L  L+L  C  ITD+++  I   CPNL+
Sbjct: 165  ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLS 204



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 37/111 (33%), Positives = 55/111 (49%)
 Frame = +1

Query: 847  GFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            GFL   L  K   +V  +A+   T+R   L  LS+      + VTD+  + +GR C  L 
Sbjct: 123  GFLKE-LSLKGCENVHDSALRTFTSRCPNLEHLSLY---RCKRVTDASCENLGRYCHKLN 178

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L+L N SSI+D  +  I  GC  L  L++  C  I D+ +  I  +C +L
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSL 229



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 42/72 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L ++G+   +L+ L L   + + D G   +A GC QLE+LD+  C  I+D ++ +
Sbjct: 292  ISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINS 351

Query: 1156 IAKSCPNLASVT 1191
            +A +C  L  ++
Sbjct: 352  LANNCTALRELS 363



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 54/197 (27%), Positives = 84/197 (42%), Gaps = 8/197 (4%)
 Frame = +1

Query: 574  VLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLL---STICRDELSTIKSGEASEPEEG 744
            VLP E L ++F  L      RSA   V + W +L    S   R +L T +          
Sbjct: 59   VLPKEVLLKVFSFLDTKALCRSA--QVCRSWSILALDGSNWQRVDLFTFQR--------- 107

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDG---FLSRCLDGKKATDVRLAAIAVG 915
            D  TA+   L +  +  GF++    +  +N        F SRC + +  +  R   +   
Sbjct: 108  DVKTAVVENLAR--RCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDA 165

Query: 916  TARRGG--LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            +    G    KL+     +   +TD  +K IG GCP+L  L++    +I D G+  I S 
Sbjct: 166  SCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSN 225

Query: 1090 CHQLEKLDLCQCPGITD 1140
            C  L+ L L  C G+T+
Sbjct: 226  CKSLDTLILRGCEGLTE 242



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 12/82 (14%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D+G   + RGC  L  L + + S ISD  +  +A+ C  L +L L  C  ITD+S+  +A
Sbjct: 320  DNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA 379

Query: 1162 K------------SCPNLASVT 1191
                         +CP L   T
Sbjct: 380  SKHRETLNVLELDNCPQLTDST 401



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  ++ I  G  +L  L + N + ISD  L  +    H L+ L+L  C  + D   + 
Sbjct: 266  LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIP 325

Query: 1156 IAKSCPNL 1179
            +A+ C  L
Sbjct: 326  LARGCRQL 333



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ-LEKLDLCQCPGITDKSL 1149
            ++D  + ++   C +LR LSL +   I+DE +  +AS   + L  L+L  CP +TD +L
Sbjct: 344  ISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTL 402



>sp|P34284|YKK7_CAEEL Hypothetical F-box/LRR-repeat protein C02F5.7 in
            chromosome III.>gb:L14745_1386894 Caenorhabditis elegans
            cosmid C02F5, complete sequence.
          Length = 461

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            DV+ A +     R GG L +LS++G  +   V DS L+     CP+L  LSL+    ++D
Sbjct: 108  DVKTAVVENLARRCGGFLKELSLKGCEN---VHDSALRTFTSRCPNLEHLSLYRCKRVTD 164

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
                 +   CH+L  L+L  C  ITD+++  I   CPNL+
Sbjct: 165  ASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLS 204



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 37/111 (33%), Positives = 55/111 (49%)
 Frame = +1

Query: 847  GFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            GFL   L  K   +V  +A+   T+R   L  LS+      + VTD+  + +GR C  L 
Sbjct: 123  GFLKE-LSLKGCENVHDSALRTFTSRCPNLEHLSLY---RCKRVTDASCENLGRYCHKLN 178

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L+L N SSI+D  +  I  GC  L  L++  C  I D+ +  I  +C +L
Sbjct: 179  YLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSL 229



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 22/72 (30%), Positives = 42/72 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L ++G+   +L+ L L   + + D G   +A GC QLE+LD+  C  I+D ++ +
Sbjct: 292  ISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINS 351

Query: 1156 IAKSCPNLASVT 1191
            +A +C  L  ++
Sbjct: 352  LANNCTALRELS 363



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 54/197 (27%), Positives = 84/197 (42%), Gaps = 8/197 (4%)
 Frame = +1

Query: 574  VLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLL---STICRDELSTIKSGEASEPEEG 744
            VLP E L ++F  L      RSA   V + W +L    S   R +L T +          
Sbjct: 59   VLPKEVLLKVFSFLDTKALCRSA--QVCRSWSILALDGSNWQRVDLFTFQR--------- 107

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDG---FLSRCLDGKKATDVRLAAIAVG 915
            D  TA+   L +  +  GF++    +  +N        F SRC + +  +  R   +   
Sbjct: 108  DVKTAVVENLAR--RCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDA 165

Query: 916  TARRGG--LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            +    G    KL+     +   +TD  +K IG GCP+L  L++    +I D G+  I S 
Sbjct: 166  SCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSN 225

Query: 1090 CHQLEKLDLCQCPGITD 1140
            C  L+ L L  C G+T+
Sbjct: 226  CKSLDTLILRGCEGLTE 242



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 12/82 (14%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D+G   + RGC  L  L + + S ISD  +  +A+ C  L +L L  C  ITD+S+  +A
Sbjct: 320  DNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA 379

Query: 1162 K------------SCPNLASVT 1191
                         +CP L   T
Sbjct: 380  SKHRETLNVLELDNCPQLTDST 401



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/68 (29%), Positives = 33/68 (48%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  ++ I  G  +L  L + N + ISD  L  +    H L+ L+L  C  + D   + 
Sbjct: 266  LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIP 325

Query: 1156 IAKSCPNL 1179
            +A+ C  L
Sbjct: 326  LARGCRQL 333



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ-LEKLDLCQCPGITDKSL 1149
            ++D  + ++   C +LR LSL +   I+DE +  +AS   + L  L+L  CP +TD +L
Sbjct: 344  ISDHTINSLANNCTALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTDSTL 402



>gb:AE013599_1131302 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003825_1226396 Drosophila melanogaster
            chromosome 2R, section 25 of 74 of the complete sequence.
          Length = 464

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 60/212 (28%), Positives = 94/212 (44%), Gaps = 8/212 (3%)
 Frame = +1

Query: 568  IEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLML-LSTICRDELSTIKSGEASEPEEG 744
            I+ LP E L  +F  L V    R  CA V K W +L L      +++        E    
Sbjct: 53   IKQLPKEVLLRVFSYLDVVSLCR--CAQVCKYWNVLALDGSSWQKINLFDFQRDIEGPVI 110

Query: 745  DNATAMQPELIKS-------DKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAA 903
            +N +      +KS          D  V++  +   + E  D  LS C   KK TD+   +
Sbjct: 111  ENISQRCRGFLKSLSLRGCQSVGDQSVRTLANHCHNIEHLD--LSDC---KKITDISTQS 165

Query: 904  IAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            I+   +      KL+    +S   +TD+ LK +  GCP+L  +++     IS+ G+  +A
Sbjct: 166  ISRYCS------KLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALA 219

Query: 1084 SGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             GC +L K     C  I D ++M +AK CP+L
Sbjct: 220  RGCVKLRKFSSKGCKQINDNAIMCLAKYCPDL 251



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            +S+C D    TD+ L +++        L  L + G  +F   TD G +A+GR C  L  +
Sbjct: 282  VSKCAD---LTDLTLLSLS---QHNHLLNTLEVSGCRNF---TDIGFQALGRNCKYLERM 332

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
             L   S I+D  L  +A+GC  LEKL L  C  ITD  +
Sbjct: 333  DLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGI 371



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 21/78 (26%), Positives = 47/78 (60%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G  KL    +   + + D+ +  + + CP L  L+L +  +I+D  + ++A+ CH+L+KL
Sbjct: 221  GCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKL 280

Query: 1111 DLCQCPGITDKSLMAIAK 1164
             + +C  +TD +L+++++
Sbjct: 281  CVSKCADLTDLTLLSLSQ 298



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 29/88 (32%), Positives = 44/88 (50%)
 Frame = +1

Query: 925  RGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE 1104
            RG L  LS+RG  S   V D  ++ +   C ++  L L +   I+D     I+  C +L 
Sbjct: 118  RGFLKSLSLRGCQS---VGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLT 174

Query: 1105 KLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             ++L  C  ITD SL  ++  CPNL  +
Sbjct: 175  AINLHSCSNITDNSLKYLSDGCPNLMEI 202



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG---CHQLEKLDLCQCPGITDKS 1146
            +TD  L  +  GCPSL  L+L +   I+D+G+  + +G      L  L+L  CP ITD++
Sbjct: 340  ITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRT 399

Query: 1147 LMAIAKSCPNLASV 1188
            L  +  SC NL  +
Sbjct: 400  LEHLV-SCHNLQRI 412



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  L ++ +    L  L +    + +D G   +   C  LE++DL +C  ITD +L  
Sbjct: 288  LTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAH 347

Query: 1156 IAKSCPNLASVT 1191
            +A  CP+L  +T
Sbjct: 348  LATGCPSLEKLT 359



>gb:AF176701_1888028 Homo sapiens F-box protein FBL9 mRNA, partial
            cds.
          Length = 313

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 28/68 (41%), Positives = 45/68 (66%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+GL A+ RGCPSL  L+L + S +SD+G  + AS   +L+ L+L  C  + +++L A
Sbjct: 203  LTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDA 262

Query: 1156 IAKSCPNL 1179
            I ++C  L
Sbjct: 263  IGQACRQL 270



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 22/53 (41%), Positives = 28/53 (52%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LR LSL  +  ++D GL  +A GC  LE L L  C  ++DK     A S P L
Sbjct: 192  LRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRL 244



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +L+ L L   S ++D  L ++     QL +L L   P +TD  L+A+A+ CP+L
Sbjct: 166  ALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPSL 218



>gb:AK175607_1817595 Arabidopsis thaliana mRNA, partial cds, clone:
            RAFL22-08-D10.>gb:AK175925_1817913 Arabidopsis thaliana
            mRNA, partial cds, clone: RAFL22-58-M23.
          Length = 169

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 40/62 (64%)
 Frame = +1

Query: 1003 GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            G  C  L++L+L    +ISD+G+  +A GC  L  LDLC C  ITD+S++A+A  C +L 
Sbjct: 1    GENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLR 60

Query: 1183 SV 1188
            S+
Sbjct: 61   SL 62



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 23/64 (35%), Positives = 39/64 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D G+ ++  GCP LR L L +   I+DE +  +A+ C  L  L L  C  ITD+++ +
Sbjct: 18   ISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYS 77

Query: 1156 IAKS 1167
            +A+S
Sbjct: 78   LAQS 81



>gb:AE014297_1139799 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003711_1221792 Drosophila melanogaster
            chromosome 3R, section 49 of 118 of the complete
            sequence.>gb:AY058675_1291829 Drosophila melanogaster
            LD38495 full length cDNA.
          Length = 772

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 28/72 (38%), Positives = 45/72 (62%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GLK I R C  LR L+     ++SD+ +  +A  C +L  LD+ +C  ++D  L A
Sbjct: 645  VSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKC-DVSDAGLRA 703

Query: 1156 IAKSCPNLASVT 1191
            +A+SCPNL  ++
Sbjct: 704  LAESCPNLKKLS 715



 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 39/111 (35%), Positives = 51/111 (45%)
 Frame = +1

Query: 847  GFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
            G   R L   K   V  A + V   R   L  L+ RG  +   V+D  +  + R CP LR
Sbjct: 631  GAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEA---VSDDSITVLARSCPRLR 687

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            AL +     +SD GL  +A  C  L+KL L  C  ITD+ +  IA  C  L
Sbjct: 688  ALDIGKCD-VSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRGL 737



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GL  + +   +LR LS+     +SD GL  IA  C++L  L+   C  ++D S+  
Sbjct: 619  ITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITV 678

Query: 1156 IAKSCPNLASV 1188
            +A+SCP L ++
Sbjct: 679  LARSCPRLRAL 689



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 24/65 (36%), Positives = 41/65 (63%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GL+A+   CP+L+ LSL +   I+D G+  IA  C  L++L++  CP ++ +   A
Sbjct: 696  VSDAGLRALAESCPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDCP-VSIEGYRA 754

Query: 1156 IAKSC 1170
            + K C
Sbjct: 755  VKKYC 759



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 26/68 (38%), Positives = 40/68 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD+GLK +   C SL+ LS+ +  +I+D GL+E+A     L  L + +C  ++D  L  
Sbjct: 593  VTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKV 652

Query: 1156 IAKSCPNL 1179
            IA+ C  L
Sbjct: 653  IARRCYKL 660



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 23/63 (36%), Positives = 33/63 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D GLK + + CP L  L L     ++D GL  + S C  L++L +  C  ITD  L  
Sbjct: 567  IDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYE 626

Query: 1156 IAK 1164
            +AK
Sbjct: 627  LAK 629



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 27/96 (28%), Positives = 38/96 (39%), Gaps = 28/96 (29%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEI-----------ASGCHQ-------- 1098
            ++D GL+ + R CP L  L L     I+++ L E             +GC Q        
Sbjct: 487  ISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNLQHLDVTGCSQVSSISPNP 546

Query: 1099 ---------LEKLDLCQCPGITDKSLMAIAKSCPNL 1179
                     L+ LDL  C  I D  L  + K+CP L
Sbjct: 547  HMEPPRRLLLQYLDLTDCMAIDDMGLKIVVKNCPQL 582



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            CP +  + L +   ISD+GL  +   C +L  L L  C  IT+++L+     C NL
Sbjct: 473  CPEVERVMLADGCRISDKGLQLLTRRCPELTHLQLQTCVDITNQALVEALTKCSNL 528



>sp|Q8WV35|FXL9_HUMAN F-box/LRR-repeat protein 9 (F-box and
            leucine-rich repeat protein 9) (F-box protein
            FBL9).>gb:AX399882_1467195 Sequence 53 from Patent
            WO0218424.>gb:BC018785_1976641 Homo sapiens leucine rich
            repeat containing 29, transcript variant 1, mRNA (cDNA
            clone MGC:32109 IMAGE:4875646), complete cds.
          Length = 223

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 28/68 (41%), Positives = 45/68 (66%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+GL A+ RGCPSL  L+L + S +SD+G  + AS   +L+ L+L  C  + +++L A
Sbjct: 113  LTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDA 172

Query: 1156 IAKSCPNL 1179
            I ++C  L
Sbjct: 173  IGQACRQL 180



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 22/53 (41%), Positives = 28/53 (52%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LR LSL  +  ++D GL  +A GC  LE L L  C  ++DK     A S P L
Sbjct: 102  LRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRL 154



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +L+ L L   S ++D  L ++     QL +L L   P +TD  L+A+A+ CP+L
Sbjct: 76   ALQELDLTACSKLTDASLAKVLQFL-QLRQLSLSLLPELTDNGLVAVARGCPSL 128



>gb:NC18F11_1688417 Neurospora crassa DNA linkage group V Cosmid
            contig 18F11.
          Length = 783

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 30/105 (28%), Positives = 56/105 (53%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            K+ TD  L  +        GL  L I G      +T++ + A+   C  L+ L++ N + 
Sbjct: 179  KRITDAGLLKLLRNNT---GLLALDISG---MEDITETSINAVAEKCSRLQGLNISNCTK 232

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            IS   L ++A  C  +++L L +C  +TD++++A A++CPN+  +
Sbjct: 233  ISIASLVQLAQSCRFIKRLKLNECAQVTDEAVIAFAENCPNILEI 277



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 19/64 (29%), Positives = 37/64 (57%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R +TD+ + AI R   +L  + L +  +I+DE +  +   C+++  +DL  C  +TD S+
Sbjct: 363  RNITDAAVFAIARLGKNLHYVHLGHCGNITDEAVKRLVQCCNRIRYIDLGCCVHLTDDSV 422

Query: 1150 MAIA 1161
            + +A
Sbjct: 423  VRLA 426



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LR L L + S ++D  + +I     +L  L L +C  ITD ++ AIA+   NL
Sbjct: 328  LRILDLTSCSRLTDRAVEKIIDVAPRLRNLVLAKCRNITDAAVFAIARLGKNL 380



>gb:BT005940_1638862 Arabidopsis thaliana At5g27920 gene, complete
            cds.>gb:AK117239_1815284 Arabidopsis thaliana At5g27920
            mRNA for unknown protein, complete cds, clone:
            RAFL16-79-B21.
          Length = 642

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 29/69 (42%), Positives = 44/69 (63%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            GV D GL+ I + C +L+ L L   ++ISD+G+F I S C +L +LDL +C G  D  L 
Sbjct: 415  GVNDRGLEYISK-CSNLQRLKLGLCTNISDKGIFHIGSKCSKLLELDLYRCAGFGDDGLA 473

Query: 1153 AIAKSCPNL 1179
            A+++ C +L
Sbjct: 474  ALSRGCKSL 482



 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 24/71 (33%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+DS L ++   C SL  + L     ++D G+  +A  C  L+ L+L  C  +TD ++ A
Sbjct: 312  VSDSSLVSLSSSCRSLMEIGLSRCVDVTDIGMISLARNCLNLKTLNLACCGFVTDVAISA 371

Query: 1156 IAKSCPNLASV 1188
            +A+SC NL ++
Sbjct: 372  VAQSCRNLGTL 382



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 2/111 (1%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            LSRC+D    TD+ + ++A        L  L+  G      VTD  + A+ + C +L  L
Sbjct: 332  LSRCVD---VTDIGMISLARNCLNLKTLN-LACCGF-----VTDVAISAVAQSCRNLGTL 382

Query: 1033 SLWNISSISDEGLFEIASGCHQL--EKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L +   I+++GL  +  GC+ +  ++LDL  C G+ D+ L  I+K C NL
Sbjct: 383  KLESCHLITEKGLQSL--GCYSMLVQELDLTDCYGVNDRGLEYISK-CSNL 430



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D G+  IG  C  L  L L+  +   D+GL  ++ GC  L +L L  C  +TD  +  
Sbjct: 441  ISDKGIFHIGSKCSKLLELDLYRCAGFGDDGLAALSRGCKSLNRLILSYCCELTDTGVEQ 500

Query: 1156 I 1158
            I
Sbjct: 501  I 501



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 30/97 (30%), Positives = 38/97 (39%), Gaps = 25/97 (25%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRAL-------------------------SLWNISSISDEGLFE 1077
            G  D GL A+ RGC SL  L                          L  + +I+  GL  
Sbjct: 466  GFGDDGLAALSRGCKSLNRLILSYCCELTDTGVEQIRQLELLSHLELRGLKNITGVGLAA 525

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            IASGC +L  LD+  C  I D    A+A    NL  +
Sbjct: 526  IASGCKKLGYLDVKLCENIDDSGFWALAYFSKNLRQI 562



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 25/85 (29%), Positives = 40/85 (47%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L  L +RG  +  GV   GL AI  GC  L  L +    +I D G + +A     L +++
Sbjct: 507  LSHLELRGLKNITGV---GLAAIASGCKKLGYLDVKLCENIDDSGFWALAYFSKNLRQIN 563

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            LC C  ++D +L  +  +   +  V
Sbjct: 564  LCNC-SVSDTALCMLMSNLSRVQDV 587



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LR L +    S+SD GL  I  GC  L K+ L  C  I+D  +  + K C  L S+
Sbjct: 148  LRELKMDKCLSLSDVGLARIVVGCSNLNKISLKWCMEISDLGIDLLCKICKGLKSL 203



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 30/101 (29%), Positives = 48/101 (47%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            K  T V LAAIA G  +   LG L ++       + DSG  A+     +LR ++L N S 
Sbjct: 516  KNITGVGLAAIASGCKK---LGYLDVK---LCENIDDSGFWALAYFSKNLRQINLCNCS- 568

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPN 1176
            +SD  L  + S   +++ +DL     +T +      ++C N
Sbjct: 569  VSDTALCMLMSNLSRVQDVDLVHLSRVTVEGFEFALRACCN 609



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 1/117 (0%)
 Frame = +1

Query: 841  GDGFLSRCLDGKKATDVRLAAIAVGTARRGGL-GKLSIRGNNSFRGVTDSGLKAIGRGCP 1017
            G   L +   G K+ DV    I   + R   L  KL +    S   + D GL+ +  G P
Sbjct: 189  GIDLLCKICKGLKSLDVSYLKITNDSIRSIALLVKLEVLDMVSCPLIDDGGLQFLENGSP 248

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SL+ + +     +S  GL  I  G   ++ L    C      S +   K   +L ++
Sbjct: 249  SLQEVDVTRCDRVSLSGLISIVRGHPDIQLLKASHCVSEVSGSFLKYIKGLKHLKTI 305



>gb:CR859619_1183726 Pongo pygmaeus mRNA; cDNA DKFZp459G1413 (from
            clone DKFZp459G1413).
          Length = 258

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 44/145 (30%), Positives = 69/145 (47%), Gaps = 2/145 (1%)
 Frame = +1

Query: 760  MQPELIKSDKKDGFV-QSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
            ++  LIK     G +  SN+SE+   E       + LD +       A + +   R+  L
Sbjct: 36   IKDRLIKIMSMQGRITDSNISEILHPEV------QTLDLRSCDISDAALLHLSNCRK--L 87

Query: 937  GKLSIRGNNSFR-GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
             KL++  +   R  VT  G+K +   C  L   SL    +++DEG+  +A  C  L+ ++
Sbjct: 88   KKLNLNASKGNRVSVTSEGIKVVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIN 147

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            L  C  ITD SL A+ K+CP L  V
Sbjct: 148  LGGCLSITDVSLHALGKNCPFLQCV 172



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/70 (30%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSL 1149
            +TD  L A+G+ CP L+ +  ++ + +SD G+  + SG    +LE++ +  C  +TD ++
Sbjct: 154  ITDVSLHALGKNCPFLQCVD-FSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAV 212

Query: 1150 MAIAKSCPNL 1179
             A+   CP +
Sbjct: 213  EAVLTYCPQI 222



>gb:AE016959_1022420 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC108884_1738679 Oryza sativa
            (japonica cultivar-group) cultivar Nipponbare clone
            OSJNBb0058B20 from chromosome 10, complete
            sequence.>gb:AC122144_1740254 Oryza sativa (japonica
            cultivar-group) chromosome 10 clone OSJNAa0011L09,
            complete sequence.>gb:AE017090_1752239 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 44 of 77
            of the complete sequence.
          Length = 1152

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 46/180 (25%), Positives = 73/180 (40%), Gaps = 1/180 (0%)
 Frame = +1

Query: 646  AGVSKRWLMLLSTI-CRDELSTIKSGEASEPEEGDNATAMQPELIKSDKKDGFVQSNVSE 822
            +GV    L+++  I C   L T+  G+    E      +  P L      D  + S + E
Sbjct: 284  SGVPHAELLVMEAITCLRHLKTLIMGKGQLGEAFFQLLSECPLLTTLTVSDASLGSGIQE 343

Query: 823  VQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAI 1002
            V  N +G   L           VR + + + + RR G+  +S+                 
Sbjct: 344  VTVNHDGLRELQILKCRALRISVRCSQLQILSLRRTGMAHVSLN---------------- 387

Query: 1003 GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
               CP L  L   +   +SD  + + A+ C  L  LD+  C  +TD++L  IA SCPNL+
Sbjct: 388  ---CPQLVELDFQSCHKLSDNAIRQAATACPLLASLDMSSCSCVTDETLREIANSCPNLS 444



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)
 Frame = +1

Query: 1012 CPSLRA---LSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            C +LR     S   I S+   G+  ++  C QL +LD   C  ++D ++   A +CP LA
Sbjct: 359  CRALRISVRCSQLQILSLRRTGMAHVSLNCPQLVELDFQSCHKLSDNAIRQAATACPLLA 418

Query: 1183 SV 1188
            S+
Sbjct: 419  SL 420



>pir|T48752|T48752 GRR1 related protein [imported] - Neurospora crassa
             (fragment)
          Length = 364

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 30/105 (28%), Positives = 56/105 (53%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            K+ TD  L  +        GL  L I G      +T++ + A+   C  L+ L++ N + 
Sbjct: 196  KRITDAGLLKLLRNNT---GLLALDISG---MEDITETSINAVAEKCSRLQGLNISNCTK 249

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            IS   L ++A  C  +++L L +C  +TD++++A A++CPN+  +
Sbjct: 250  ISIASLVQLAQSCRFIKRLKLNECAQVTDEAVIAFAENCPNILEI 294



>gb:AP004067_1837165 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1581_H09.>gb:AP005513_1853182 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0014E22.
          Length = 316

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/69 (40%), Positives = 43/69 (62%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            GVTD G+  IG   PSL+++ + +   +SD+GL  +  GC  L +L +  C  ITD  L+
Sbjct: 16   GVTDVGMAKIGDRLPSLQSIDVSHCRKLSDKGLKAVLLGCQNLRQLVIAGCRLITDNLLI 75

Query: 1153 AIAKSCPNL 1179
            A++KSC +L
Sbjct: 76   ALSKSCIHL 84



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 27/132 (20%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            +K +D  L A+ +G      L +L I G    R +TD+ L A+ + C  L  L     ++
Sbjct: 41   RKLSDKGLKAVLLGCQN---LRQLVIAG---CRLITDNLLIALSKSCIHLEDLVAAGCNN 94

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQC-----PGIT----------------------DKSLM 1152
            I+D G+  +A GCH+++ LD+ +C     PG+                       DKS+ 
Sbjct: 95   ITDAGISGLADGCHKMKSLDMSKCNKVGDPGVCKFAEVSSSSLVSLKLLDCNKVGDKSIH 154

Query: 1153 AIAKSCPNLASV 1188
            A+AK C NL ++
Sbjct: 155  ALAKFCHNLETL 166



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 35/109 (32%), Positives = 51/109 (46%)
 Frame = +1

Query: 862  CLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLW 1041
            CL G   TDV +A I     R   L  + +   +  R ++D GLKA+  GC +LR L + 
Sbjct: 13   CLVG--VTDVGMAKIG---DRLPSLQSIDV---SHCRKLSDKGLKAVLLGCQNLRQLVIA 64

Query: 1042 NISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
                I+D  L  ++  C  LE L    C  ITD  +  +A  C  + S+
Sbjct: 65   GCRLITDNLLIALSKSCIHLEDLVAAGCNNITDAGISGLADGCHKMKSL 113



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 18/51 (35%), Positives = 30/51 (58%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            SL +L L + + + D+ +  +A  CH LE L +  C  +TD S+ A+A +C
Sbjct: 136  SLVSLKLLDCNKVGDKSIHALAKFCHNLETLVIGGCRDVTDASIEALAFAC 186



>gb:AY087448_1572479 Arabidopsis thaliana clone 35534 mRNA, complete
            sequence.
          Length = 353

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/77 (33%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSL-WNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            N  + ++D+G++AI   CP L+  S+ WN+  ++D G+  +   C  +  L+L  C  +T
Sbjct: 119  NVCQKISDNGIEAITSICPKLKVFSIYWNVR-VTDAGIRNLVKNCRHITDLNLSGCKSLT 177

Query: 1138 DKSLMAIAKSCPNLASV 1188
            DKS+  +A+S P+L S+
Sbjct: 178  DKSMQLVAESYPDLESL 194



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            + +TD  ++ +    P L +L++     I+D+GL ++   C  L+ L+L    G TDK+ 
Sbjct: 174  KSLTDKSMQLVAESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAY 233

Query: 1150 MAIA 1161
            M I+
Sbjct: 234  MKIS 237



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 31/93 (33%), Positives = 45/93 (48%), Gaps = 25/93 (26%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNIS-------------------------SISDEGLFEI 1080
            +TD GL  + + C SL+ L+L+ +S                         +ISDEG+  I
Sbjct: 202  ITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLLADLRFLDICGAQNISDEGIGHI 261

Query: 1081 ASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            A  C++LE L+L  C  ITD  +  IA SC +L
Sbjct: 262  AK-CNKLESLNLTWCVRITDAGVNTIANSCTSL 293



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH-QLEKLDLCQCPGITDKSLM 1152
            +TD+G+  I   C SL  LSL+ I  ++D  L  ++  C   L  LD+  C GI  +S  
Sbjct: 278  ITDAGVNTIANSCTSLEFLSLFGIVGVTDRCLETLSQTCSTTLTTLDVNGCTGIKRRSRE 337

Query: 1153 AIAKSCPNL 1179
             + +  P L
Sbjct: 338  ELLQMFPRL 346



>gb:AY054560_1563214 Arabidopsis thaliana putative protein (At3g58530;
            F14P22.120) mRNA, complete cds.>gb:AY064636_1566087
            Arabidopsis thaliana putative protein (At3g58530;
            F14P22.120) mRNA, complete cds.
          Length = 353

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/77 (33%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSL-WNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            N  + ++D+G++AI   CP L+  S+ WN+  ++D G+  +   C  +  L+L  C  +T
Sbjct: 119  NVCQKISDNGIEAITSICPKLKVFSIYWNVR-VTDAGIRNLVKNCRHITDLNLSGCKSLT 177

Query: 1138 DKSLMAIAKSCPNLASV 1188
            DKS+  +A+S P+L S+
Sbjct: 178  DKSMQLVAESYPDLESL 194



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 19/64 (29%), Positives = 35/64 (54%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            + +TD  ++ +    P L +L++     I+D+GL ++   C  L+ L+L    G TDK+ 
Sbjct: 174  KSLTDKSMQLVAESYPDLESLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAY 233

Query: 1150 MAIA 1161
            M I+
Sbjct: 234  MKIS 237



 Score = 41.2 bits (95), Expect = 0.042
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 25/93 (26%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNIS-------------------------SISDEGLFEI 1080
            +TD GL  + + C SL+ L+L+ +S                         +ISDEG+  I
Sbjct: 202  ITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLLADLRFLDICGAQNISDEGIGHI 261

Query: 1081 ASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            A  C++L  L+L  C  ITD  +  IA SC +L
Sbjct: 262  AK-CNKLGSLNLTWCVRITDAGVNTIANSCTSL 293



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH-QLEKLDLCQCPGITDKSLM 1152
            +TD+G+  I   C SL  LSL+ I  ++D  L  ++  C   L  LD+  C GI  +S  
Sbjct: 278  ITDAGVNTIANSCTSLEFLSLFGIVGVTDRCLETLSQTCSTTLTTLDVNGCTGIKRRSRE 337

Query: 1153 AIAKSCPNL 1179
             + +  P L
Sbjct: 338  ELLQMFPRL 346



>gb:AK126722_1916426 Homo sapiens cDNA FLJ44768 fis, clone
            BRACE3032631, highly similar to Mus musculus F-box
            protein FBX13.
          Length = 303

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA GC +L+++ + +   +TD+S+ A
Sbjct: 53   LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKA 112

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 113  FAEHCPELQYV 123



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 22/71 (30%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 27   LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIV 86

Query: 1156 IAKSCPNLASV 1188
            IAK C  L  +
Sbjct: 87   IAKGCLKLQRI 97



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 17/71 (23%), Positives = 34/71 (47%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+G+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L  
Sbjct: 1    MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ 60

Query: 1156 IAKSCPNLASV 1188
            +   C  L  +
Sbjct: 61   LGSKCRELKDI 71



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 105  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 162

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 163  IVKRCKNLSSL 173



>gb:HSM801456_1186185 Homo sapiens mRNA; cDNA DKFZp434C1715 (from
            clone DKFZp434C1715).
          Length = 314

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA GC +L+++ + +   +TD+S+ A
Sbjct: 53   LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKA 112

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 113  FAEHCPELQYV 123



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 22/71 (30%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 27   LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIV 86

Query: 1156 IAKSCPNLASV 1188
            IAK C  L  +
Sbjct: 87   IAKGCLKLQRI 97



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 17/71 (23%), Positives = 34/71 (47%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+G+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L  
Sbjct: 1    MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQ 60

Query: 1156 IAKSCPNLASV 1188
            +   C  L  +
Sbjct: 61   LGSKCRELKDI 71



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 105  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 162

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 163  IVKRCKNLSSL 173



>gb:AE013599_1133354 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003458_1210653 Drosophila melanogaster
            chromosome 2R, section 66 of 74 of the complete
            sequence.>gb:AF187980_1249186 Drosophila melanogaster
            Partner of Paired (ppa) mRNA, complete
            cds.>gb:AY119098_1300820 Drosophila melanogaster RE01138
            full insert cDNA.
          Length = 538

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 29/71 (40%), Positives = 43/71 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  I +G   LR+LSL N   I+D G+ +IA   H+LE L++ QC  ITDK L  
Sbjct: 436  ISDQALTHIAQGLYRLRSLSL-NQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQT 494

Query: 1156 IAKSCPNLASV 1188
            +A+   NL ++
Sbjct: 495  LAEDLTNLKTI 505



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 29/90 (32%), Positives = 47/90 (52%)
 Frame = +1

Query: 919  ARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ 1098
            AR   L +L++R   S   ++D G+  +  G   + +L +     ISD+ L  IA G ++
Sbjct: 394  ARMPKLEQLNLR---SCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYR 450

Query: 1099 LEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            L  L L QC  ITD  ++ IAK+   L ++
Sbjct: 451  LRSLSLNQCQ-ITDHGMLKIAKALHELENL 479



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 29/96 (30%), Positives = 44/96 (45%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K +D  L  IA G  R   L  LS+        +TD G+  I +    L  L++   S I
Sbjct: 435  KISDQALTHIAQGLYR---LRSLSLNQCQ----ITDHGMLKIAKALHELENLNIGQCSRI 487

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  +A     L+ +DL  C  ++ K +  I K
Sbjct: 488  TDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMK 523



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 17/103 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL KL      S   ++D G+       +    G   L  L L +   +SDE L  IA G
Sbjct: 311  GLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQG 370

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLASV 1188
               L+ ++L  C  +TD  L  +A          +SC N++ +
Sbjct: 371  LTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDI 413



>pir|T43444|T43444 hypothetical protein DKFZp434C1715.1 - human
            (fragment)
          Length = 381

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA GC +L+++ + +   +TD+S+ A
Sbjct: 120  LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKA 179

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 180  FAEHCPELQYV 190



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 22/71 (30%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 94   LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIV 153

Query: 1156 IAKSCPNLASV 1188
            IAK C  L  +
Sbjct: 154  IAKGCLKLQRI 164



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 18/73 (24%), Positives = 35/73 (47%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R ++D+G+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L
Sbjct: 66   RSMSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGL 125

Query: 1150 MAIAKSCPNLASV 1188
              +   C  L  +
Sbjct: 126  KQLGSKCRELKDI 138



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +S + VTD  L+ I     ++  +++ +  S+SD G+  +A  C  L +    +C  ++D
Sbjct: 37   SSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQLSD 96

Query: 1141 KSLMAIAKSCPNLASV 1188
             S++A+A  CP L  V
Sbjct: 97   TSIIAVASHCPLLQKV 112



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 172  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 229

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 230  IVKRCKNLSSL 240



>sp|Q9UF56|FX13_HUMAN F-box only protein 13 (Fragment).
          Length = 370

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 27/71 (38%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA GC +L+++ + +   +TD+S+ A
Sbjct: 120  LTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCLKLQRIYMQENKLVTDQSVKA 179

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 180  FAEHCPELQYV 190



 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 22/71 (30%), Positives = 42/71 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 94   LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIV 153

Query: 1156 IAKSCPNLASV 1188
            IAK C  L  +
Sbjct: 154  IAKGCLKLQRI 164



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 18/73 (24%), Positives = 35/73 (47%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R ++D+G+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L
Sbjct: 66   RSMSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGL 125

Query: 1150 MAIAKSCPNLASV 1188
              +   C  L  +
Sbjct: 126  KQLGSKCRELKDI 138



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +S + VTD  L+ I     ++  +++ +  S+SD G+  +A  C  L +    +C  ++D
Sbjct: 37   SSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQLSD 96

Query: 1141 KSLMAIAKSCPNLASV 1188
             S++A+A  CP L  V
Sbjct: 97   TSIIAVASHCPLLQKV 112



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 172  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 229

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 230  IVKRCKNLSSL 240



>gb:AE016959_1020937 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091665_1734853 Oryza sativa
            chromosome 10 clone OSJNBb0016M10, complete
            sequence.>gb:AE017056_1750756 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 10 of 77 of the
            complete sequence.
          Length = 628

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 28/78 (35%), Positives = 43/78 (55%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            NN+F G         GR C  L+++ L N   ISDE +  IA GC  L +L +  CP I 
Sbjct: 404  NNAFLG--------FGRCCFLLKSVCLANCCKISDEAISHIAQGCKNLRELSIISCPQIG 455

Query: 1138 DKSLMAIAKSCPNLASVT 1191
            D++L+++ ++C  L  +T
Sbjct: 456  DEALLSVGENCKELRELT 473



 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 35/101 (34%), Positives = 51/101 (50%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K +D  ++ IA G      L +LSI    S   + D  L ++G  C  LR L+L  +  +
Sbjct: 427  KISDEAISHIAQGCKN---LRELSII---SCPQIGDEALLSVGENCKELRELTLHGLGRL 480

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +D GL  +   C  LE+LD+C C  ITD  L  I + C +L
Sbjct: 481  NDTGLATVDQ-CRFLERLDICGCNQITDYGLTTIIRECHDL 520



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D+ L  +G G   L+ L +    +ISD GL +IA GC QLE   + +C  +T   + A
Sbjct: 531  IGDTTLAKVGEGFRKLKHLMMLRCDAISDVGLEDIARGCLQLEACGVFRCSQVTPAGVAA 590

Query: 1156 IAKSCPNLASV 1188
            +A     L  +
Sbjct: 591  LAGGSSRLQRI 601



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 28/82 (34%), Positives = 41/82 (50%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +L I G N    +TD GL  I R C  L  L++ +   I D  L ++  G  +L+ L 
Sbjct: 494  LERLDICGCNQ---ITDYGLTTIIRECHDLVHLNISDTKKIGDTTLAKVGEGFRKLKHLM 550

Query: 1114 LCQCPGITDKSLMAIAKSCPNL 1179
            + +C  I+D  L  IA+ C  L
Sbjct: 551  MLRCDAISDVGLEDIARGCLQL 572



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T   L AIG  C +L  LS+ +     ++G+  +A GC  L+ L +    G+ D++L A
Sbjct: 244  ITYRSLYAIGTYCHNLEVLSVESKHVNENKGMISVAKGCQYLKSLKMVWL-GVGDEALEA 302

Query: 1156 IAKSCPNLASVT 1191
            I  SC  L +++
Sbjct: 303  IGSSCSALENLS 314



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +1

Query: 1042 NISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            N +S +D GL  +  GC  LEKL L     I++K L+ IA  C NL S+
Sbjct: 136  NPTSFTDAGLLHLIEGCKGLEKLTLNWFLHISEKGLVGIANRCRNLQSL 184



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 48/202 (23%), Positives = 84/202 (41%), Gaps = 4/202 (1%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGG--QERSACAGVSKRWLMLLSTICRDELSTIKS--GEASEPEEG 744
            LPD+ L E+FRR+   G   +  +CA V +RW  +     R     +    G+A      
Sbjct: 12   LPDDLLAEVFRRVAAAGGKADLDSCALVCRRWRGVERASRRAARVPVDGPDGDAVVRCVA 71

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTAR 924
            D    +    +          S  +  +   +G    +  LD +    ++ + ++  T +
Sbjct: 72   DRFPGLADVFLDHGLYIAAGASAAAAERSRAQGWDNENPKLDEQH---MQCSTLSEDTQK 128

Query: 925  RGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE 1104
              G   ++     SF   TD+GL  +  GC  L  L+L     IS++GL  IA+ C  L+
Sbjct: 129  ENGSDGVN---PTSF---TDAGLLHLIEGCKGLEKLTLNWFLHISEKGLVGIANRCRNLQ 182

Query: 1105 KLDLCQCPGITDKSLMAIAKSC 1170
             L L     + +  L+ +A+ C
Sbjct: 183  SLAL-SGGYVQNHGLITLAEGC 203



>gb:AF174593_1887911 Homo sapiens F-box protein Fbl7 (FBL7) mRNA,
            partial cds.
          Length = 483

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 55/202 (27%), Positives = 80/202 (39%), Gaps = 2/202 (0%)
 Frame = +1

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            +K+QASI+ LPD  + +IF  LP    +   CA V +RW  L                  
Sbjct: 100  QKEQASIDRLPDHSMVQIFSFLPTN--QLCRCARVCRRWYNL------------------ 139

Query: 730  EPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSR--CLDGKKATDVRLAA 903
                     A  P L ++ +  G       E  + +     L+R  C D      + L  
Sbjct: 140  ---------AWDPRLWRTIRLTG-------ETINVDRALKVLTRRLCQDTPNVC-LMLET 182

Query: 904  IAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            + V   RR                +TD GL  I + CP LR L +    +IS+E +F++ 
Sbjct: 183  VTVSGCRR----------------LTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVV 226

Query: 1084 SGCHQLEKLDLCQCPGITDKSL 1149
            S C  LE LD+  C  +T  SL
Sbjct: 227  SLCPNLEHLDVSGCSKVTCISL 248



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 31/104 (29%), Positives = 55/104 (52%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            + TDV +  +A   ++   L  L+ RG     G+TD G++ + + C  L++L +     +
Sbjct: 354  RVTDVGIRYVAKYCSK---LRYLNARG---CEGITDHGVEYLAKNCTKLKSLDIGKCPLV 407

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SD GL  +A  C  L++L L  C  IT + L  +A +C +L ++
Sbjct: 408  SDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTL 451



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +1

Query: 850  FLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRA 1029
            +L RC+   + TD  L  + +  A    + +LS+   +  R V+D GL+ I +    LR 
Sbjct: 296  YLRRCV---RLTDEGLRYLVIYCA---SIKELSV---SDCRFVSDFGLREIAKLESRLRY 346

Query: 1030 LSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LS+ +   ++D G+  +A  C +L  L+   C GITD  +  +AK+C  L S+
Sbjct: 347  LSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSL 399



 Score = 40.4 bits (93), Expect = 0.071
 Identities = 20/65 (30%), Positives = 40/65 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GL+ +   C +L+ LSL +  SI+ +GL  +A+ C  L+ L++  C  ++ ++L  
Sbjct: 407  VSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE-VSVEALRF 465

Query: 1156 IAKSC 1170
            + + C
Sbjct: 466  VKRHC 470



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 16/56 (28%), Positives = 32/56 (57%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            C  L  +++     ++D GL+ IA  C +L +L++  C  I+++++  +   CPNL
Sbjct: 177  CLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL 232



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+R L + +   + DEGL  IA+ C QL  L L +C  +TD+ L  +   C ++  ++
Sbjct: 265  SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELS 322



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/61 (32%), Positives = 29/61 (47%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D GL  I   C  L  L L     ++DEGL  +   C  +++L +  C  ++D  L  IA
Sbjct: 279  DEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA 338

Query: 1162 K 1164
            K
Sbjct: 339  K 339



>gb:AB020647_1865245 Homo sapiens mRNA for KIAA0840 protein, partial
            cds.
          Length = 523

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 55/202 (27%), Positives = 80/202 (39%), Gaps = 2/202 (0%)
 Frame = +1

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            +K+QASI+ LPD  + +IF  LP    +   CA V +RW  L                  
Sbjct: 140  QKEQASIDRLPDHSMVQIFSFLPTN--QLCRCARVCRRWYNL------------------ 179

Query: 730  EPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSR--CLDGKKATDVRLAA 903
                     A  P L ++ +  G       E  + +     L+R  C D      + L  
Sbjct: 180  ---------AWDPRLWRTIRLTG-------ETINVDRALKVLTRRLCQDTPNVC-LMLET 222

Query: 904  IAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            + V   RR                +TD GL  I + CP LR L +    +IS+E +F++ 
Sbjct: 223  VTVSGCRR----------------LTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVV 266

Query: 1084 SGCHQLEKLDLCQCPGITDKSL 1149
            S C  LE LD+  C  +T  SL
Sbjct: 267  SLCPNLEHLDVSGCSKVTCISL 288



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 31/104 (29%), Positives = 55/104 (52%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            + TDV +  +A   ++   L  L+ RG     G+TD G++ + + C  L++L +     +
Sbjct: 394  RVTDVGIRYVAKYCSK---LRYLNARG---CEGITDHGVEYLAKNCTKLKSLDIGKCPLV 447

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SD GL  +A  C  L++L L  C  IT + L  +A +C +L ++
Sbjct: 448  SDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTL 491



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +1

Query: 850  FLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRA 1029
            +L RC+   + TD  L  + +  A    + +LS+   +  R V+D GL+ I +    LR 
Sbjct: 336  YLRRCV---RLTDEGLRYLVIYCA---SIKELSV---SDCRFVSDFGLREIAKLESRLRY 386

Query: 1030 LSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LS+ +   ++D G+  +A  C +L  L+   C GITD  +  +AK+C  L S+
Sbjct: 387  LSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSL 439



 Score = 40.4 bits (93), Expect = 0.071
 Identities = 20/65 (30%), Positives = 40/65 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GL+ +   C +L+ LSL +  SI+ +GL  +A+ C  L+ L++  C  ++ ++L  
Sbjct: 447  VSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE-VSVEALRF 505

Query: 1156 IAKSC 1170
            + + C
Sbjct: 506  VKRHC 510



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 16/56 (28%), Positives = 32/56 (57%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            C  L  +++     ++D GL+ IA  C +L +L++  C  I+++++  +   CPNL
Sbjct: 217  CLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL 272



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+R L + +   + DEGL  IA+ C QL  L L +C  +TD+ L  +   C ++  ++
Sbjct: 305  SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELS 362



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/61 (32%), Positives = 29/61 (47%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D GL  I   C  L  L L     ++DEGL  +   C  +++L +  C  ++D  L  IA
Sbjct: 319  DEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA 378

Query: 1162 K 1164
            K
Sbjct: 379  K 379



>gb:AK032391_1162894 Mus musculus adult male olfactory brain cDNA,
            RIKEN full-length enriched library, clone:6430536M17
            product:F-BOX PROTEIN FBL5 homolog [Homo sapiens], full
            insert sequence.>gb:AK051429_1169684 Mus musculus 12 days
            embryo spinal ganglion cDNA, RIKEN full-length enriched
            library, clone:D130048H07 product:F-BOX PROTEIN FBL5
            homolog [Homo sapiens], full insert sequence.
          Length = 621

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCP 1173
            IG  C +LR L LW   +I++ G+ E+ASGC  LE+LDL  CP +   +   + +A+  P
Sbjct: 474  IGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELDLGWCPTLQSSTGCFVRLARQLP 533

Query: 1174 NL 1179
            NL
Sbjct: 534  NL 535



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 19/61 (31%), Positives = 35/61 (57%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            + R  P+L+ L L    S+ D  + E+AS C +L++LD+     ++  SL  + +SC +L
Sbjct: 528  LARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVSPASLRKLLESCKDL 587

Query: 1180 A 1182
            +
Sbjct: 588  S 588



>pir|E85358|E85358 hypothetical protein AT4g30640 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV73_1546985 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No. 73.
          Length = 301

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 57/204 (27%), Positives = 82/204 (40%), Gaps = 3/204 (1%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAG--VSKRWLMLLSTICRDE-LSTIKSGEASEPEEGD 747
            L  ECL +IF RL    QE+       VSK W+      C D  L+TI   E       +
Sbjct: 23   LTRECLLDIFSRL---SQEQRWIGPMLVSKNWM----NACYDPTLNTIFDLETRFLSFPE 75

Query: 748  NATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARR 927
            +     PE    DK D F++S    V D  EG             T++R+          
Sbjct: 76   SINWWTPEF--EDKVDSFLRS----VVDRSEGG-----------LTEIRI---------- 108

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
                          R  T+  L      CP+L  L + N  +++D  + +IA  C  L +
Sbjct: 109  --------------RHCTERSLSYAAERCPNLEVLWIKNCPNVTDASMEKIAMNCPNLRE 154

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LD+    GIT +SL+ + +SC NL
Sbjct: 155  LDISYSYGITHESLITLGRSCQNL 178



>sp|Q9UJT9|FXL7_HUMAN F-box/LRR-repeat protein 7 (F-box and
            leucine-rich repeat protein 7).>gb:AF199356_1889696 Homo
            sapiens F-box protein FBL6 (FBL6) mRNA, complete
            cds.>gb:BC075061_1989560 Homo sapiens F-box and
            leucine-rich repeat protein 7, mRNA (cDNA clone
            MGC:104130 IMAGE:30915585), complete cds.
          Length = 491

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 55/202 (27%), Positives = 80/202 (39%), Gaps = 2/202 (0%)
 Frame = +1

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            +K+QASI+ LPD  + +IF  LP    +   CA V +RW  L                  
Sbjct: 108  QKEQASIDRLPDHSMVQIFSFLPTN--QLCRCARVCRRWYNL------------------ 147

Query: 730  EPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSR--CLDGKKATDVRLAA 903
                     A  P L ++ +  G       E  + +     L+R  C D      + L  
Sbjct: 148  ---------AWDPRLWRTIRLTG-------ETINVDRALKVLTRRLCQDTPNVC-LMLET 190

Query: 904  IAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            + V   RR                +TD GL  I + CP LR L +    +IS+E +F++ 
Sbjct: 191  VTVSGCRR----------------LTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVV 234

Query: 1084 SGCHQLEKLDLCQCPGITDKSL 1149
            S C  LE LD+  C  +T  SL
Sbjct: 235  SLCPNLEHLDVSGCSKVTCISL 256



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 31/104 (29%), Positives = 55/104 (52%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            + TDV +  +A   ++   L  L+ RG     G+TD G++ + + C  L++L +     +
Sbjct: 362  RVTDVGIRYVAKYCSK---LRYLNARG---CEGITDHGVEYLAKNCTKLKSLDIGKCPLV 415

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SD GL  +A  C  L++L L  C  IT + L  +A +C +L ++
Sbjct: 416  SDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTL 459



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 35/113 (30%), Positives = 59/113 (52%)
 Frame = +1

Query: 850  FLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRA 1029
            +L RC+   + TD  L  + +  A    + +LS+   +  R V+D GL+ I +    LR 
Sbjct: 304  YLRRCV---RLTDEGLRYLVIYCA---SIKELSV---SDCRFVSDFGLREIAKLESRLRY 354

Query: 1030 LSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LS+ +   ++D G+  +A  C +L  L+   C GITD  +  +AK+C  L S+
Sbjct: 355  LSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSL 407



 Score = 40.4 bits (93), Expect = 0.071
 Identities = 20/65 (30%), Positives = 40/65 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GL+ +   C +L+ LSL +  SI+ +GL  +A+ C  L+ L++  C  ++ ++L  
Sbjct: 415  VSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCE-VSVEALRF 473

Query: 1156 IAKSC 1170
            + + C
Sbjct: 474  VKRHC 478



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 16/56 (28%), Positives = 32/56 (57%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            C  L  +++     ++D GL+ IA  C +L +L++  C  I+++++  +   CPNL
Sbjct: 185  CLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL 240



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+R L + +   + DEGL  IA+ C QL  L L +C  +TD+ L  +   C ++  ++
Sbjct: 273  SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELS 330



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/61 (32%), Positives = 29/61 (47%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D GL  I   C  L  L L     ++DEGL  +   C  +++L +  C  ++D  L  IA
Sbjct: 287  DEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIA 346

Query: 1162 K 1164
            K
Sbjct: 347  K 347



>gb:AK129227_2069458 Mus musculus mRNA for mKIAA0840 protein.
          Length = 523

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 55/202 (27%), Positives = 80/202 (39%), Gaps = 2/202 (0%)
 Frame = +1

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            +K+QASI+ LPD  + +IF  LP    +   CA V +RW  L                  
Sbjct: 140  QKEQASIDRLPDHSMVQIFSFLPTN--QLCRCARVCRRWYNL------------------ 179

Query: 730  EPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSR--CLDGKKATDVRLAA 903
                     A  P L ++ +  G       E  + +     L+R  C D      + L  
Sbjct: 180  ---------AWDPRLWRTIRLTG-------ETINVDRALKVLTRRLCQDTPNVC-LMLET 222

Query: 904  IAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            + V   RR                +TD GL  I + CP LR L +    +IS+E +F++ 
Sbjct: 223  VIVSGCRR----------------LTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVV 266

Query: 1084 SGCHQLEKLDLCQCPGITDKSL 1149
            S C  LE LD+  C  +T  SL
Sbjct: 267  SLCPNLEHLDVSGCSKVTCISL 288



 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 31/101 (30%), Positives = 53/101 (52%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            + TDV +  +A   ++   L  L+ RG     G+TD G++ + + C  L++L +     +
Sbjct: 394  RITDVGIRYVAKYCSK---LRYLNARG---CEGITDHGVEYLAKNCTKLKSLDIGKCPLV 447

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            SD GL  +A  C  L++L L  C  IT + L  +A +C +L
Sbjct: 448  SDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDL 488



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 27/73 (36%), Positives = 41/73 (56%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R V+D GL+ I +    LR LS+ +   I+D G+  +A  C +L  L+   C GITD  +
Sbjct: 367  RFVSDFGLREIAKLESRLRYLSIAHCGRITDVGIRYVAKYCSKLRYLNARGCEGITDHGV 426

Query: 1150 MAIAKSCPNLASV 1188
              +AK+C  L S+
Sbjct: 427  EYLAKNCTKLKSL 439



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 25/68 (36%), Positives = 37/68 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GL+ +   C S++ LS+ +   +SD GL EIA    +L  L +  C  ITD  +  
Sbjct: 343  LTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRITDVGIRY 402

Query: 1156 IAKSCPNL 1179
            +AK C  L
Sbjct: 403  VAKYCSKL 410



 Score = 40.8 bits (94), Expect = 0.054
 Identities = 20/65 (30%), Positives = 41/65 (63%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V+D+GL+++   C +L+ LSL +  SI+ +GL  +A+ C  L+ L++  C  ++ ++L  
Sbjct: 447  VSDTGLESLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCE-VSVEALRF 505

Query: 1156 IAKSC 1170
            + + C
Sbjct: 506  VKRHC 510



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 16/56 (28%), Positives = 31/56 (55%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            C  L  + +     ++D GL+ IA  C +L +L++  C  I+++++  +   CPNL
Sbjct: 217  CLMLETVIVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNL 272



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+R L + +   + DEGL  IA+ C QL  L L +C  +TD+ L  +   C ++  ++
Sbjct: 305  SIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELS 362



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/61 (32%), Positives = 29/61 (47%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D GL  I   C  L  L L     ++DEGL  +   C  +++L +  C  ++D  L  IA
Sbjct: 319  DEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCRFVSDFGLREIA 378

Query: 1162 K 1164
            K
Sbjct: 379  K 379



>gb:BC033265_2097424 Mus musculus F-box and leucine-rich repeat
            protein 4, mRNA (cDNA clone MGC:25568 IMAGE:3983942),
            complete cds.
          Length = 551

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCP 1173
            IG  C +LR L LW   +I++ G+ E+ASGC  LE+LDL  CP +   +     +A+  P
Sbjct: 443  IGAKCKNLRTLDLWRCKNITENGIAELASGCVLLEELDLGWCPTLQSSTGCFARLARQLP 502

Query: 1174 NL 1179
            NL
Sbjct: 503  NL 504



>gb:AF176529_2057845 Mus musculus F-box protein FBX13 mRNA, partial
            cds.
          Length = 435

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 26/71 (36%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA  C +L+++ + +   +TD+S+ A
Sbjct: 212  LTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKA 271

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 272  FAEHCPELQYV 282



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 23/71 (32%), Positives = 43/71 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 186  LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIV 245

Query: 1156 IAKSCPNLASV 1188
            IAKSC  L  +
Sbjct: 246  IAKSCLKLQRI 256



 Score = 40.8 bits (94), Expect = 0.054
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R ++DSG+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L
Sbjct: 158  RSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGL 217

Query: 1150 MAIAKSCPNLASV 1188
              +   C  L  +
Sbjct: 218  KQLGSRCRELKDI 230



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +S + VTD  L+ I     ++  +++ +  S+SD G+  +A  C  L +    +C  ++D
Sbjct: 129  SSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSD 188

Query: 1141 KSLMAIAKSCPNLASV 1188
             S++A+A  CP L  V
Sbjct: 189  TSIIAVASHCPLLQKV 204



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 264  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 321

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 322  IVKRCKNLSSL 332



>sp|Q9QZN1|FX13_MOUSE F-box only protein 13 (Fragment).
          Length = 462

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 26/71 (36%), Positives = 41/71 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GLK +G  C  L+ +       ISDEG+  IA  C +L+++ + +   +TD+S+ A
Sbjct: 212  LTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKA 271

Query: 1156 IAKSCPNLASV 1188
             A+ CP L  V
Sbjct: 272  FAEHCPELQYV 282



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 23/71 (32%), Positives = 43/71 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D+ + A+   CP L+ + + N   ++DEGL ++ S C +L+ +   QC  I+D+ ++ 
Sbjct: 186  LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIV 245

Query: 1156 IAKSCPNLASV 1188
            IAKSC  L  +
Sbjct: 246  IAKSCLKLQRI 256



 Score = 40.8 bits (94), Expect = 0.054
 Identities = 19/73 (26%), Positives = 35/73 (47%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R ++DSG+  +   CP L   + +    +SD  +  +AS C  L+K+ +     +TD+ L
Sbjct: 158  RSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGL 217

Query: 1150 MAIAKSCPNLASV 1188
              +   C  L  +
Sbjct: 218  KQLGSRCRELKDI 230



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +S + VTD  L+ I     ++  +++ +  S+SD G+  +A  C  L +    +C  ++D
Sbjct: 129  SSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSD 188

Query: 1141 KSLMAIAKSCPNLASV 1188
             S++A+A  CP L  V
Sbjct: 189  TSIIAVASHCPLLQKV 204



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/71 (29%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  +KA    CP L+ +     S ++ +G+  +      L  LDL     + ++++M 
Sbjct: 264  VTDQSVKAFAEHCPELQYVGFMGCS-VTSKGVIHLTK-LRNLSSLDLRHITELDNETVME 321

Query: 1156 IAKSCPNLASV 1188
            I K C NL+S+
Sbjct: 322  IVKRCKNLSSL 332



>gb:AB023482_1515588 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, clone P0680A03.>gb:AP002536_1822474
            Oryza sativa (japonica cultivar-group) genomic DNA,
            chromosome 6, BAC clone:OSJNBa0015I14.
          Length = 238

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 2/73 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRG--CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +TD GL  I       +L ++SLW ++ I+D G+ ++ S  H L+ L++     ITD+SL
Sbjct: 103  ITDQGLIRISTADCVKNLTSISLWGLAGITDNGVIQLVSRAHSLQHLNIGGT-FITDESL 161

Query: 1150 MAIAKSCPNLASV 1188
             A+AKSC NL S+
Sbjct: 162  YAVAKSCINLKSI 174



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 45/199 (22%), Positives = 89/199 (44%), Gaps = 10/199 (5%)
 Frame = +1

Query: 550  EKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEAS 729
            E+ +  +E LP + L  +   LP    + S   GVS+RW   +            +G+ +
Sbjct: 16   EEPEPHVERLPADLLAHVLSLLP-SFHDLSMAGGVSRRWRRAVERSLAGRRRMSFAGQRT 74

Query: 730  EPEEGDNATAMQPELIKS--DKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAA 903
                GD++TA     +++  + +D  +  +    Q  ++G   +S     K  T + L  
Sbjct: 75   ----GDDSTA---RFVRAAVNLRDLDISRSCWGCQITDQGLIRISTADCVKNLTSISLWG 127

Query: 904  IAVGT--------ARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +A  T        +R   L  L+I G      +TD  L A+ + C +L+++ +W+   ++
Sbjct: 128  LAGITDNGVIQLVSRAHSLQHLNIGGTF----ITDESLYAVAKSCINLKSIIVWSCRHVT 183

Query: 1060 DEGLFEIASGCHQLEKLDL 1116
            + GL  +  GC +LE +++
Sbjct: 184  EAGLVALVGGCRRLECINV 202



>gb:AF199355_1889695 Homo sapiens F-box protein FBL5 (FBL5) mRNA,
            complete cds.
          Length = 621

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCP 1173
            IG  C  LR L LW   +I++ G+ E+ASGC  LE+LDL  CP +   +     +A   P
Sbjct: 474  IGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLP 533

Query: 1174 NL 1179
            NL
Sbjct: 534  NL 535



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            P+L+ L L    S+ D  + E+A  C +L++LD+     ++  SL  + +SC +L+
Sbjct: 533  PNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLS 588



>gb:AF176699_1888026 Homo sapiens F-box protein FBL4 mRNA, complete
            cds.
          Length = 621

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCP 1173
            IG  C  LR L LW   +I++ G+ E+ASGC  LE+LDL  CP +   +     +A   P
Sbjct: 474  IGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLP 533

Query: 1174 NL 1179
            NL
Sbjct: 534  NL 535



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            P+L+ L L    S+ D  + E+A  C +L++LD+     ++  SL  + +SC +L+
Sbjct: 533  PNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLS 588



>gb:AP004650_1842658 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1540_G08.
          Length = 314

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 26/70 (37%), Positives = 38/70 (54%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R  +D  L       P L  LS+ +  S+SD  +F +AS CH L +LD+  C  ++ KSL
Sbjct: 111  RHCSDDALAFAAERSPKLSILSIRSSPSVSDRSMFIVASSCHMLTELDISYCHEVSYKSL 170

Query: 1150 MAIAKSCPNL 1179
              I ++C NL
Sbjct: 171  EMIGQNCRNL 180



>sp|Q9UKA2|FXL4_HUMAN F-box/LRR-repeat protein 4 (F-box and
            leucine-rich repeat protein 4) (F-box protein
            FBL5).>gb:AF174590_1887908 Homo sapiens F-box protein
            Fbl4 (FBL4) mRNA, partial cds.>gb:BC055010_1985225 Homo
            sapiens F-box and leucine-rich repeat protein 4, mRNA
            (cDNA clone MGC:61641 IMAGE:6137889), complete
            cds.>gb:HS273N12_1997838 Human DNA sequence from clone
            RP1-273N12 on chromosome 6q16.1-16.3 Contains the FBXL4
            gene for F-box and leucine-rich repeat protein 4 and the
            POU3F2 gene for POU domain class 3 transcription factor 2
            and a CpG island, complete sequence.
          Length = 621

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCP 1173
            IG  C  LR L LW   +I++ G+ E+ASGC  LE+LDL  CP +   +     +A   P
Sbjct: 474  IGAKCKKLRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLP 533

Query: 1174 NL 1179
            NL
Sbjct: 534  NL 535



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 17/56 (30%), Positives = 32/56 (57%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            P+L+ L L    S+ D  + E+A  C +L++LD+     ++  SL  + +SC +L+
Sbjct: 533  PNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLS 588



>gb:FRU90880_2572188 Takifugu rubripes isotocin and vasotocin locus.
          Length = 257

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 23/66 (34%), Positives = 39/66 (59%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D+ L A+G  CP L  + + N   ++DE L ++   C +L+ + L QC  ITD+ ++A++
Sbjct: 131  DASLSALGTHCPLLVKVHVGNQDKLTDEALKKLGEHCSELKDIHLGQCYSITDEGMVALS 190

Query: 1162 KSCPNL 1179
            K C  L
Sbjct: 191  KGCRKL 196



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  LK +G  C  L+ + L    SI+DEG+  ++ GC +L++L L +   IT    M 
Sbjct: 155  LTDEALKKLGEHCSELKDIHLGQCYSITDEGMVALSKGCRKLQRLYLQENKLITKGGKMR 214

Query: 1156 I 1158
            I
Sbjct: 215  I 215



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 20/71 (28%), Positives = 33/71 (46%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V D  L  I     ++  +++ +   + D G+  +AS C  L+K    +C  + D SL A
Sbjct: 77   VNDDLLVKIASRRQNITEINISDCRGVHDHGVSSLASHCPSLQKYTAYRCKQLGDASLSA 136

Query: 1156 IAKSCPNLASV 1188
            +   CP L  V
Sbjct: 137  LGTHCPLLVKV 147



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 22/98 (22%), Positives = 45/98 (45%)
 Frame = +1

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFE 1077
            AA  VG   RG L  L+++       +     + +       + + L  +  ++D+ L +
Sbjct: 25   AAPDVGLEDRGVLSHLTVKERCLCASLVCKYWRDLCLDFQFWKQIDLSGLQQVNDDLLVK 84

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            IAS    + ++++  C G+ D  + ++A  CP+L   T
Sbjct: 85   IASRRQNITEINISDCRGVHDHGVSSLASHCPSLQKYT 122



>gb:BC067674_2554845 Danio rerio zgc:85882, mRNA (cDNA clone MGC:85882
            IMAGE:6968485), complete cds.
          Length = 296

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R + D  +  +   CP LRALS+   ++I+D  + E+A  C ++E+LDL  C  + ++++
Sbjct: 174  RQLKDPAVCYLAGKCPELRALSVAVNANITDTAVEEVAKKCREMERLDLTGCLRVRNEAI 233

Query: 1150 MAIAKSCPNLASV 1188
              +A+ CP L S+
Sbjct: 234  RTLAEYCPKLQSL 246



 Score = 41.2 bits (95), Expect = 0.042
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            L A+   CP L+ LSL +   +    L  +A  C  L  LDL  C  + D ++  +A  C
Sbjct: 129  LVAVSLSCPRLQHLSLAHCEWVDSLALRSLADHCPMLRSLDLTACRQLKDPAVCYLAGKC 188

Query: 1171 PNLASVT 1191
            P L +++
Sbjct: 189  PELRALS 195



>gb:AK175307_1817295 Arabidopsis thaliana mRNA for hypothetical
            protein, complete cds, clone: RAFL21-73-P17.
          Length = 762

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 29/84 (34%), Positives = 48/84 (57%)
 Frame = +1

Query: 916  TARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH 1095
            TAR   L +L +  +   R ++DS +K I   CP+L  L L N+  ++D  L  +A+GC 
Sbjct: 585  TARGQTLKQLILTNS---RKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQ 641

Query: 1096 QLEKLDLCQCPGITDKSLMAIAKS 1167
             LEKL  C+ P  +D+++ A  ++
Sbjct: 642  ALEKLIFCRNP-FSDEAVAAFVET 664



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +L+ L L N   +SD  +  I+  C  L  LDL     +TD SL  +A  C  L
Sbjct: 590  TLKQLILTNSRKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQAL 643



>gb:AB013396_1512190 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MTI20.>gb:AF263377_1781678 Arabidopsis thaliana
            SKP1 interacting partner 1 (SKIP1) mRNA, complete cds.
          Length = 300

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 26/84 (30%), Positives = 47/84 (55%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GGL K+ +R        +D  L      CP+L+ L++ +  +++D  + +IA  C  L++
Sbjct: 89   GGLTKIRVRH------CSDHALSYAADRCPNLQVLAIRSSPNVTDASMTKIAFRCRSLKE 142

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LD+  C  I+  +L+ I ++CPNL
Sbjct: 143  LDISYCHEISHDTLVMIGRNCPNL 166



>gb:BT010706_1640652 Arabidopsis thaliana At2g06030 mRNA, complete
            cds.>gb:BT010997_1640943 Arabidopsis thaliana At2g06030
            mRNA, partial cds.
          Length = 233

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 24/66 (36%), Positives = 40/66 (60%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R ++DS +K I   CP+L  L L N+  ++D  L  +A+GC  LEKL  C+ P  +D+++
Sbjct: 135  RKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQALEKLIFCRNP-FSDEAV 193

Query: 1150 MAIAKS 1167
             A  ++
Sbjct: 194  AAFVET 199



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +L+ L L N   +SD  +  I+  C  L  LDL     +TD SL  +A  C  L
Sbjct: 125  TLKQLILTNSRKLSDSSIKVISENCPNLSVLDLANVCKLTDSSLGYLANGCQAL 178



>gb:AE013599_1130713 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003835_1226946 Drosophila melanogaster
            chromosome 2R, section 15 of 74 of the complete
            sequence.>gb:AY069552_1294282 Drosophila melanogaster
            LD27656 full length cDNA.
          Length = 689

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 33/87 (37%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVT-DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GL  L++RG N    V+   GLK I      LR L L N   IS  G+  +AS C  +E+
Sbjct: 535  GLRSLNLRGCNKISDVSLKYGLKHI-----ELRRLMLSNCQQISLLGMEAMASSCPSIEE 589

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LDL  C  ITDK++  +    P L ++
Sbjct: 590  LDLSDCYNITDKTIQVVTSKLPRLKAL 616



>gb:AP005398_1851132 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0669G10.>gb:AP005694_1856174 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0063E14.
          Length = 414

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 26/82 (31%), Positives = 45/82 (54%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +L +   N+ + V+D G++ I   CP+LRALS++ I  ++D  +  I   C  +  L+
Sbjct: 143  LQELELLNINACQKVSDKGIETITSLCPNLRALSIYWIVGLTDLTIRHIVQNCKHIVDLN 202

Query: 1114 LCQCPGITDKSLMAIAKSCPNL 1179
            L  C  I+DK +  +A +   L
Sbjct: 203  LSGCKNISDKGMQLVADNYEGL 224



 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 30/81 (37%), Positives = 40/81 (49%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L  L+       + VTD GL  I R C  L  L+L     ++D G+  IA GC  L+ 
Sbjct: 270  GSLTNLTFLDLCGAQNVTDDGLSCISR-CVCLTYLNLSWCVRVTDVGVVAIAQGCRSLQL 328

Query: 1108 LDLCQCPGITDKSLMAIAKSC 1170
            L L    G+TD  L A++K C
Sbjct: 329  LSLFGIVGVTDVCLEALSKHC 349



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD GL+ + + C SL +L+L+ +SS SD+   +I S    L  LDLC    +TD  L  
Sbjct: 235  LTDDGLQEVLQKCSSLESLNLYALSSFSDKVYKKIGS-LTNLTFLDLCGAQNVTDDGLSC 293

Query: 1156 IAK 1164
            I++
Sbjct: 294  ISR 296



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            + ++D G++ +      L+ L++     ++D+GL E+   C  LE L+L      +DK
Sbjct: 207  KNISDKGMQLVADNYEGLKKLNITRCIKLTDDGLQEVLQKCSSLESLNLYALSSFSDK 264



>pir|G88523|G88523 truncated hypothetical protein C02F5.7 -
            Caenorhabditis elegans
          Length = 197

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 31/92 (33%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +1

Query: 886  DVRLAAIAVGTARRGG-LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISD 1062
            DV+ A +     R GG L +LS++G  +   V DS L+     CP+L  LSL+    ++D
Sbjct: 108  DVKTAVVENLARRCGGFLKELSLKGCEN---VHDSALRTFTSRCPNLEHLSLYRCKRVTD 164

Query: 1063 EGLFEIASGCHQLEKLDLCQCPGITDKSLMAI 1158
                 +   CH+L  L+L  C  ITD+++  I
Sbjct: 165  ASCENLGRYCHKLNYLNLENCSSITDRAMKYI 196



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPS-LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            R V  + ++ + R C   L+ LSL    ++ D  L    S C  LE L L +C  +TD S
Sbjct: 107  RDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKRVTDAS 166

Query: 1147 LMAIAKSCPNL 1179
               + + C  L
Sbjct: 167  CENLGRYCHKL 177



>gb:BC085657_2564534 Danio rerio zgc:92297, mRNA (cDNA clone MGC:92297
            IMAGE:7054126), complete cds.
          Length = 607

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 2/58 (3%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--LMAIAKSCPNL 1179
            C SLR+L LW   ++S+ GL E+ SGC  LE+LDL  C  +   S     +A+S P L
Sbjct: 464  CRSLRSLDLWRCRNLSERGLAELVSGCRLLEELDLGWCSTLQSSSACFQHLARSLPRL 521



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +1

Query: 1000 IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            + R  P LR L L    ++ D  L E+A+ C  L+ LD+     ++  SL  + + CP L
Sbjct: 514  LARSLPRLRKLFLTANRTVCDADLEELAANCSALQHLDILGTRMVSSASLRKLLQCCPRL 573



>gb:AF467464_2496361 Gallus gallus PPA (PPA) gene, partial cds.
          Length = 188

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 35/108 (32%), Positives = 58/108 (53%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNI 1047
            D +K +D+ L  +A       GLG+L     +   G++D+GL  +     SLR+L+L + 
Sbjct: 5    DCQKLSDLSLKHLA------RGLGRLRQLNLSFCGGISDAGLLHLSH-MSSLRSLNLRSC 57

Query: 1048 SSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
             +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 58   DNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLRSLS 105



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 34/105 (32%), Positives = 50/105 (47%), Gaps = 1/105 (0%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 85   KVGDQSLAYIAQGL---DGLRSLSLCSCH----ISDEGINRMVRQMHGLRTLNIGQCVRI 137

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK-SCPNLASV 1188
            +D+GL  IA    QL  +DL  C  IT + L  I +  CP + ++
Sbjct: 138  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCPKVLNL 182



>gb:AP005709_1856455 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0646B04.>gb:AP005860_1859154 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1134_E08.
          Length = 530

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 31/108 (28%), Positives = 52/108 (48%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            +DG KA  +    +A    +   L +L + G N    +T + L+ I   CP+L  L+L  
Sbjct: 319  VDGWKANRIGDRGLAAVAQKCAALQELVLIGVN----LTSASLELIAANCPALERLALCG 374

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
              +  D  +  +A+ C  L KL +  CP ++D  +  +A+ CP L  V
Sbjct: 375  SDTFGDAEISCVATKCAALRKLCIKACP-VSDAGMDKLAQGCPRLVKV 421



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 27/91 (29%), Positives = 47/91 (51%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            L G   T   L  IA   A    L +L++ G+++F    D+ +  +   C +LR L +  
Sbjct: 347  LIGVNLTSASLELIA---ANCPALERLALCGSDTFG---DAEISCVATKCAALRKLCI-K 399

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
               +SD G+ ++A GC +L K+ + +C G+T
Sbjct: 400  ACPVSDAGMDKLAQGCPRLVKVKVKKCQGVT 430



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 1/99 (1%)
 Frame = +1

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIG-RGCPSLRALSLWNISSISDEGLF 1074
            AA+    AR   + KL+++ +     V D  L  +  R  P+LR L L +I  ++D+G+ 
Sbjct: 101  AALPGILARFPAVSKLALKCDRRAESVADPTLALLADRLGPALRRLKLRSIRLVTDDGVA 160

Query: 1075 EIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
             +A+    L KL +  C     K + A+ +SC +L  ++
Sbjct: 161  ALAAAATNLRKLSVGSCT-FGAKGIEAVLRSCLHLEELS 198



>gb:ATAC009853_1543062 Arabidopsis thaliana chromosome III BAC F21O3
            genomic sequence, complete sequence.>gb:BT008530_1639747
            Arabidopsis thaliana clone U51342 putative F-box protein
            family, AtFBL12 (At3g07550) mRNA, complete
            cds.>gb:AK118929_1816879 Arabidopsis thaliana At3g07550
            mRNA for unknown protein, complete cds, clone:
            RAFL21-26-L05.
          Length = 395

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 25/72 (34%), Positives = 43/72 (59%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            G++D G+  I   CP+L  +SL+  + ISD GL  +A     L+ ++L  CP ++D  + 
Sbjct: 129  GISDDGISTIASFCPNLSVVSLYRCN-ISDIGLETLARASLSLKCVNLSYCPLVSDFGIK 187

Query: 1153 AIAKSCPNLASV 1188
            A++++C  L SV
Sbjct: 188  ALSQACLQLESV 199



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 1/90 (1%)
 Frame = +1

Query: 913  GTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS-LRALSLWNISSISDEGLFEIASG 1089
            G    GG+  L+I G + +  +   GL  IG G  S LR L+L    ++ DE +  IA G
Sbjct: 236  GIISGGGIEFLNISGVSCY--IRKDGLVPIGSGIASKLRILNLRMCRTVGDESIEAIAKG 293

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            C  L++ +L  C  +      A+ K C NL
Sbjct: 294  CPLLQEWNLALCHEVKISGWEAVGKWCRNL 323



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            ++D GL+ + R   SL+ ++L     +SD G+  ++  C QLE + +  C  IT
Sbjct: 155  ISDIGLETLARASLSLKCVNLSYCPLVSDFGIKALSQACLQLESVKISNCKSIT 208



>gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map
            1005175-1418323 strain AX4, complete sequence.
          Length = 638

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 24/75 (32%), Positives = 41/75 (54%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            S   ++D  LKA+ R C  L+ +SL +   I+D G+ E+   C QL  L+L  C  +T  
Sbjct: 237  SSNNLSDDDLKALTRQCKKLKFISLKSCKLITDHGVLELIHDCPQLMDLNLASCSKVTRT 296

Query: 1144 SLMAIAKSCPNLASV 1188
            S+  + ++  NL ++
Sbjct: 297  SVQHVLQNLHNLTTL 311



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            +F G++   ++ +   C    ++ L + +++SD+ L  +   C +L+ + L  C  ITD 
Sbjct: 211  NFNGISGWDIRTLAPYCAHFTSMDLGSSNNLSDDDLKALTRQCKKLKFISLKSCKLITDH 270

Query: 1144 SLMAIAKSCPNL 1179
             ++ +   CP L
Sbjct: 271  GVLELIHDCPQL 282



>gb:AE017348_1758146 Cryptococcus neoformans var. neoformans JEC21
            chromosome 8, complete sequence.
          Length = 928

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 25/73 (34%), Positives = 40/73 (54%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TD  L++IG+    L  L L ++S I+D+G+  +A  C +L  LDL  C  +TD
Sbjct: 459  NKCPALTDKSLESIGKLGKHLHNLHLGHVSLITDDGVINLARSCTRLRYLDLACCTLLTD 518

Query: 1141 KSLMAIAKSCPNL 1179
              +  I ++ P L
Sbjct: 519  ACVAEIGENMPKL 531



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D+ L  +G  C  L+A++L     + DEG+  +A     L ++   +C  IT KSL+ + 
Sbjct: 276  DAVLVIVGETCQKLQAINLSECRLVGDEGVLALAKESRALRRIKFEKCHRITQKSLIPLI 335

Query: 1162 KSCP 1173
            ++CP
Sbjct: 336  RACP 339



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRG----VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQL 1101
            +GKL    +N   G    +TD G+  + R C  LR L L   + ++D  + EI     +L
Sbjct: 472  IGKLGKHLHNLHLGHVSLITDDGVINLARSCTRLRYLDLACCTLLTDACVAEIGENMPKL 531

Query: 1102 EKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++  L +   ITD+++ ++ +   +L  V
Sbjct: 532  KRFGLVKVTNITDEAIYSLVRKHTSLERV 560



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 3/72 (4%)
 Frame = +1

Query: 973  GVTDSGLKAIGR---GCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            G TD G KA+       P LR L+L    +++D+ L  I      L  L L     ITD 
Sbjct: 434  GCTDLGDKAVDNLITNAPKLRQLTLNKCPALTDKSLESIGKLGKHLHNLHLGHVSLITDD 493

Query: 1144 SLMAIAKSCPNL 1179
             ++ +A+SC  L
Sbjct: 494  GVINLARSCTRL 505



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 15/58 (25%), Positives = 32/58 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +TD+ +  IG   P L+   L  +++I+DE ++ +      LE++ L  C  ++ K++
Sbjct: 516  LTDACVAEIGENMPKLKRFGLVKVTNITDEAIYSLVRKHTSLERVHLSYCDQLSVKAI 573



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 15/48 (31%), Positives = 28/48 (58%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            LR + +   + + D+ +  + +   +L +L L +CP +TDKSL +I K
Sbjct: 427  LRVVDMTGCTDLGDKAVDNLITNAPKLRQLTLNKCPALTDKSLESIGK 474



>gb:AB020742_1514567 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K21H1.>gb:AY072313_1567130 Arabidopsis thaliana
            unknown protein (At5g67140) mRNA, complete
            cds.>gb:AY114554_1578596 Arabidopsis thaliana unknown
            protein (At5g67140) mRNA, complete cds.
          Length = 228

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 35/112 (31%), Positives = 56/112 (50%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            +SR   G   TD  L  IA        L  +S+ G  +   +TDSG+  +     SL+ L
Sbjct: 79   ISRSRWGCHITDNGLYQIASARCV-SNLNSVSLWGMTA---ITDSGVVQLISRTSSLQHL 134

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++   + I+DE LF IA  CHQL+ + +  C  +T++ L+ +   C  L S+
Sbjct: 135  NIGG-TFITDESLFAIAERCHQLKTIGMWCCRHVTERGLLVLVNKCRKLESI 185



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 43/195 (22%), Positives = 84/195 (43%), Gaps = 8/195 (4%)
 Frame = +1

Query: 556  KQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLS-TICRDELSTIKSGEASE 732
            ++A+I+ LP + L  IF  L       +  +GV K+W   ++ ++ R E  +    +   
Sbjct: 3    EEAAIDRLPLDLLAYIFS-LATSFTVLAQASGVCKKWRKAVNQSMARRETLSFAGWKMD- 60

Query: 733  PEEGDNATAMQPELIKSDKKDGFVQSNVS-EVQDNEEGDGFLSRCLDGKKA------TDV 891
                D++T+    L  + K+    +S     + DN       +RC+    +      T +
Sbjct: 61   ----DDSTSRLVHLAFNLKELDISRSRWGCHITDNGLYQIASARCVSNLNSVSLWGMTAI 116

Query: 892  RLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGL 1071
              + +    +R   L  L+I G      +TD  L AI   C  L+ + +W    +++ GL
Sbjct: 117  TDSGVVQLISRTSSLQHLNIGGTF----ITDESLFAIAERCHQLKTIGMWCCRHVTERGL 172

Query: 1072 FEIASGCHQLEKLDL 1116
              + + C +LE ++L
Sbjct: 173  LVLVNKCRKLESINL 187



>gb:AE014297_1139487 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003703_1221480 Drosophila melanogaster
            chromosome 3R, section 41 of 118 of the complete
            sequence.
          Length = 632

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 30/87 (34%), Positives = 46/87 (52%)
 Frame = +1

Query: 919  ARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ 1098
            +R  GL +L++RG    R VTDS L  +G   P LRALSL   + ++ EG   +   C  
Sbjct: 492  SRLRGLKELNLRG---CRNVTDSSLM-VGLKLPELRALSLGYCNRLTSEGFEALTQNCPS 547

Query: 1099 LEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LE L +  C  + D++++ I  +   L
Sbjct: 548  LEALCVSSCMAVDDETVLNIVSNLKRL 574



>gb:BC021329_2093374 Mus musculus F-box and leucine-rich repeat
            protein 14, mRNA (cDNA clone MGC:29433 IMAGE:3710945),
            complete cds.
          Length = 400

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSF-RGVTDSGLKAIGRGCPSLRALSLWN 1044
            D +K TD+ L  I+ G     GL  L++    SF  G++D+GL  +     SLR+L+L +
Sbjct: 211  DCQKLTDLSLKHISRGLT---GLRLLNL----SFCGGISDAGLLHLSH-MGSLRSLNLRS 262

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
              +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 263  CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLS 311



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 267  SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-IS 318

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 319  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 361



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 291  KVGDQSLAYIAQGL---DGLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 344  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R ++D G+       ++   GC  L  L+L +   ++D  L  I+ G
Sbjct: 167  GLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
               L  L+L  C GI+D  L+ ++          +SC N++
Sbjct: 227  LTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNIS 267



>gb:BC006913_2090478 Mus musculus F-box and leucine-rich repeat
            protein 14, mRNA (cDNA clone IMAGE:3601186), partial cds.
          Length = 327

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSF-RGVTDSGLKAIGRGCPSLRALSLWN 1044
            D +K TD+ L  I+ G     GL  L++    SF  G++D+GL  +     SLR+L+L +
Sbjct: 138  DCQKLTDLSLKHISRGLT---GLRLLNL----SFCGGISDAGLLHLSH-MGSLRSLNLRS 189

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
              +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 190  CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLS 238



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 194  SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-IS 245

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 246  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 288



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 218  KVGDQSLAYIAQGL---DGLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 270

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 271  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 306



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R ++D G+       ++   GC  L  L+L +   ++D  L  I+ G
Sbjct: 94   GLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRG 153

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
               L  L+L  C GI+D  L+ ++          +SC N++
Sbjct: 154  LTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNIS 194



>gb:AF467463_2066642 Mus musculus PPA (Ppa) mRNA, partial cds.
          Length = 184

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSF-RGVTDSGLKAIGRGCPSLRALSLWN 1044
            D +K TD+ L  I+ G     GL  L++    SF  G++D+GL  +     SLR+L+L +
Sbjct: 5    DCQKLTDLSLKHISRGLT---GLRLLNL----SFCGGISDAGLLHLSH-MGSLRSLNLRS 56

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
              +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 57   CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLS 105



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 61   SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-IS 112

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 113  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 155



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 85   KVGDQSLAYIAQGL---DGLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 137

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 138  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 173



>sp|Q8BID8|FXLE_MOUSE F-box/LRR-repeat protein 14 (F-box and
            leucine-rich repeat protein 14).>gb:AK084506_1174252 Mus
            musculus 13 days embryo heart cDNA, RIKEN full-length
            enriched library, clone:D330009L09 product:similar to
            F-BOX LEUCINE-RICH REPEAT PROTEIN 13 (FRAGMENT) [Xenopus
            laevis], full insert sequence.
          Length = 400

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSF-RGVTDSGLKAIGRGCPSLRALSLWN 1044
            D +K TD+ L  I+ G     GL  L++    SF  G++D+GL  +     SLR+L+L +
Sbjct: 211  DCQKLTDLSLKHISRGLT---GLRLLNL----SFCGGISDAGLLHLSH-MGSLRSLNLRS 262

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
              +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 263  CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLS 311



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 267  SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-IS 318

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 319  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 361



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 291  KVGDQSLAYIAQGL---DGLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 344  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R ++D G+       ++   GC  L  L+L +   ++D  L  I+ G
Sbjct: 167  GLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
               L  L+L  C GI+D  L+ ++          +SC N++
Sbjct: 227  LTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNIS 267



>sp|Q8N1E6|FXLE_HUMAN F-box/LRR-repeat protein 14 (F-box and
            leucine-rich repeat protein 14).>gb:BC028132_1979129 Homo
            sapiens F-box and leucine-rich repeat protein 14, mRNA
            (cDNA clone MGC:40195 IMAGE:5205284), complete cds.
          Length = 418

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 1/109 (0%)
 Frame = +1

Query: 868  DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSF-RGVTDSGLKAIGRGCPSLRALSLWN 1044
            D +K TD+ L  I+ G     GL  L++    SF  G++D+GL  +     SLR+L+L +
Sbjct: 211  DCQKLTDLSLKHISRGLT---GLRLLNL----SFCGGISDAGLLHLSH-MGSLRSLNLRS 262

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
              +ISD G+  +A G  +L  LD+  C  + D+SL  IA+    L S++
Sbjct: 263  CDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLS 311



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 267  SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCH-IS 318

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 319  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 361



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 32/96 (33%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 291  KVGDQSLAYIAQGL---DGLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 344  TDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQ 379



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R ++D G+       ++   GC  L  L+L +   ++D  L  I+ G
Sbjct: 167  GLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
               L  L+L  C GI+D  L+ ++          +SC N++
Sbjct: 227  LTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNIS 267



>gb:CR382129_1661907 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 767

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 50/234 (21%), Positives = 93/234 (39%), Gaps = 6/234 (2%)
 Frame = +1

Query: 505  SRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLST 684
            S I+   V   + V+  K A +  LP E L  IF  LP      S C  VSK W M    
Sbjct: 67   SDIDMDEVAEADGVEPDKDAPVHQLPSELLTVIFTMLPERRDVHS-CLLVSKTWFMSCVD 125

Query: 685  IC------RDELSTIKSGEASEPEEGDNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGD 846
            +         +L+ ++    +  +   + T      I+             E+       
Sbjct: 126  LVWFRPHLPKDLTRLQQLLRTLKQPVSSQTVPYSTYIRRLNLTNLTGEMTDELLSGVAVC 185

Query: 847  GFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLR 1026
              L R L     T +  A++     +  GL  + +    +   +TD+ +KA+      L+
Sbjct: 186  TRLER-LTLANCTALSDASLVPVLQQNSGLQSVDV---TNVSHITDATIKALLPSKRRLQ 241

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             L     ++I++  +  +A+ C  L+++ +  CP + D++ MA+  +CP L  +
Sbjct: 242  GLYATGCANITNAAIVALATECRLLKRIKVNSCPNVEDEAAMALVDNCPQLVEL 295



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 18/62 (29%), Positives = 38/62 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+G+  + R C  ++ + + N S ++D  + ++AS   +L ++ L +C  ITD ++ A
Sbjct: 409  ITDAGIAQLVRACQRIQYIDVANCSQLTDAAVEDLAS-LTKLRRIGLVKCVNITDAAIYA 467

Query: 1156 IA 1161
            +A
Sbjct: 468  LA 469



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 48/217 (22%), Positives = 85/217 (39%), Gaps = 3/217 (1%)
 Frame = +1

Query: 538  EKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKS 717
            + VD    + I     + L    RRL   G   + CA ++   ++ L+T CR  L  IK 
Sbjct: 215  QSVDVTNVSHITDATIKALLPSKRRLQ--GLYATGCANITNAAIVALATECR-LLKRIKV 271

Query: 718  GEASEPEEGDNATAMQ---PELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATD 888
                  E+ + A A+    P+L++ D  +    S     +   +      R L   + T 
Sbjct: 272  NSCPNVED-EAAMALVDNCPQLVELDLHENSALSGSVATEALRKLPNL--RELRVGQVTG 328

Query: 889  VRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEG 1068
            V  A   +G   R    +L I    +   +TD+ +  +    P LR + L   + ++D  
Sbjct: 329  VNDACF-LGFPARPQFDRLRIIDLTACNAITDAAVDRLVTCAPKLRHVVLAKCTRVTDRS 387

Query: 1069 LFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            +  +      L  L L  C  ITD  +  + ++C  +
Sbjct: 388  IRSLLRLGKSLHYLHLGHCASITDAGIAQLVRACQRI 424



>gb:AY220479_1590513 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
            protein 189 (ACRE189) mRNA, complete cds.
          Length = 550

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 48/188 (25%), Positives = 78/188 (41%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LPDECL  IF+ L  G  +R  C+ V +RWL++                     EG +  
Sbjct: 63   LPDECLALIFQCLSSG--DRKKCSLVWRRWLLV---------------------EGQSR- 98

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
                  +  + K  F+    +     + G     RC   +K+  +   A+ + + R   L
Sbjct: 99   ----HRLSLNAKAEFLPHIPTIFSRFDSGTKLALRC--DRKSVSINDEALTLISLRCVNL 152

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
             +L +RG    R VTD G+ A  + C SL+  S  +      +G+  +   C  LE+L +
Sbjct: 153  TRLKLRG---CRDVTDVGMSAFAKNCKSLKKFSCGS-CMFGAKGMNALLDHCSTLEELSV 208

Query: 1117 CQCPGITD 1140
             +  GI D
Sbjct: 209  KRLRGIND 216



 Score = 40.4 bits (93), Expect = 0.071
 Identities = 24/70 (34%), Positives = 34/70 (48%)
 Frame = +1

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAI 1158
            T   L AI   C  L  L+L    +I D  +  IA+ C  L+KL +  C  +TD+   + 
Sbjct: 371  TSPSLLAIASNCQKLERLALCGSDTIGDPEVSCIATKCMALKKLCIKGCE-VTDEGFESF 429

Query: 1159 AKSCPNLASV 1188
            A  CPNL  +
Sbjct: 430  AWGCPNLVKI 439



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 18/43 (41%), Positives = 25/43 (58%)
 Frame = +1

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            SI+DE L  I+  C  L +L L  C  +TD  + A AK+C +L
Sbjct: 136  SINDEALTLISLRCVNLTRLKLRGCRDVTDVGMSAFAKNCKSL 178



>gb:AY089649_1297305 Drosophila melanogaster RH06780 full insert cDNA.
          Length = 666

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 32/83 (38%), Positives = 41/83 (49%)
 Frame = +1

Query: 943  LSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQ 1122
            LSI    S   +T+ G+  I    P L  LSL   S ++D+G+  IA    +L  LDL  
Sbjct: 483  LSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSW 542

Query: 1123 CPGITDKSLMAIAKSCPNLASVT 1191
            CP ITD SL  IA     L  +T
Sbjct: 543  CPRITDASLEYIACDLNQLEELT 565



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 23/55 (41%), Positives = 30/55 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +TD G++ I      LRAL L     I+D  L  IA   +QLE+L L +C  ITD
Sbjct: 520  LTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITD 574



>gb:AE014296_1135872 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003544_1214848 Drosophila melanogaster
            chromosome 3L, section 41 of 83 of the complete sequence.
          Length = 666

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 32/83 (38%), Positives = 41/83 (49%)
 Frame = +1

Query: 943  LSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQ 1122
            LSI    S   +T+ G+  I    P L  LSL   S ++D+G+  IA    +L  LDL  
Sbjct: 483  LSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSW 542

Query: 1123 CPGITDKSLMAIAKSCPNLASVT 1191
            CP ITD SL  IA     L  +T
Sbjct: 543  CPRITDASLEYIACDLNQLEELT 565



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 23/55 (41%), Positives = 30/55 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +TD G++ I      LRAL L     I+D  L  IA   +QLE+L L +C  ITD
Sbjct: 520  LTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITD 574



>gb:BC087158_2110046 Rattus norvegicus cDNA clone MGC:95282
            IMAGE:7134260, complete cds.
          Length = 589

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 61/251 (24%), Positives = 105/251 (41%), Gaps = 25/251 (9%)
 Frame = +1

Query: 511  INAPFVFSGEKVDEKKQA-SIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLL--- 678
            IN    FS   V +K+    I VLPD+ + +IF  L    ++  +C+ V++ W+ ++   
Sbjct: 177  INIEGSFSDFGVTDKRIVFDISVLPDQAVVQIFVYLTF--KDLVSCSQVNRSWMSMIQRG 234

Query: 679  --------STIC----RDELSTIKSGEASEPEEGDNATAMQPELIKSDKKDGFVQS-NVS 819
                    ST+     R  ++T++    +          ++ + +KS      +Q  NVS
Sbjct: 235  SLWNSIDFSTVKNIADRCVVTTLQKWRLNVLRLNFRGCVLRAKTLKSVSHCKNLQELNVS 294

Query: 820  EVQD-NEEGDGFLSRCLDGKKATDVRLAAIAVGTARR-----GGLGKLSIRGNNSFRGVT 981
            +     +E    +S    G    ++    I   T R        L  LS+     F   T
Sbjct: 295  DCPSFTDESMRHISEGCPGVLYLNLSNTTITNRTMRLLPRYFHNLQNLSLAYCRKF---T 351

Query: 982  DSGLKAI--GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            D GL+ +  G GC  L  L L   + IS +G   IA+ C  +  L +   P +TD  +  
Sbjct: 352  DKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRNIANSCTGIMHLTINDMPTLTDNCVKV 411

Query: 1156 IAKSCPNLASV 1188
            + + CP ++SV
Sbjct: 412  LVEKCPRISSV 422



>pir|B85072|B85072 hypothetical protein AT4g07400 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV17_1544418 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            17.>gb:F28D6_1678101 Arabidopsis thaliana BAC F28D6.
          Length = 554

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 48/164 (29%), Positives = 67/164 (40%), Gaps = 29/164 (17%)
 Frame = +1

Query: 784  DKKDGFVQSNVSEVQDNEEGDGFLSRC-----LDGKKATDVRLAAIAVGTARRGGLGKLS 948
            DK +  V+ ++  +Q ++ G   LS+C     L   K  D     +A+   R   L KL 
Sbjct: 289  DKVNAIVEIHLERIQMSDLGLTALSKCSGVEVLHLVKTPDCTNVGLALVAERCKLLRKLH 348

Query: 949  IRGNNSFR----------------------GV--TDSGLKAIGRGCPSLRALSLWNISSI 1056
            I G  + R                      GV  T   L+AI   C +L  L+L    ++
Sbjct: 349  IDGWKTNRIGDEGLIVVAKYCWNLQELVLIGVNPTKLSLEAIVSNCLNLERLALCGSDTV 408

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             D  L  IA  C  L KL +  CP ITD  + A+   CPNL  V
Sbjct: 409  GDTELCCIAEKCLALRKLCIKNCP-ITDDGIKALGNGCPNLLKV 451



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 29/100 (29%), Positives = 50/100 (50%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            L G   T + L AI         L +L++ G+++   V D+ L  I   C +LR L + N
Sbjct: 377  LIGVNPTKLSLEAIVSNCLN---LERLALCGSDT---VGDTELCCIAEKCLALRKLCIKN 430

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
               I+D+G+  + +GC  L K+ + +C G+T +    + K
Sbjct: 431  CP-ITDDGIKALGNGCPNLLKVKVKKCRGVTTQGADLLRK 469



>pir|D96512|D96512 hypothetical protein F2G19.16 [imported] -
            Arabidopsis thaliana>gb:AE005173_892682 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC083835_1733196 Arabidopsis thaliana
            chromosome 1 BAC F2G19 genomic sequence, complete
            sequence.
          Length = 518

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 43/141 (30%), Positives = 64/141 (45%), Gaps = 8/141 (5%)
 Frame = +1

Query: 781  SDKKDGFVQSNVSEVQDNEEGDGFLSRC--------LDGKKATDVRLAAIAVGTARRGGL 936
            S K  G V+ ++  +Q ++     +S C        +   + T+  LAAIA    R   L
Sbjct: 255  SGKDHGVVEIHLERMQVSDVALSAISYCSSLESLHLVKTPECTNFGLAAIAEKCKR---L 311

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
             KL I G  +   + D GL A+ + C  L+ L L  ++  +   L  +A+ C  LE+L L
Sbjct: 312  RKLHIDGWKA-NLIGDEGLVAVAKFCSQLQELVLIGVNPTT-LSLGMLAAKCLNLERLAL 369

Query: 1117 CQCPGITDKSLMAIAKSCPNL 1179
            C C    D  L  IA  CP L
Sbjct: 370  CGCDTFGDPELSCIAAKCPAL 390



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 30/90 (33%), Positives = 47/90 (52%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            L G   T + L  +A   A+   L +L++ G ++F    D  L  I   CP+LR L + N
Sbjct: 344  LIGVNPTTLSLGMLA---AKCLNLERLALCGCDTFG---DPELSCIAAKCPALRKLCIKN 397

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
               ISD G+  +A+GC  L K+ + +C G+
Sbjct: 398  CP-ISDVGIENLANGCPGLTKVKIKKCKGV 426



>gb:BC036680_1982003 Homo sapiens F-box and leucine-rich repeat
            protein 16, mRNA (cDNA clone MGC:33974 IMAGE:5262152),
            complete cds.
          Length = 479

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+ G+  +    P+L ALSL   S ++D+G+  +A    +L  LDL  CP ITD +L  
Sbjct: 307  ITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEY 366

Query: 1156 IA 1161
            +A
Sbjct: 367  VA 368



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 22/58 (37%), Positives = 31/58 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            VTD G++ +      LR+L L     I+D  L  +A   H+LE+L L +C  ITD  L
Sbjct: 333  VTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGL 390



>gb:AE006464_1875628 Homo sapiens 16p13.3 sequence section 3 of 8.
          Length = 581

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+ G+  +    P+L ALSL   S ++D+G+  +A    +L  LDL  CP ITD +L  
Sbjct: 339  ITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEY 398

Query: 1156 IA 1161
            +A
Sbjct: 399  VA 400



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 22/58 (37%), Positives = 31/58 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            VTD G++ +      LR+L L     I+D  L  +A   H+LE+L L +C  ITD  L
Sbjct: 365  VTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGL 422



>gb:OSJN00054_1693991 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0072K14, complete sequence.
          Length = 575

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 7/74 (9%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW-------NISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            ++D GL+ +   C  L+ L ++         S++++EGL  ++ GC +L  L L  C  +
Sbjct: 321  ISDKGLQVVASSCKDLQELRVFPSDFYVAGYSAVTEEGLVAVSLGCPKLNSL-LYFCHQM 379

Query: 1135 TDKSLMAIAKSCPN 1176
            T+ +L+ +AK+CPN
Sbjct: 380  TNAALVTVAKNCPN 393



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS--- 1146
            V+D  L+ + R  P  RAL L +    S +GL  +AS C  L +LDL Q   + D+    
Sbjct: 112  VSDESLELLARSFPRFRALVLISCEGFSTDGLAAVASHCKLLRELDL-QENEVEDRGPRW 170

Query: 1147 LMAIAKSCPNLASV 1188
            L     SC +L S+
Sbjct: 171  LSCFPDSCTSLVSL 184



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 7/58 (12%)
 Frame = +1

Query: 1036 LWNISSISDEGLFEIASGCHQLEKLD-------LCQCPGITDKSLMAIAKSCPNLASV 1188
            LW +  ISD+GL  +AS C  L++L        +     +T++ L+A++  CP L S+
Sbjct: 315  LWVLDCISDKGLQVVASSCKDLQELRVFPSDFYVAGYSAVTEEGLVAVSLGCPKLNSL 372



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 22/66 (33%), Positives = 33/66 (50%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL +LSI G      +TD     IG+    L  LS+   +  SD+G+  + +GC  L KL
Sbjct: 428  GLQRLSISGL-----LTDKVFMYIGKYAKQLEMLSI-AFAGDSDKGMMHVMNGCKNLRKL 481

Query: 1111 DLCQCP 1128
            ++   P
Sbjct: 482  EIRDSP 487



>gb:CR382139_1673111 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 732

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 21/68 (30%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D  L  +  GCP L  L+L N + ++   +  +   C +L+ +DL    GI D  ++A
Sbjct: 184  LVDDDLLKLFVGCPKLERLTLVNCTKLTYSPVTSVLKNCEKLQSIDLTGVTGIHDDIILA 243

Query: 1156 IAKSCPNL 1179
            +A +CP L
Sbjct: 244  LANNCPRL 251



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 19/62 (30%), Positives = 37/62 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD+ L+A+ +   SL  + L +   I+D G+  +   CH+++ +DL  C  +TD +L+ 
Sbjct: 394  ITDASLRALSQLGRSLHYIHLGHCGLITDFGVASLVRSCHRIQYIDLACCSQLTDWTLVE 453

Query: 1156 IA 1161
            +A
Sbjct: 454  LA 455



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 16/56 (28%), Positives = 33/56 (58%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++ L+L  ++ + D+ L ++  GC +LE+L L  C  +T   + ++ K+C  L S+
Sbjct: 173  IKRLNLSFMTKLVDDDLLKLFVGCPKLERLTLVNCTKLTYSPVTSVLKNCEKLQSI 228



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 18/61 (29%), Positives = 31/61 (50%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            N    +TD  ++A+   C SL  + L N S+++D+ L  I     QL +  +    G+TD
Sbjct: 283  NGSANITDRSIEAMHENCKSLVEIDLHNCSNVTDKYLKLIFLNLSQLREFRISNAAGVTD 342

Query: 1141 K 1143
            +
Sbjct: 343  R 343



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V++  +  + + CP L+ +     ++I+D  +  +   C  L ++DL  C  +TDK L  
Sbjct: 262  VSEDAILKLLKSCPMLKRVKFNGSANITDRSIEAMHENCKSLVEIDLHNCSNVTDKYLKL 321

Query: 1156 I 1158
            I
Sbjct: 322  I 322



>gb:AK030172_1161864 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4933409A11
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 589

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 970  RGVTDSGLKAI--GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDK 1143
            R  TD GL+ +  G GC  L  L L   + IS +G   IAS C  +  L +   P +TD 
Sbjct: 391  RKFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRNIASSCTGIVHLTINDMPTLTDN 450

Query: 1144 SLMAIAKSCPNLASV 1188
             +  + + CP ++SV
Sbjct: 451  CVKVLVEKCPRISSV 465



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPG 1131
            N S   +T+  ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  
Sbjct: 361  NLSNTTITNRTMRLLPRYFHNLQNLSLAYCRKFTDKGLQYLNLGNGCHKLIYLDLSGCTQ 420

Query: 1132 ITDKSLMAIAKSCPNLASVT 1191
            I+ +    IA SC  +  +T
Sbjct: 421  ISVQGFRNIASSCTGIVHLT 440



>gb:BT002473_1636076 Arabidopsis thaliana SKP1 interacting partner 2
            (SKIP2) (At5g67250) mRNA, complete
            cds.>gb:BT008886_1640082 Arabidopsis thaliana At5g67250
            mRNA, complete cds.>gb:AF263378_1781679 Arabidopsis
            thaliana SKP1 interacting partner 2 (SKIP2) mRNA,
            complete cds.
          Length = 527

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 45/186 (24%), Positives = 81/186 (43%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LPDECL  +F+ L  G  +R  C+ V KRWL++                       D  +
Sbjct: 46   LPDECLAHVFQFL--GAGDRKRCSLVCKRWLLV-----------------------DGQS 80

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
              +  L   D+   F+ S  +      +      RC   +K+  +   A+A+ + R   L
Sbjct: 81   RHRLSLDAKDEISSFLTSMFNRFDSVTK---LALRC--DRKSVSLSDEALAMISVRCLNL 135

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
             ++ +RG    R +TD G++   + C +L+ LS+ +  +   +G+  +   C  LE+L +
Sbjct: 136  TRVKLRG---CREITDLGMEDFAKNCKNLKKLSVGS-CNFGAKGVNAMLEHCKLLEELSV 191

Query: 1117 CQCPGI 1134
             +  GI
Sbjct: 192  KRLRGI 197



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 29/91 (31%), Positives = 47/91 (51%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWN 1044
            L G  AT + LAAIA    +   L +L++ G+ +   + D+ +  I R C +LR   +  
Sbjct: 348  LIGVNATHMSLAAIASNCEK---LERLALCGSGT---IGDTEIACIARKCGALRKFCIKG 401

Query: 1045 ISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
               +SD G+  +A GC  L KL + +C  +T
Sbjct: 402  CP-VSDRGIEALAVGCPNLVKLKVKKCKVVT 431



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL--DLCQCPGITDKSL 1149
            V+D GL AI + C ++  L +      S+ GL  +A  C  L KL  D  +   I D+ L
Sbjct: 275  VSDIGLSAISK-CSNVETLHIVKTPECSNFGLIYVAERCKLLRKLHIDGWRTNRIGDEGL 333

Query: 1150 MAIAKSCPNL 1179
            +++AK C NL
Sbjct: 334  LSVAKHCLNL 343



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +1

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+SDE L  I+  C  L ++ L  C  ITD  +   AK+C NL  ++
Sbjct: 119  SLSDEALAMISVRCLNLTRVKLRGCREITDLGMEDFAKNCKNLKKLS 165



>gb:AY056152_1563483 Arabidopsis thaliana putative SKP1 interacting
            partner SKIP2 (At5g67250) mRNA, complete cds.
          Length = 304

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 45/186 (24%), Positives = 81/186 (43%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LPDECL  +F+ L  G  +R  C+ V KRWL++                       D  +
Sbjct: 46   LPDECLAHVFQFL--GAGDRKRCSLVCKRWLLV-----------------------DGQS 80

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
              +  L   D+   F+ S  +      +      RC   +K+  +   A+A+ + R   L
Sbjct: 81   RHRLSLDAKDEISSFLTSMFNRFDSVTK---LALRC--DRKSVSLSDEALAMISVRCLNL 135

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
             ++ +RG    R +TD G++   + C +L+ LS+ +  +   +G+  +   C  LE+L +
Sbjct: 136  TRVKLRG---CREITDLGMEDFAKNCKNLKKLSVGS-CNFGAKGVNAMLEHCKLLEELSV 191

Query: 1117 CQCPGI 1134
             +  GI
Sbjct: 192  KRLRGI 197



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +1

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+SDE L  I+  C  L ++ L  C  ITD  +   AK+C NL  ++
Sbjct: 119  SLSDEALAMISVRCLNLTRVKLRGCREITDLGMEDFAKNCKNLKKLS 165



>gb:AF467462_2496360 Danio rerio PpaB (ppaB) mRNA, partial cds.
          Length = 392

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+GT R  GL       + SF   + D  L  I +G   L++LSL +   IS
Sbjct: 265  SDTGIMHLAMGTLRLSGL-------DVSFCDKIGDQSLACIAQGLYQLKSLSLCSCH-IS 316

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H+L  L++ QC  ITDK L  IA     L  +
Sbjct: 317  DDGINRMVRQMHELRTLNIGQCVRITDKGLELIADHLTQLTGI 359



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TDS L  I +   +L  L L   S+I++ GL  IA G H+L+ L+L  C  ++D  +  
Sbjct: 128  ITDSSLGRIAQYLKNLEVLELGGCSNITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGH 187

Query: 1156 IA 1161
            +A
Sbjct: 188  LA 189



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R V+D G+       ++   GC SL  L+L +   ++D  L  I+ G
Sbjct: 165  GLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQKLTDLSLKHISKG 224

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
              +L+ L+L  C GI+D  ++ ++          +SC N++
Sbjct: 225  LTKLKVLNLSFCGGISDAGMIHLSHMTSLWSLNLRSCDNIS 265



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 30/96 (31%), Positives = 42/96 (43%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G  +   L   S         ++D G+  + R    LR L++     I
Sbjct: 289  KIGDQSLACIAQGLYQLKSLSLCSCH-------ISDDGINRMVRQMHELRTLNIGQCVRI 341

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 342  TDKGLELIADHLTQLTGIDLYGCTKITKRGLERITQ 377



>gb:AK117866_1815876 Arabidopsis thaliana At1g77000 mRNA for unknown
            protein, complete cds, clone: RAFL19-04-B19.
          Length = 146

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 21/57 (36%), Positives = 34/57 (59%)
 Frame = +1

Query: 997  AIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
            ++  GCP LR L L +   I+DE +  +A+ C  L  L L  C  ITD+++ ++A+S
Sbjct: 2    SLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNITDRAMYSLAQS 58



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = +1

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            +A GC  L  LDLC C  ITD+S++A+A  C +L S+
Sbjct: 3    LAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSL 39



>gb:AC114261_1205586 Dictyostelium discoideum chromosome 2 map
            126059-159710 strain AX4, complete sequence.
          Length = 2159

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQ-LEKLDLCQCPGITDKSLM 1152
            ++D  +  I +   +L+ + L   + ISD G+ EIA  C Q L +L L  C  +TD S++
Sbjct: 1878 ISDESVITIAQRLKNLKNIDLTKCTQISDRGVIEIAKQCKQNLNRLILVSCTQVTDASII 1937

Query: 1153 AIAKSCPNL 1179
             +A  C +L
Sbjct: 1938 EVANQCSSL 1946



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCP-SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            ++D G+  I + C  +L  L L + + ++D  + E+A+ C  L  LDL QC  ITD+SL+
Sbjct: 1904 ISDRGVIEIAKQCKQNLNRLILVSCTQVTDASIIEVANQCSSLIHLDLSQCEKITDQSLL 1963

Query: 1153 AIAKSCPNL 1179
             +++    L
Sbjct: 1964 KVSQGLRQL 1972



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +++ G+ ++ RGCP+L  + L     I+D  + E+   C QL  LDL +C  +TD
Sbjct: 1625 LSNPGIVSLARGCPNLYVVDLSGCMKITDFAIHELLQNCKQLHTLDLRKCVNLTD 1679



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 22/65 (33%), Positives = 34/65 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D+ +  I    P L  L L   + ISDE +  IA     L+ +DL +C  I+D+ ++ 
Sbjct: 1852 INDTSILTITNQSPLLETLILAMCTDISDESVITIAQRLKNLKNIDLTKCTQISDRGVIE 1911

Query: 1156 IAKSC 1170
            IAK C
Sbjct: 1912 IAKQC 1916



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 19/53 (35%), Positives = 31/53 (58%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            L+ ++L   +++ D  L      C  +E LD+ +CP ITD SL +I  SCP++
Sbjct: 2079 LKTVNLSWCANMEDSALIGFLKQCTAIETLDISKCPKITDNSLESILDSCPSI 2131



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 6/74 (8%)
 Frame = +1

Query: 976  VTDSGLKAIGR-----GCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPG-IT 1137
            +TD G+ ++G      GC  L  +       ISD  L ++A GC  +  LDL QC   IT
Sbjct: 1982 ITDVGVSSLGEISEGYGCQYLEVIKFGYCRFISDSSLIKLAFGCPFVSNLDLSQCSNLIT 2041

Query: 1138 DKSLMAIAKSCPNL 1179
             +++ +  K+ P L
Sbjct: 2042 PRAIRSAIKAWPRL 2055



 Score = 40.4 bits (93), Expect = 0.071
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = +1

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            I+D+ L +I+  C  L  LDL  C  ITD+ +  + K+C  L+S+
Sbjct: 1726 ITDQSLKKISENCQSLTNLDLVLCENITDQGVQLLGKNCLKLSSI 1770



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 19/68 (27%), Positives = 33/68 (48%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +    L +I   C +L  + L     +S+ G+  +A GC  L  +DL  C  ITD ++  
Sbjct: 1599 IPSDALNSISMSCKNLEVIILKGCYQLSNPGIVSLARGCPNLYVVDLSGCMKITDFAIHE 1658

Query: 1156 IAKSCPNL 1179
            + ++C  L
Sbjct: 1659 LLQNCKQL 1666



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            P +++L L     +S   L  I S C QL+KL L  C  I   +L +I+ SC NL
Sbjct: 1560 PFMQSLDLEGAKFLSTISLKTIGSTCSQLKKLSLANCINIPSDALNSISMSCKNL 1614



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            S +G+TD  LK I   C SL  L L    +I+D+G+  +   C +L  ++L     +T
Sbjct: 1722 SGKGITDQSLKKISENCQSLTNLDLVLCENITDQGVQLLGKNCLKLSSINLFSSKNLT 1779



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 4/75 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWN--ISSISDEGLFEIASG--CHQLEKLDLCQCPGITDK 1143
            +TD  L  + +G   LR L +    I+ +    L EI+ G  C  LE +    C  I+D 
Sbjct: 1957 ITDQSLLKVSQGLRQLRILCMEECIITDVGVSSLGEISEGYGCQYLEVIKFGYCRFISDS 2016

Query: 1144 SLMAIAKSCPNLASV 1188
            SL+ +A  CP ++++
Sbjct: 2017 SLIKLAFGCPFVSNL 2031



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 19/63 (30%), Positives = 33/63 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD+ +  +   C SL  L L     I+D+ L +++ G  QL  L + +C  ITD  + +
Sbjct: 1931 VTDASIIEVANQCSSLIHLDLSQCEKITDQSLLKVSQGLRQLRILCMEECI-ITDVGVSS 1989

Query: 1156 IAK 1164
            + +
Sbjct: 1990 LGE 1992



>gb:AY823669_2088564 Rattus norvegicus spinal cord injury and
            regeneration related protein 1 (Scirr1) mRNA, complete
            cds.
          Length = 479

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+ G+  +    P+L +LSL   S ++D+G+  +A    +L  LDL  CP ITD +L  
Sbjct: 307  ITNHGVVNVVHSLPNLTSLSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRITDMALEY 366

Query: 1156 IA 1161
            +A
Sbjct: 367  VA 368



 Score = 38.5 bits (88), Expect = 0.27
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L  LS+ G +    VTD G++ +      LR+L L     I+D  L  +A   H+LE+L 
Sbjct: 322  LTSLSLSGCSK---VTDDGVELVAENLRKLRSLDLSWCPRITDMALEYVACDLHRLEELV 378

Query: 1114 LCQCPGITDKSL 1149
            L +C  ITD  L
Sbjct: 379  LDRCVRITDTGL 390



>pir|T45861|T45861 hypothetical protein F3A4.160 - Arabidopsis
            thaliana>gb:ATF3A4_1550562 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F3A4.
          Length = 522

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 46/186 (24%), Positives = 78/186 (41%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LPD+CL  IF+ L  G  +R  C+ VSKRWL++                     +G N  
Sbjct: 44   LPDDCLAHIFQFLSAG--DRKRCSLVSKRWLLV---------------------DGQNR- 79

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGL 936
                  +  D K   +          +       RC   +++  +   A+ + + R   L
Sbjct: 80   ----HRLSLDAKSEILPFLPCIFNRFDSVTKLALRC--DRRSFSLSDEALFIVSIRCSNL 133

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
             ++ +RG    R +TD G+++  R C SLR LS  +  +   +G+  +   C  LE+L L
Sbjct: 134  IRVKLRG---CREITDLGMESFARNCKSLRKLSCGS-CTFGAKGINAMLEHCKVLEELSL 189

Query: 1117 CQCPGI 1134
             +  G+
Sbjct: 190  KRIRGL 195



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 5/104 (4%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDS---GLKAIGRGCPSLRALSL--WNI 1047
            T++RL  + V      G+ K S           D    GL ++   C  LR L +  W +
Sbjct: 260  TEIRLERLQVTDIGLFGISKCSNLETLHIVKTPDCSNLGLASVVERCKLLRKLHIDGWRV 319

Query: 1048 SSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
              I D+GL  +A  C  L++L L      T  SL AIA +C  L
Sbjct: 320  KRIGDQGLMSVAKHCLNLQELVLIGVDA-TYMSLSAIASNCKKL 362



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 16/47 (34%), Positives = 28/47 (59%)
 Frame = +1

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S+SDE LF ++  C  L ++ L  C  ITD  + + A++C +L  ++
Sbjct: 117  SLSDEALFIVSIRCSNLIRVKLRGCREITDLGMESFARNCKSLRKLS 163



>gb:BX649324_2567750 Zebrafish DNA sequence from clone DKEY-85M15 in
            linkage group 4 Contains the 5' end of the wnt5a gene for
            wingless-type MMTV integration site family member 5a, the
            ppab gene for partner of paired b, the 3' end of the gene
            for a novel protein similar to vertebrate
            Rab6-interacting protein 2 (ELKS) and a CpG island,
            complete sequence.
          Length = 400

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+GT R  GL       + SF   + D  L  I +G   L++LSL +   IS
Sbjct: 267  SDTGIMHLAMGTLRLSGL-------DVSFCDKIGDQSLAYIAQGLYQLKSLSLCSCH-IS 318

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H+L  L++ QC  ITDK L  IA     L  +
Sbjct: 319  DDGINRMVRQMHELRTLNIGQCVRITDKGLELIADHLTQLTGI 361



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TDS L  I +   +L  L L   S+I++ GL  IA G H+L+ L+L  C  ++D  +  
Sbjct: 130  ITDSSLGRIAQYLKNLEVLELGGCSNITNTGLLLIAWGLHRLKSLNLRSCRHVSDVGIGH 189

Query: 1156 IA 1161
            +A
Sbjct: 190  LA 191



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL +L      S R V+D G+       ++   GC SL  L+L +   ++D  L  I+ G
Sbjct: 167  GLHRLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQKLTDLSLKHISKG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
              +L+ L+L  C GI+D  ++ ++          +SC N++
Sbjct: 227  LTKLKVLNLSFCGGISDAGMIHLSHMTSLWSLNLRSCDNIS 267



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 30/96 (31%), Positives = 42/96 (43%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G  +   L   S         ++D G+  + R    LR L++     I
Sbjct: 291  KIGDQSLAYIAQGLYQLKSLSLCSCH-------ISDDGINRMVRQMHELRTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 344  TDKGLELIADHLTQLTGIDLYGCTKITKRGLERITQ 379



>gb:BX908798_830310 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 501

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 22/61 (36%), Positives = 33/61 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +T+  LK+I R C  L    +     ++D+G+ EI S C  L K +  +C  ITDK L+ 
Sbjct: 379  LTNDDLKSICRNCSRLEEFDVEECRLLTDQGILEIFSSCSHLSKFNCNRCDLITDKGLLE 438

Query: 1156 I 1158
            I
Sbjct: 439  I 439



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R +TD G+  I   C  L   +      I+D+GL EI    H L +L + +C  +TD+ L
Sbjct: 403  RLLTDQGILEIFSSCSHLSKFNCNRCDLITDKGLLEIGVRAHLLSQLSIERCSKLTDQGL 462

Query: 1150 MAIAKSCPNLASVT 1191
            +   +  PNL  ++
Sbjct: 463  LYFLRLKPNLKELS 476



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 16/55 (29%), Positives = 32/55 (58%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            +L +LS      ++++ L  I   C +LE+ D+ +C  +TD+ ++ I  SC +L+
Sbjct: 367  TLISLSTRQCHQLTNDDLKSICRNCSRLEEFDVEECRLLTDQGILEIFSSCSHLS 421



>pir|T00403|T00403 hypothetical protein At2g44900 [imported] -
            Arabidopsis thaliana>gb:AC002388_1530613 Arabidopsis
            thaliana chromosome 2 clone T13E15 map m336, complete
            sequence.
          Length = 930

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 29/92 (31%), Positives = 43/92 (46%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            KK TD  L+ I    AR   L  L + G +    +T   +KA+   CP L+ L L  I  
Sbjct: 143  KKITDATLSMIV---ARHEALESLQL-GPDFCERITSDAIKAVAFCCPKLKKLRLSGIRD 198

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            ++ E +  +A  C QL  L    C  I +++L
Sbjct: 199  VTSEAIEALAKHCPQLNDLGFLDCLNIDEEAL 230



>pir|T52139|T52139 LRR-containing F-box protein [imported] -
            Arabidopsis thaliana>gb:AY045625_1561216 Arabidopsis
            thaliana At2g39940/T28M21.10 mRNA, complete
            cds.>gb:AY133556_1581379 Arabidopsis thaliana
            At2g39940/T28M21.10 mRNA, complete
            cds.>gb:AF002109_1760569 Arabidopsis thaliana chromosome
            2 clone T28M21 map CIC10A06, complete
            sequence.>gb:AF036340_1762957 Arabidopsis thaliana
            LRR-containing F-box protein (COI1) mRNA, complete cds.
          Length = 592

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 25/69 (36%), Positives = 41/69 (59%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            G+TD GL  IG+  P++R + L  +   SDEGL E + GC  L+KL++  C   +++++ 
Sbjct: 449  GLTDLGLSYIGQYSPNVRWMLLGYVGE-SDEGLMEFSRGCPNLQKLEMRGC-CFSERAIA 506

Query: 1153 AIAKSCPNL 1179
            A     P+L
Sbjct: 507  AAVTKLPSL 515



>pir|T05201|T05201 hypothetical protein F4I10.140 - Arabidopsis
            thaliana>gb:ATCHRIV79_1547241 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 79.>gb:ATF4I10_1550703
            Arabidopsis thaliana DNA chromosome 4, BAC clone F4I10
            (ESSA project).
          Length = 934

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 6/76 (7%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS----L 1149
            D+ +++    CP L +L + N S +SDE L EIA  C  L  L+   CP I+ +S    +
Sbjct: 384  DAAIRSAAISCPQLESLDVSNCSCVSDETLREIAQACANLHILNASYCPNISLESVHLPM 443

Query: 1150 MAIAK--SCPNLASVT 1191
            + + K  SC  + S +
Sbjct: 444  LTVLKLHSCEGITSAS 459



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            CP L+ L + +   + D  +   A  C QLE LD+  C  ++D++L  IA++C NL
Sbjct: 368  CPLLQLLDIASCHKLLDAAIRSAAISCPQLESLDVSNCSCVSDETLREIAQACANL 423



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 22/59 (37%), Positives = 32/59 (54%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            CP LR+LSL   S++S   L      C  L+ LD+  C  + D ++ + A SCP L S+
Sbjct: 348  CPQLRSLSLKR-SNMSQAML-----NCPLLQLLDIASCHKLLDAAIRSAAISCPQLESL 400



>pir|F86261|F86261 F13K23.7 protein - Arabidopsis
            thaliana>gb:AE005172_890293 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AY099541_1576567 Arabidopsis thaliana
            transport inhibitor response 1, putative (At1g12820)
            mRNA, complete cds.>gb:BT002118_1635721 Arabidopsis
            thaliana transport inhibitor response 1, putative
            (At1g12820) mRNA, complete cds.>gb:F13K23_1677388
            Sequence of BAC F13K23 from Arabidopsis thaliana
            chromosome 1, complete sequence.
          Length = 577

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 9/76 (11%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW---------NISSISDEGLFEIASGCHQLEKLDLCQCP 1128
            + D GL  +   C  L+ L ++         N +S+++ GL  I++GC +L  + L  C 
Sbjct: 321  IGDKGLAVVAATCKELQELRVFPSDVHGEEDNNASVTEVGLVAISAGCPKLHSI-LYFCK 379

Query: 1129 GITDKSLMAIAKSCPN 1176
             +T+ +L+A+AK+CPN
Sbjct: 380  QMTNAALIAVAKNCPN 395



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = +1

Query: 1024 RALSLWNISSISDEGLFEIASGCHQLEKLDLCQC---------PGITDKSLMAIAKSCPN 1176
            R   LW + SI D+GL  +A+ C +L++L +              +T+  L+AI+  CP 
Sbjct: 311  RLQRLWILDSIGDKGLAVVAATCKELQELRVFPSDVHGEEDNNASVTEVGLVAISAGCPK 370

Query: 1177 LASV 1188
            L S+
Sbjct: 371  LHSI 374



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            VTD  L  + R   + ++L L +    + +GL  IA+ C  L +LDL
Sbjct: 112  VTDESLDLLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDL 158



>gb:AF139835_1771452 Populus tremula x Populus tremuloides F-box
            containing protein TIR1 (TIR1) mRNA, complete cds.
          Length = 635

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 23/75 (30%), Positives = 44/75 (58%), Gaps = 7/75 (9%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISS-------ISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            + D GL+A+   C  LR L ++ +         +S+ GL  I+ GC +L+ + L  C  +
Sbjct: 388  ICDEGLQAVAATCKELRELRVFPVDPREDIEGPVSEVGLQAISEGCRKLQSI-LYFCHRM 446

Query: 1135 TDKSLMAIAKSCPNL 1179
            T+ +++A++K+CP+L
Sbjct: 447  TNAAVVAMSKNCPDL 461



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 23/73 (31%), Positives = 38/73 (52%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            + FR +    L AI   C +L +L+ ++ + +S E L  I S CH+L+   +     I D
Sbjct: 334  SGFREIIPDYLPAINPVCANLTSLN-FSFADVSAEQLKPIISNCHKLQIFWVLD--SICD 390

Query: 1141 KSLMAIAKSCPNL 1179
            + L A+A +C  L
Sbjct: 391  EGLQAVAATCKEL 403



>gb:CR382125_1657482 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1239

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 19/63 (30%), Positives = 39/63 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TDS LK++ R   +++ +   +  +ISDEG+  + S C +++ +D   C  +T+K+L  
Sbjct: 747  ITDSALKSLARLGKNIQTMHFGHCFNISDEGVRVLVSNCPKIQYIDFACCTNLTNKTLYE 806

Query: 1156 IAK 1164
            +A+
Sbjct: 807  LAE 809



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +1

Query: 952  RGNNSFRG--VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            R N SF G  +TD  L+    GCP+L  L+L     I+ + + ++  GC  L+ +D+   
Sbjct: 527  RLNFSFVGDYMTDRKLEHF-IGCPNLERLTLVFCKYITTKSVAKVLKGCQYLQSVDITGI 585

Query: 1126 PGITDKSLMAIAKSCPNL 1179
              I D     +A  C  +
Sbjct: 586  HHIRDDLFEVLASDCERI 603



>gb:CER05H5_1366508 Caenorhabditis elegans cosmid R05H5, complete
            sequence.>gb:CET01E8_1366974 Caenorhabditis elegans
            cosmid T01E8, complete sequence.
          Length = 535

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            L AI RG  +L  L   ++SS+ D  L  +   C QL  L++  C  ++DK L  +AK C
Sbjct: 398  LFAIARGARNLTDLETSHMSSVDDRFLCLLGGNCRQLRCLNINGCRMVSDKGLAVLAKRC 457

Query: 1171 P 1173
            P
Sbjct: 458  P 458



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE-KLDLCQCPGITDKSLM 1152
            V D  L  +G  C  LR L++     +SD+GL  +A  C   E ++    C   TDKS+ 
Sbjct: 419  VDDRFLCLLGGNCRQLRCLNINGCRMVSDKGLAVLAKRCPLREVRIRGTAC---TDKSIY 475

Query: 1153 AIAKSCPNL 1179
             +A+ CP L
Sbjct: 476  TLAQFCPEL 484



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G   +L     N  R V+D GL  + + CP LR + +   ++ +D+ ++ +A  C +LE 
Sbjct: 429  GNCRQLRCLNINGCRMVSDKGLAVLAKRCP-LREVRIRG-TACTDKSIYTLAQFCPELEW 486

Query: 1108 L---DLCQCPGITDKSLMAIAKSC 1170
            +   D    P  +D +L  +  SC
Sbjct: 487  ISYADYSGRPKFSDAALQCLRDSC 510



>gb:AC116979_1207101 Dictyostelium discoideum chromosome 2 map
            6445720-6776760 strain AX4, complete sequence.
          Length = 1629

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 21/58 (36%), Positives = 34/58 (58%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P L+ L L+ +  I+D+ +  I+S C +LE LDL  C GI  +    + K CP++A +
Sbjct: 1318 PILKKLKLYELPDITDKTVKLISSTCKELEVLDLGGCSGILGEDFNELYKGCPSIAKL 1375



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 22/72 (30%), Positives = 34/72 (47%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            G+       + +GCPS+  L+L     I ++G+ EI +G   L +LDL +C  +T  S  
Sbjct: 1356 GILGEDFNELYKGCPSIAKLAL--PPFIENDGVSEILNGTLPLVRLDLIKCSKVTHHSYS 1413

Query: 1153 AIAKSCPNLASV 1188
                 C  L  V
Sbjct: 1414 KALDICSTLKKV 1425



>pir|T23945|T23945 hypothetical protein T01E8.1 - Caenorhabditis
            elegans
          Length = 551

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            L AI RG  +L  L   ++SS+ D  L  +   C QL  L++  C  ++DK L  +AK C
Sbjct: 414  LFAIARGARNLTDLETSHMSSVDDRFLCLLGGNCRQLRCLNINGCRMVSDKGLAVLAKRC 473

Query: 1171 P 1173
            P
Sbjct: 474  P 474



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE-KLDLCQCPGITDKSLM 1152
            V D  L  +G  C  LR L++     +SD+GL  +A  C   E ++    C   TDKS+ 
Sbjct: 435  VDDRFLCLLGGNCRQLRCLNINGCRMVSDKGLAVLAKRCPLREVRIRGTAC---TDKSIY 491

Query: 1153 AIAKSCPNL 1179
             +A+ CP L
Sbjct: 492  TLAQFCPEL 500



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 3/84 (3%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G   +L     N  R V+D GL  + + CP LR + +   ++ +D+ ++ +A  C +LE 
Sbjct: 445  GNCRQLRCLNINGCRMVSDKGLAVLAKRCP-LREVRIRG-TACTDKSIYTLAQFCPELEW 502

Query: 1108 L---DLCQCPGITDKSLMAIAKSC 1170
            +   D    P  +D +L  +  SC
Sbjct: 503  ISYADYSGRPKFSDAALQCLRDSC 526



>gb:AB016889_1513188 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MDJ14.>gb:AY062568_1565224 Arabidopsis thaliana
            transport inhibitor response-like protein (At3g26830;
            MDJ14.12) mRNA, complete cds.>gb:BT010396_1640342
            Arabidopsis thaliana At3g26830 mRNA, complete cds.
          Length = 575

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 22/74 (29%), Positives = 43/74 (58%), Gaps = 7/74 (9%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW-------NISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            + D GL+ +   C  L+ L ++         +++++EGL  I++GC +L  + L  C  +
Sbjct: 321  IGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGLVAISAGCPKLHSI-LYFCQQM 379

Query: 1135 TDKSLMAIAKSCPN 1176
            T+ +L+ +AK+CPN
Sbjct: 380  TNAALVTVAKNCPN 393



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 7/58 (12%)
 Frame = +1

Query: 1036 LWNISSISDEGLFEIASGCHQLEKLDLCQC-------PGITDKSLMAIAKSCPNLASV 1188
            LW + SI D+GL  +AS C +L++L +            +T++ L+AI+  CP L S+
Sbjct: 315  LWILDSIGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGLVAISAGCPKLHSI 372



>gb:AF026206_1234219 Caenorhabditis elegans cosmid T28B4, complete
            sequence.
          Length = 535

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P+LR ++LW +  I+DE +  I+S C  LE L +  CP +T   L  + + C  L ++
Sbjct: 233  PNLRVVNLWGVPFITDEHVDAISSNCAHLECLCVNYCPKVTGSCLKLVLQRCRKLKTL 290



>gb:AF026206_1234218 Caenorhabditis elegans cosmid T28B4, complete
            sequence.
          Length = 518

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P+LR ++LW +  I+DE +  I+S C  LE L +  CP +T   L  + + C  L ++
Sbjct: 216  PNLRVVNLWGVPFITDEHVDAISSNCAHLECLCVNYCPKVTGSCLKLVLQRCRKLKTL 273



>gb:AF026206_1234217 Caenorhabditis elegans cosmid T28B4, complete
            sequence.
          Length = 552

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P+LR ++LW +  I+DE +  I+S C  LE L +  CP +T   L  + + C  L ++
Sbjct: 250  PNLRVVNLWGVPFITDEHVDAISSNCAHLECLCVNYCPKVTGSCLKLVLQRCRKLKTL 307



>pir|T32441|T32441 hypothetical protein T28B4.1 - Caenorhabditis
            elegans
          Length = 419

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P+LR ++LW +  I+DE +  I+S C  LE L +  CP +T   L  + + C  L ++
Sbjct: 233  PNLRVVNLWGVPFITDEHVDAISSNCAHLECLCVNYCPKVTGSCLKLVLQRCRKLKTL 290



>gb:AY398381_2531911 Danio rerio clone RK131A2B02 hypothetical protein
            MGC40195 (MGC40195) mRNA, complete cds.
          Length = 411

 Score = 43.1 bits (100), Expect = 0.011
 Identities = 30/72 (41%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +1

Query: 976  VTDSGL-KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            +TD+GL  A  +  PSLR L+L     I+D  L  IA     LE LDL  C  IT+  L+
Sbjct: 103  LTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLL 162

Query: 1153 AIAKSCPNLASV 1188
             IA    NL S+
Sbjct: 163  LIAWGLHNLKSL 174



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 26/71 (36%), Positives = 38/71 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V D  L  I +G   L++LSL +   ISD+G+  +    H+L+ L++ QC  ITDK L  
Sbjct: 292  VGDQSLAYIAQGLYQLKSLSLCSCH-ISDDGINRMVRQMHELKTLNIGQCVRITDKGLEL 350

Query: 1156 IAKSCPNLASV 1188
            IA     L  +
Sbjct: 351  IADHLTQLTGI 361



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TDS L  I +   +L  L L   S+I++ GL  IA G H L+ L+L  C  ++D  +  
Sbjct: 130  ITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGH 189

Query: 1156 IA 1161
            +A
Sbjct: 190  LA 191



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL  L      S R V+D G+       ++   GC +L  L+L +   ++D  L  I+ G
Sbjct: 167  GLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
             ++L+ L+L  C GI+D  ++ ++          +SC N++
Sbjct: 227  LNKLKVLNLSFCGGISDAGMIHLSHMTQLWTLNLRSCDNIS 267



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 29/96 (30%), Positives = 42/96 (43%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G  +   L   S         ++D G+  + R    L+ L++     I
Sbjct: 291  KVGDQSLAYIAQGLYQLKSLSLCSCH-------ISDDGINRMVRQMHELKTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 344  TDKGLELIADHLTQLTGIDLYGCTKITKRGLERITQ 379



>gb:AF467461_2496359 Danio rerio PpaA (ppaA) mRNA, partial cds.
          Length = 386

 Score = 43.1 bits (100), Expect = 0.011
 Identities = 30/72 (41%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +1

Query: 976  VTDSGL-KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            +TD+GL  A  +  PSLR L+L     I+D  L  IA     LE LDL  C  IT+  L+
Sbjct: 98   LTDNGLGHAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLL 157

Query: 1153 AIAKSCPNLASV 1188
             IA    NL S+
Sbjct: 158  LIAWGLHNLKSL 169



 Score = 42.4 bits (98), Expect = 0.019
 Identities = 26/71 (36%), Positives = 38/71 (53%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V D  L  I +G   L++LSL +   ISD+G+  +    H+L+ L++ QC  ITDK L  
Sbjct: 287  VGDQSLAYIAQGLYQLKSLSLCSCH-ISDDGINRMVRQMHELKTLNIGQCVRITDKGLEL 345

Query: 1156 IAKSCPNLASV 1188
            IA     L  +
Sbjct: 346  IADHLTQLTGI 356



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 22/62 (35%), Positives = 34/62 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TDS L  I +   +L  L L   S+I++ GL  IA G H L+ L+L  C  ++D  +  
Sbjct: 125  ITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGLHNLKSLNLRSCRHVSDVGIGH 184

Query: 1156 IA 1161
            +A
Sbjct: 185  LA 186



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 27/101 (26%), Positives = 49/101 (48%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL  L      S R V+D G+       ++   GC +L  L+L +   ++D  L  I+ G
Sbjct: 162  GLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKG 221

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
             ++L+ L+L  C GI+D  ++ ++          +SC N++
Sbjct: 222  LNKLKGLNLSFCGGISDAGMIHLSHMTQLWTLNLRSCDNIS 262



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 29/96 (30%), Positives = 42/96 (43%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G  +   L   S         ++D G+  + R    L+ L++     I
Sbjct: 286  KVGDQSLAYIAQGLYQLKSLSLCSCH-------ISDDGINRMVRQMHELKTLNIGQCVRI 338

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT + L  I +
Sbjct: 339  TDKGLELIADHLTQLTGIDLYGCTKITKRGLERITQ 374



>gb:AY359238_1948007 Homo sapiens F-box and leucine-rich repeat
            protein 13 transcript variant 1 (FBXL13) mRNA, complete
            cds.
          Length = 453

 Score = 43.1 bits (100), Expect = 0.011
 Identities = 58/256 (22%), Positives = 101/256 (39%), Gaps = 25/256 (9%)
 Frame = +1

Query: 487  FPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRW 666
            FP R  S +          VDE  +  I +LP+  + +IF  L +  ++   C  V+  W
Sbjct: 136  FPERSSSEVFL--------VDETLKCDISLLPERAILQIFFYLSL--KDVIICGQVNHAW 185

Query: 667  LML--------------LSTICRDE--LSTIKSGEASEPEEGDNATAMQPELIKSDKKDG 798
            +++              +  +  D+  +ST++    +          ++P+  +S     
Sbjct: 186  MLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRSVSHCR 245

Query: 799  FVQS-NVSEVQD-NEEGDGFLSRCLDGKKATDVRLAAIAVGTARR-----GGLGKLSIRG 957
             +Q  NVS+     +E    +S    G    ++    I   T R        L  LS+  
Sbjct: 246  NLQELNVSDCPTFTDESMRHISEGCPGVLCLNLSNTTITNRTMRLLPRHFHNLQNLSLAY 305

Query: 958  NNSFRGVTDSGLKAI--GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPG 1131
               F   TD GL+ +  G GC  L  L L   + I+D  +  +++ CH L  LD+  C  
Sbjct: 306  CRRF---TDKGLQYLNLGNGCHKLIYLDLSGCTQITDSAMEMLSAKCHYLHILDISGCVL 362

Query: 1132 ITDKSLMAIAKSCPNL 1179
            +TD+ L  +   C  L
Sbjct: 363  LTDQILEDLQIGCKQL 378



>pir|T45673|T45673 hypothetical protein F14P22.120 - Arabidopsis
            thaliana>gb:ATF14P22_1548621 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F14P22.
          Length = 314

 Score = 43.1 bits (100), Expect = 0.011
 Identities = 24/53 (45%), Positives = 32/53 (60%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            LR L +    +ISDEG+  IA  C++LE L+L  C  ITD  +  IA SC +L
Sbjct: 203  LRFLDICGAQNISDEGIGHIAK-CNKLESLNLTWCVRITDAGVNTIANSCTSL 254



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH-QLEKLDLCQCPGITDKSLM 1152
            +TD+G+  I   C SL  LSL+ I  ++D  L  ++  C   L  LD+  C GI  +S  
Sbjct: 239  ITDAGVNTIANSCTSLEFLSLFGIVGVTDRCLETLSQTCSTTLTTLDVNGCTGIKRRSRE 298

Query: 1153 AIAKSCPNL 1179
             + +  P L
Sbjct: 299  ELLQMFPRL 307



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 4/76 (5%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCP----SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            GV DS LK +   CP    SL  L+L     ISD G+  I S C +L+   +     +TD
Sbjct: 78   GVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAITSICPKLKVFSIYWNVRVTD 137

Query: 1141 KSLMAIAKSCPNLASV 1188
              +  + K+C ++  +
Sbjct: 138  AGIRNLVKNCRHITDL 153



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSL-WNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            N  + ++D+G++AI   CP L+  S+ WN+  ++D G+  +   C  +  L+L  C
Sbjct: 104  NVCQKISDNGIEAITSICPKLKVFSIYWNV-RVTDAGIRNLVKNCRHITDLNLSGC 158



>gb:BC077430_2560140 Xenopus laevis F-box leucine-rich repeat protein
            13, mRNA (cDNA clone MGC:82207 IMAGE:3402730), complete
            cds.
          Length = 400

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 34/103 (33%), Positives = 51/103 (49%), Gaps = 1/103 (0%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRG-VTDSGLKAIGRGCPSLRALSLWNISSIS 1059
            +D  +  +A+G+ R  GL       + SF   V D  L  I +G   L++LSL +   IS
Sbjct: 267  SDTGIMHLAMGSLRLSGL-------DVSFCDKVGDQSLAYIAQGLYGLKSLSLCSCH-IS 318

Query: 1060 DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            D+G+  +    H L  L++ QC  ITDK L  IA+    L  +
Sbjct: 319  DDGINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGI 361



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 30/101 (29%), Positives = 49/101 (48%), Gaps = 17/101 (16%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGL-------KAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            GL  L++R   S R V+D G+       ++   GC SL  L+L +   ++D  L  I+ G
Sbjct: 170  GLKSLNLR---SCRHVSDVGIGHLAGMTRSAAEGCLSLEQLTLQDCQKLTDLALKHISRG 226

Query: 1090 CHQLEKLDLCQCPGITDKSLMAIA----------KSCPNLA 1182
               L  L+L  C GI+D  L+ ++          +SC N++
Sbjct: 227  LQGLRVLNLSFCGGISDAGLLHLSHMGGLRSLNLRSCDNIS 267



 Score = 39.3 bits (90), Expect = 0.16
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 7/93 (7%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            +G L     +  + VTDS L  I +    L+ L L   ++I++ GL  IA G H L+ L+
Sbjct: 116  IGSLRTLNLSLCKQVTDSSLGRIAQYLKGLQVLELGGCTNITNTGLLLIAWGLHGLKSLN 175

Query: 1114 LCQCPGITDKSL-------MAIAKSCPNLASVT 1191
            L  C  ++D  +        + A+ C +L  +T
Sbjct: 176  LRSCRHVSDVGIGHLAGMTRSAAEGCLSLEQLT 208



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 33/96 (34%), Positives = 45/96 (46%)
 Frame = +1

Query: 877  KATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSI 1056
            K  D  LA IA G     GL  LS+   +    ++D G+  + R    LR L++     I
Sbjct: 291  KVGDQSLAYIAQGLY---GLKSLSLCSCH----ISDDGINRMVRQMHGLRTLNIGQCVRI 343

Query: 1057 SDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            +D+GL  IA    QL  +DL  C  IT K L  I +
Sbjct: 344  TDKGLELIAEHLSQLTGIDLYGCTRITKKGLERITQ 379



>gb:AC084218_1733375 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0001A07, complete sequence.
          Length = 462

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/86 (38%), Positives = 44/86 (51%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            GL +LSI G      +TD   K+IG     L  LS+   +  SD GL  I SGC  L+KL
Sbjct: 316  GLRRLSISGL-----LTDLVFKSIGAHADRLEMLSI-AFAGNSDLGLHYILSGCKSLKKL 369

Query: 1111 DLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++  CP   DK L+A A     + S+
Sbjct: 370  EIRDCP-FGDKPLLANAAKLETMRSL 394



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL-----DLCQCPGITDKSLMA 1155
            +K I R C +L+   LW +  I D GL  +AS C++L++L     D      +T++ L+ 
Sbjct: 193  IKFISR-CRNLQ--QLWVMDLIEDHGLAVVASSCNKLQELRVFPSDPFGAGFLTERGLVD 249

Query: 1156 IAKSCPNLASV 1188
            ++ SCP L SV
Sbjct: 250  VSASCPMLESV 260



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 5/72 (6%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW-----NISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            + D GL  +   C  L+ L ++         +++ GL ++++ C  LE + L  C  +T+
Sbjct: 211  IEDHGLAVVASSCNKLQELRVFPSDPFGAGFLTERGLVDVSASCPMLESV-LYFCRRMTN 269

Query: 1141 KSLMAIAKSCPN 1176
            ++L+ IAK+ PN
Sbjct: 270  EALITIAKNRPN 281



>gb:CR382134_1667309 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 919

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +1

Query: 976  VTDSGLKAIG-RGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            +TD G +    R  P+L+ LSL + + ++D+ +  IA+  + LE LDL  C  ++D S+ 
Sbjct: 751  ITDQGFEHWNKRSFPNLKKLSLKDCTFLTDKSIISIANSANNLEILDLKFCCALSDVSID 810

Query: 1153 AIAKSCPNL 1179
             +   CP L
Sbjct: 811  MLCLGCPKL 819



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC-PGITDKSLM 1152
            +TD  + +I     +L  L L    ++SD  +  +  GC +L+ LDL  C   ++D SL+
Sbjct: 778  LTDKSIISIANSANNLEILDLKFCCALSDVSIDMLCLGCPKLKHLDLSFCGSAVSDFSLV 837

Query: 1153 AIA 1161
            AI+
Sbjct: 838  AIS 840



>pir|E96838|E96838 hypothetical protein T21F11.4 [imported] -
            Arabidopsis thaliana>gb:AE005173_895575 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC018849_1538414 Arabidopsis thaliana
            chromosome 1 BAC T21F11 genomic sequence, complete
            sequence.>gb:AY086192_1571247 Arabidopsis thaliana clone
            22321 mRNA, complete sequence.
          Length = 578

 Score = 42.7 bits (99), Expect = 0.014
 Identities = 23/69 (33%), Positives = 36/69 (52%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            D  L+ I R CP + +L +     I+ +G+ E+   C +L  LD+ +C GI  KSL  + 
Sbjct: 386  DECLEKISRHCPFIESLDVAQCPGITRDGILEVWRNCGKLRSLDISRCTGI--KSLGVVD 443

Query: 1162 KSCPNLASV 1188
               P L S+
Sbjct: 444  FELPKLESL 452



 Score = 41.6 bits (96), Expect = 0.032
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 4/70 (5%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLW----NISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            G +DS L +IG   P L  L +     + S +SD G+ E++S    L K+++     ITD
Sbjct: 119  GFSDSDLVSIGVNFPLLEKLDISYPNSSPSRVSDSGVIELSSNLKGLLKINISGNSFITD 178

Query: 1141 KSLMAIAKSC 1170
            KSL+A++++C
Sbjct: 179  KSLIALSQNC 188



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 17/46 (36%), Positives = 29/46 (63%)
 Frame = +1

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++ DE L +I+  C  +E LD+ QCPGIT   ++ + ++C  L S+
Sbjct: 383  NLLDECLEKISRHCPFIESLDVAQCPGITRDGILEVWRNCGKLRSL 428



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 19/57 (33%), Positives = 27/57 (47%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SLRA   W    I DE L  I+  C  L  LDL  C  ++ + +  + +SC  L  +
Sbjct: 451  SLRACGTW----IDDEALDMISKKCRGLLHLDLQGCLNVSSRGVKEVVQSCIRLREI 503



>gb:BC053821_2550768 Xenopus laevis hypothetical protein MGC64561,
            mRNA (cDNA clone MGC:64561 IMAGE:6880228), complete cds.
          Length = 292

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R + D  +  + +    L++LSL   ++ISD  + E A  C  LE LDL  C  + + S+
Sbjct: 170  RQLKDDAISYLVQKSTRLKSLSLAVNANISDIAVEETAKSCRDLEHLDLTGCLRVKNDSI 229

Query: 1150 MAIAKSCPNLASV 1188
              +A+ C NL S+
Sbjct: 230  RTLAEYCNNLKSL 242



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +1

Query: 1021 LRALSLWNISS-ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            L+ L L + S  ++D+ L  I    H L  ++L  C  +T +SL+AI+ SCP+L ++
Sbjct: 82   LQKLDLQSCSDWLTDKELLPIIGQNHHLTYINLNSCGQLTRQSLVAISLSCPHLQNI 138



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 20/77 (25%), Positives = 35/77 (45%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            NS   +T   L AI   CP L+ + L +   +    +  +A  C  LE +DL  C  + D
Sbjct: 115  NSCGQLTRQSLVAISLSCPHLQNICLGHCDWVDCLSMRSLADHCKCLEAIDLTACRQLKD 174

Query: 1141 KSLMAIAKSCPNLASVT 1191
             ++  + +    L S++
Sbjct: 175  DAISYLVQKSTRLKSLS 191



>gb:AP003873_1834620 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1118_A06.
          Length = 443

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK----LDLCQCPGITDK 1143
            +TD+GL A+G G   + +L L     IS+ G+  +  G   + K    LD+   P I+ +
Sbjct: 263  ITDAGLSALGNGRCPMSSLCLRGCKRISNNGIASLLCGSGTINKTLISLDIGNVPRISGR 322

Query: 1144 SLMAIAKSCPNLASV 1188
            ++  IAK+C  ++S+
Sbjct: 323  AVTLIAKNCEQISSL 337



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 19/77 (24%), Positives = 39/77 (50%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGIT 1137
            +++FR VTD G+  +  GC  L+ + L   S + D G   +   C  L+K ++     ++
Sbjct: 131  SSTFRRVTDFGIMMLADGCKQLKTIRLAGFSKVRDAGYAALLQSCKDLKKFEV-STGYLS 189

Query: 1138 DKSLMAIAKSCPNLASV 1188
            D + + + ++ P +  V
Sbjct: 190  DLTCLDLDEAAPKITEV 206



>gb:AK117894_1815902 Arabidopsis thaliana At4g33210 mRNA for unknown
            protein, complete cds, clone: RAFL19-07-J10.
          Length = 309

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 24/66 (36%), Positives = 35/66 (53%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            L+ +  GCP L +L L + + + + G+    SGC  LE LDL  CP I+  S+      C
Sbjct: 236  LEVLKLGCPRLASLFLQSCN-MDEAGVEAAISGCSSLETLDLRFCPKISSVSMSKFRTVC 294

Query: 1171 PNLASV 1188
            P+L  V
Sbjct: 295  PSLKRV 300



>gb:AC116979_1207102 Dictyostelium discoideum chromosome 2 map
            6445720-6776760 strain AX4, complete sequence.
          Length = 1445

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 22/58 (37%), Positives = 32/58 (55%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P LR L L+ I +++D  +  IAS C  LE LDL  C GI  +    + K CP++  +
Sbjct: 1148 PKLRKLKLYEIPTLTDLIVKLIASTCKDLEVLDLGGCSGILGEDFNELYKGCPSVVKL 1205



>gb:BX908798_830230 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1154

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            + DS L +     P+++ LSL N  S++  G+  + + C Q+EK+DLC C GI
Sbjct: 704  LNDSNLVSFVEKFPNVKELSLRNCPSLTGTGIRALITECPQIEKIDLCGCLGI 756



>pir|T47846|T47846 Arm repeat containing protein-like - Arabidopsis
            thaliana>gb:ATT8B10_1556440 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T8B10.
          Length = 928

 Score = 42.4 bits (98), Expect = 0.019
 Identities = 27/92 (29%), Positives = 43/92 (46%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISS 1053
            +K TD  L+ IA   AR   L  L + G +    +T   ++ I   CP L+ L +  +  
Sbjct: 136  RKITDATLSMIA---ARHEALESLQL-GPDFCERITSDAIRVIAFCCPKLKKLRVSGMRD 191

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +S E +  +A  C QL  L    C  I +++L
Sbjct: 192  VSSEAIESLAKHCPQLSDLGFLDCLNINEEAL 223



>gb:HSBA18I14_2010886 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 311

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG G+LS R            L A+  GCP L+ LSL +   +    L  +A  C  LE+
Sbjct: 118  GGCGQLSRRA-----------LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEE 166

Query: 1108 LDLCQCPGITDKSLMAIAK 1164
            LDL  C  + D++++ +A+
Sbjct: 167  LDLTACRQLKDEAIVYLAQ 185



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 97   LSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 156

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 157  LADRCPAL 164



>gb:HSBA18I14_2010885 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 190

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG G+LS R            L A+  GCP L+ LSL +   +    L  +A  C  LE+
Sbjct: 122  GGCGQLSRRA-----------LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEE 170

Query: 1108 LDLCQCPGITDKSLMAIAK 1164
            LDL  C  + D++++ +A+
Sbjct: 171  LDLTACRQLKDEAIVYLAQ 189



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 101  LSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 160

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 161  LADRCPAL 168



>gb:HSBA18I14_2010884 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 203

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG G+LS R            L A+  GCP L+ LSL +   +    L  +A  C  LE+
Sbjct: 122  GGCGQLSRRA-----------LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEE 170

Query: 1108 LDLCQCPGITDKSLMAIAK 1164
            LDL  C  + D++++ +A+
Sbjct: 171  LDLTACRQLKDEAIVYLAQ 189



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 101  LSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 160

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 161  LADRCPAL 168



>gb:HSBA18I14_2010883 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 208

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG G+LS R            L A+  GCP L+ LSL +   +    L  +A  C  LE+
Sbjct: 122  GGCGQLSRRA-----------LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEE 170

Query: 1108 LDLCQCPGITDKSLMAIAK 1164
            LDL  C  + D++++ +A+
Sbjct: 171  LDLTACRQLKDEAIVYLAQ 189



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 101  LSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 160

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 161  LADRCPAL 168



>gb:HSBA18I14_2010882 Human DNA sequence from clone RP11-18I14 on
            chromosome 10 Contains the GBF1 gene for golgi-specific
            brefeldin A resistance factor 1 (SEC7 domain family
            member, Myeloblast KIAA0248), the NFKB2 gene for the
            nuclear factor of kappa light polypeptide gene enhancer
            in B-cells 2 (p49/p100), the PSD gene for a pleckstrin
            and Sec7 domain protein, four novel genes, a novel gene
            (FLJ22529) the ACTR1A gene for ARP1 actin-related protein
            1 homolog A, centractin alpha (yeast), the 5' end of the
            SUFU gene for suppressor of fused homolog (Drosophila)
            and eight CpG islands, complete sequence.
          Length = 315

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG G+LS R            L A+  GCP L+ LSL +   +    L  +A  C  LE+
Sbjct: 122  GGCGQLSRRA-----------LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEE 170

Query: 1108 LDLCQCPGITDKSLMAIAK 1164
            LDL  C  + D++++ +A+
Sbjct: 171  LDLTACRQLKDEAIVYLAQ 189



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 101  LSDEDLVPVLARNPQLRSVALGGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 160

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 161  LADRCPAL 168



>gb:CR380959_1654044 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 1125

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 22/71 (30%), Positives = 37/71 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  +  + +  P LR + L   S I+D  LF +++    L+ +    C  ITD+ + A
Sbjct: 598  ITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTLGKNLQTVHFGHCFNITDRGVRA 657

Query: 1156 IAKSCPNLASV 1188
            + KSCP +  V
Sbjct: 658  LIKSCPRIQYV 668



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +1

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            + DE L+    GC  LE+L L  C  IT   + A+ K C  L SV
Sbjct: 414  LHDEELYNFV-GCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSV 457



>pir|G96837|G96837 unknown protein T21F11.10 [imported] - Arabidopsis
            thaliana>gb:AE005173_895569 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC018849_1538420 Arabidopsis thaliana
            chromosome 1 BAC T21F11 genomic sequence, complete
            sequence.>gb:BT002966_1636549 Arabidopsis thaliana clone
            RAFL14-85-E11 (R20418) putative F-box family protein,
            AtFBL14 (At1g80570) mRNA, complete
            cds.>gb:BT004407_1637479 Arabidopsis thaliana clone
            U20418 putative F-box family protein, AtFBL14 (At1g80570)
            mRNA, complete cds.
          Length = 467

 Score = 41.6 bits (96), Expect = 0.032
 Identities = 21/60 (35%), Positives = 31/60 (51%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            C SL  LSL N       GL  +   C  LEKL L  C G++D  ++A+ +   +L S++
Sbjct: 234  CDSLVELSLGNCIIAPGRGLACVLRNCKNLEKLHLDMCTGVSDSDIIALVQKASHLRSIS 293



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +1

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            + D+GL  + + CH L  L L  C  ITD  +  ++ SCP L+S+
Sbjct: 84   VDDQGLLVLTTNCHSLTDLTLSFCTFITDVGIGHLS-SCPELSSL 127



>gb:BC031285_1980114 Homo sapiens F-box and leucine-rich repeat
            protein 13, mRNA (cDNA clone MGC:39815 IMAGE:5298780),
            complete cds.
          Length = 707

 Score = 41.2 bits (95), Expect = 0.042
 Identities = 56/253 (22%), Positives = 106/253 (41%), Gaps = 18/253 (7%)
 Frame = +1

Query: 487  FPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRW 666
            FP R  S +          VDE  +  I +LP+  + +IF  L +  ++   C  V+  W
Sbjct: 136  FPERSSSEVFL--------VDETLKCDISLLPERAILQIFFYLSL--KDVIICGQVNHAW 185

Query: 667  LML--------------LSTICRDE--LSTIKSGEASEPEEGDNATAMQPELIKSDKKDG 798
            +++              +  +  D+  +ST++    +          ++P+  +S     
Sbjct: 186  MLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS----- 240

Query: 799  FVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGV 978
                 VS  ++ +E +  +S C      TD  +  I+ G       G L +  +N+   +
Sbjct: 241  -----VSHCRNLQELN--VSDC---PTFTDESMRHISEGCP-----GVLCLNLSNTT--I 283

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLM 1152
            T+  ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  I+ +   
Sbjct: 284  TNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFR 343

Query: 1153 AIAKSCPNLASVT 1191
             IA SC  +  +T
Sbjct: 344  YIANSCTGIMHLT 356



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 565  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 624

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 625  LQIGCKQL 632



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 402  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 458

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D S+M +++ CPNL
Sbjct: 459  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNL 507



>gb:AK097537_1914904 Homo sapiens cDNA FLJ40218 fis, clone
            TESTI2021599.
          Length = 735

 Score = 41.2 bits (95), Expect = 0.042
 Identities = 56/253 (22%), Positives = 106/253 (41%), Gaps = 18/253 (7%)
 Frame = +1

Query: 487  FPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRW 666
            FP R  S +          VDE  +  I +LP+  + +IF  L +  ++   C  V+  W
Sbjct: 136  FPERSSSEVFL--------VDETLKCDISLLPERAILQIFFYLSL--KDVIICGQVNHAW 185

Query: 667  LML--------------LSTICRDE--LSTIKSGEASEPEEGDNATAMQPELIKSDKKDG 798
            +++              +  +  D+  +ST++    +          ++P+  +S     
Sbjct: 186  MLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS----- 240

Query: 799  FVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGV 978
                 VS  ++ +E +  +S C      TD  +  I+ G       G L +  +N+   +
Sbjct: 241  -----VSHCRNLQELN--VSDC---PTFTDESMRHISEGCP-----GVLCLNLSNTT--I 283

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLM 1152
            T+  ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  I+ +   
Sbjct: 284  TNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFR 343

Query: 1153 AIAKSCPNLASVT 1191
             IA SC  +  +T
Sbjct: 344  YIANSCTGIMHLT 356



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 593  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 652

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 653  LQIGCKQL 660



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S +SD  +  +A  C  L  L +  CP ITD ++  
Sbjct: 567  ITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEM 626

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 627  LSAKC 631



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 402  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 458

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D S+M +++ CPNL
Sbjct: 459  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNL 507



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 542  ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 600

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 601  LAIYCINLTSLS 612



>gb:OSJN00271_1697717 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0002J11, complete
            sequence.>gb:OSJN00283_1697935 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBb0116K07, complete
            sequence.
          Length = 522

 Score = 41.2 bits (95), Expect = 0.042
 Identities = 25/94 (26%), Positives = 38/94 (40%), Gaps = 27/94 (28%)
 Frame = +1

Query: 979  TDSGLKAIGRGCPSLRALSL--WNISSISDEGLFEIASG--------------------- 1089
            TD+G+ ++   C  LR L +  W  + I D GL  +A G                     
Sbjct: 303  TDAGIISVAEKCHKLRKLHIDGWRTNRIGDHGLMAVARGCPDLQELVLIGVNPTVQSLRM 362

Query: 1090 ----CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
                C  LE+L LC C  + D  ++ +A+ C  L
Sbjct: 363  LGEHCRSLERLALCGCETVGDPEIICLAERCAAL 396



 Score = 40.0 bits (92), Expect = 0.093
 Identities = 26/95 (27%), Positives = 46/95 (48%), Gaps = 4/95 (4%)
 Frame = +1

Query: 919  ARRGGLGKLSIR--GNNSFRGVTDSGLKAIGRGCPSLRA--LSLWNISSISDEGLFEIAS 1086
            AR   + KL++R    +    ++D G + +    PS R   L L  +  +SD+GL  +A 
Sbjct: 95   ARFTAVSKLALRCARGSGTDSLSDDGARQVAAALPSARLARLKLRGLRQLSDDGLASLAG 154

Query: 1087 GCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
                + KL +  C     K+ +A+ +SCP L  ++
Sbjct: 155  ATPVIRKLSVASC-SFGPKAFVAVLRSCPLLEDLS 188



>gb:ATT6G21_1556302 Arabidopsis thaliana DNA chromosome 5, BAC clone
            T6G21 (ESSA project).>gb:BT015833_1642451 Arabidopsis
            thaliana At5g21900 gene, complete
            cds.>gb:BT020184_1642579 Arabidopsis thaliana At5g21900
            mRNA, complete cds.>gb:AC140977_1744067 Arabidopsis
            thaliana chromosome 5 BAC F13M11 genomic sequence,
            complete sequence.
          Length = 544

 Score = 41.2 bits (95), Expect = 0.042
 Identities = 22/56 (39%), Positives = 32/56 (57%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            L  LSL N + ++DE ++ I   C +LE LD+     +TDKSL  I + C  L S+
Sbjct: 364  LTDLSLANCNEVTDECMWHIGRYCKKLEALDITDLDKLTDKSLEFITEGCRYLKSL 419



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            SLR L L  +  +  E  F +A  C  L+ LDL  C  + +  L  I + C +L S+
Sbjct: 441  SLRELCLNKVRDVGPETAFSLAKVCKMLQFLDLSWCRRLKEDDLRRILRCCSSLQSL 497



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            VTD  +  IGR C  L AL + ++  ++D+ L  I  GC  L+ L L
Sbjct: 375  VTDECMWHIGRYCKKLEALDITDLDKLTDKSLEFITEGCRYLKSLKL 421



>gb:AY359239_1948008 Homo sapiens F-box and leucine-rich repeat
            protein 13 transcript variant 2 (FBXL13) mRNA, complete
            cds.
          Length = 690

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 55/253 (21%), Positives = 106/253 (41%), Gaps = 18/253 (7%)
 Frame = +1

Query: 487  FPSRKRSRINAPFVFSGEKVDEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRW 666
            FP R  S +          VDE  +  I +LP+  + +IF  L +  ++   C  V+  W
Sbjct: 136  FPERSSSEVFL--------VDETLKCDISLLPERAILQIFFYLSL--KDVIICGQVNHAW 185

Query: 667  LML--------------LSTICRDE--LSTIKSGEASEPEEGDNATAMQPELIKSDKKDG 798
            +++              +  +  D+  +ST++    +          ++P+  +S     
Sbjct: 186  MLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQRWRLNVLRLNFRGCLLRPKTFRS----- 240

Query: 799  FVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGV 978
                 VS  ++ +E +  +S C      TD  +  I+ G       G L +  +N+   +
Sbjct: 241  -----VSHCRNLQELN--VSDC---PTFTDESMRHISEGCP-----GVLCLNLSNTT--I 283

Query: 979  TDSGLKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLM 1152
            T+  ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  ++ +   
Sbjct: 284  TNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQVSVQGFR 343

Query: 1153 AIAKSCPNLASVT 1191
             IA SC  +  +T
Sbjct: 344  YIANSCTGIMHLT 356



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 402  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 458

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D S+M +++ CPNL
Sbjct: 459  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNL 507



>gb:OSJN00275_1697800 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0042I07, complete sequence.
          Length = 440

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 13/82 (15%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPG---------- 1131
            ++GL+ + R C +L  L L  ++ + D+ +  ++  C  L+ + L   PG          
Sbjct: 212  ETGLRFLLRKCKALERLCLEYVNGVIDKDMIVLSQSCKNLKSISLWMIPGLYHEPDGIVF 271

Query: 1132 ---ITDKSLMAIAKSCPNLASV 1188
               +TD+SL A+  +CP L  V
Sbjct: 272  RTDLTDESLEALTNNCPLLQDV 293



>gb:OSJN00253_1697441 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0072D08, complete sequence.
          Length = 485

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 20/46 (43%), Positives = 26/46 (56%)
 Frame = +1

Query: 1003 GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            G   PSL  LSL  I + +DE + ++ SGC  L  L L QCP + D
Sbjct: 170  GVSMPSLEILSLKRIMATTDEAVQQLVSGCPNLADLTLEQCPSVAD 215



>gb:AY428737_1605824 Nicotiana tabacum coronatine-insensitive 1 (COI1)
            mRNA, partial cds.
          Length = 352

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            G+TD GL  +GR   ++R + L  +   SDEGL E + GC  L+KL++  C
Sbjct: 204  GLTDVGLSYVGRYSQNVRWMLLGYVGE-SDEGLLEFSKGCPSLQKLEVRGC 253



>gb:ATH303346_1552436 Arabidopsis thaliana partial mRNA for
            hypothetical protein (ORF1), clone G2F2.
          Length = 601

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK----LDLCQCPGITDK 1143
            VTDSG+ A+G+    +  LSL     +SD G+  + +    + K    LDL   PGI+D+
Sbjct: 419  VTDSGMLALGKSDVPITQLSLRGCRRVSDRGISYLLNNEGTISKTLSTLDLGHMPGISDR 478

Query: 1144 SLMAIAKSCPNLASVT 1191
            ++  I   C  L  ++
Sbjct: 479  AIHTITHCCKALTELS 494



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 11/107 (10%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGK-------LSIRGNNSFRGVTDSGLKAI----GRGCPS 1020
            +K T + LA   V  +    LGK       LS+RG    R V+D G+  +    G    +
Sbjct: 407  RKLTSLNLAGADVTDSGMLALGKSDVPITQLSLRG---CRRVSDRGISYLLNNEGTISKT 463

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            L  L L ++  ISD  +  I   C  L +L +  C  +TD S+ ++A
Sbjct: 464  LSTLDLGHMPGISDRAIHTITHCCKALTELSIRSCFHVTDSSIESLA 510



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 8/76 (10%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW--------NISSISDEGLFEIASGCHQLEKLDLCQCPG 1131
            +T +GL+A+G  C  L +LSL         +   I+D G+F ++  C  LE + L   P 
Sbjct: 259  LTYTGLQALGF-CQQLTSLSLVRTCYNRKISFKRINDMGIFLLSEACKGLESVRLGGFPK 317

Query: 1132 ITDKSLMAIAKSCPNL 1179
            ++D    ++  SC NL
Sbjct: 318  VSDAGFASLLHSCRNL 333



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 13/51 (25%), Positives = 24/51 (47%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            SF+ + D G+  +   C  L ++ L     +SD G   +   C  L+K ++
Sbjct: 288  SFKRINDMGIFLLSEACKGLESVRLGGFPKVSDAGFASLLHSCRNLKKFEV 338



>pir|E96598|E96598 protein F20N2.2 [imported] - Arabidopsis
            thaliana>gb:AE005173_893442 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC002328_1530232 Genomic sequence for
            Arabidopsis thaliana BAC F20N2 from chromosome I,
            complete sequence.>gb:AY102102_1577710 Arabidopsis
            thaliana At1g55590/F20N2_18 mRNA, complete
            cds.>gb:BT001062_1635317 Arabidopsis thaliana
            At1g55590/F20N2_18 mRNA, complete cds.
          Length = 607

 Score = 40.8 bits (94), Expect = 0.054
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK----LDLCQCPGITDK 1143
            VTDSG+ A+G+    +  LSL     +SD G+  + +    + K    LDL   PGI+D+
Sbjct: 425  VTDSGMLALGKSDVPITQLSLRGCRRVSDRGISYLLNNEGTISKTLSTLDLGHMPGISDR 484

Query: 1144 SLMAIAKSCPNLASVT 1191
            ++  I   C  L  ++
Sbjct: 485  AIHTITHCCKALTELS 500



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 32/107 (29%), Positives = 49/107 (45%), Gaps = 11/107 (10%)
 Frame = +1

Query: 874  KKATDVRLAAIAVGTARRGGLGK-------LSIRGNNSFRGVTDSGLKAI----GRGCPS 1020
            +K T + LA   V  +    LGK       LS+RG    R V+D G+  +    G    +
Sbjct: 413  RKLTSLNLAGADVTDSGMLALGKSDVPITQLSLRG---CRRVSDRGISYLLNNEGTISKT 469

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            L  L L ++  ISD  +  I   C  L +L +  C  +TD S+ ++A
Sbjct: 470  LSTLDLGHMPGISDRAIHTITHCCKALTELSIRSCFHVTDSSIESLA 516



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 8/76 (10%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW--------NISSISDEGLFEIASGCHQLEKLDLCQCPG 1131
            +T +GL+A+G  C  L +LSL         +   I+D G+F ++  C  LE + L   P 
Sbjct: 265  LTYTGLQALGF-CQQLTSLSLVRTCYNRKISFKRINDMGIFLLSEACKGLESVRLGGFPK 323

Query: 1132 ITDKSLMAIAKSCPNL 1179
            ++D    ++  SC NL
Sbjct: 324  VSDAGFASLLHSCRNL 339



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 13/51 (25%), Positives = 24/51 (47%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            SF+ + D G+  +   C  L ++ L     +SD G   +   C  L+K ++
Sbjct: 294  SFKRINDMGIFLLSEACKGLESVRLGGFPKVSDAGFASLLHSCRNLKKFEV 344



>gb:BC016499_2092332 Mus musculus F-box and leucine-rich repeat
            protein 15, mRNA (cDNA clone MGC:25449 IMAGE:4221584),
            complete cds.
          Length = 296

 Score = 40.4 bits (93), Expect = 0.071
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LR+LSL   +++ D  + E+A  C QLE LDL  C  +    +  +A+ CP L S+
Sbjct: 191  LRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPALRSL 246



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/58 (34%), Positives = 33/58 (56%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            L A+  GCP L+ LSL +   +    L  +A  C  LE+LDL  C  + D++++ +A+
Sbjct: 128  LGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCPALEELDLTACRQLKDEAIVYLAQ 185



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 20/68 (29%), Positives = 34/68 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  L  +    P LR+++L     +S   L  +A GC +L++L L  C  +   +L  
Sbjct: 97   LSDEDLVPVLARNPQLRSVALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRG 156

Query: 1156 IAKSCPNL 1179
            +A  CP L
Sbjct: 157  LADRCPAL 164



>gb:AC130602_1740771 Oryza sativa (japonica cultivar-group) chromosome
            5 clone B1122D01, complete sequence.
          Length = 597

 Score = 40.4 bits (93), Expect = 0.071
 Identities = 24/72 (33%), Positives = 41/72 (56%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            G++D+GL  IG+    ++ + L N+   +D+GL   A GC  L KL+L  C   ++++L 
Sbjct: 454  GLSDTGLGYIGQYSGIIQYMLLGNVGE-TDDGLIRFALGCENLRKLELRSC-CFSEQALA 511

Query: 1153 AIAKSCPNLASV 1188
               +S P+L  V
Sbjct: 512  RAIRSMPSLRYV 523



>gb:CRU303349_1673663 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5
            and ORF6 (partial).
          Length = 606

 Score = 40.4 bits (93), Expect = 0.071
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEI----ASGCHQLEKLDLCQCPGITDK 1143
            VTDSG+ A+G+    +  LSL     +SD G+  +     +    L  LDL   PG++D+
Sbjct: 424  VTDSGMLALGKSDVPITQLSLRGCKRVSDRGISHLLINEGTISKTLSTLDLGHMPGMSDR 483

Query: 1144 SLMAIAKSCPNLASVT 1191
            ++  I + C  L  ++
Sbjct: 484  AIHTITRYCKALTELS 499



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 13/51 (25%), Positives = 24/51 (47%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            SF+ + D G+  +   C  L ++ L     +SD G   +   C  L+K ++
Sbjct: 293  SFKRINDMGIFLLSEACKGLESVRLGGFQKVSDAGFASLLHSCRNLKKFEV 343



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 8/76 (10%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLW--------NISSISDEGLFEIASGCHQLEKLDLCQCPG 1131
            +T +GL+A+G  C  L +LSL         +   I+D G+F ++  C  LE + L     
Sbjct: 264  LTYTGLQALGY-CQQLTSLSLVRTCYNRKISFKRINDMGIFLLSEACKGLESVRLGGFQK 322

Query: 1132 ITDKSLMAIAKSCPNL 1179
            ++D    ++  SC NL
Sbjct: 323  VSDAGFASLLHSCRNL 338



>gb:CR382139_1672396 Debaryomyces hansenii chromosome G of strain
            CBS767 of Debaryomyces hansenii.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.071
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPG---ITDKS 1146
            + D  L  + + CP+L  L +     ISD G+++IA  C +L  ++  +      ITD S
Sbjct: 326  IDDGFLSMVAKKCPNLEVLDIRACELISDSGIYQIAKRCTKLTTVNFGRKNKGNLITDSS 385

Query: 1147 LMAIAKSCPNLASV 1188
            +  + ++ PNL +V
Sbjct: 386  ICILIRNNPNLKTV 399



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
 Frame = +1

Query: 1048 SSISDEGLFE-IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            S + D+G    +A  C  LE LD+  C  I+D  +  IAK C  L +V
Sbjct: 323  SKVIDDGFLSMVAKKCPNLEVLDIRACELISDSGIYQIAKRCTKLTTV 370



>gb:AY423549_1605476 Lycopersicon esculentum coronatine-insensitive 1
            (Coi1) gene, complete cds.>gb:AY423550_1605477
            Lycopersicon esculentum coronatine-insensitive 1 (Coi1)
            mRNA, complete cds.
          Length = 603

 Score = 40.4 bits (93), Expect = 0.071
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            G+TD GL  +G+  P++R + L  +   SD GL E + GC  L+KL++  C
Sbjct: 455  GLTDVGLSYVGQYSPNVRWMLLGYVGE-SDHGLLEFSKGCPSLQKLEVRGC 504



>gb:OSJN00216_1696884 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0076A22, complete sequence.
          Length = 303

 Score = 40.0 bits (92), Expect = 0.093
 Identities = 26/78 (33%), Positives = 39/78 (50%)
 Frame = +1

Query: 955  GNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            GN S   + + GL+ +    P L  L+L   S I+D GL    + C  L  L L   P I
Sbjct: 45   GNGS--QIDNQGLRVLSFSLPLLNDLTLSFCSEINDSGL-ACLTNCKMLMSLKLNSTPEI 101

Query: 1135 TDKSLMAIAKSCPNLASV 1188
            T + L+++A  C  L+S+
Sbjct: 102  TSRGLLSLAVGCKTLSSL 119



 Score = 38.9 bits (89), Expect = 0.21
 Identities = 21/57 (36%), Positives = 28/57 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            + DSGL  +   C  L +L L +   I+  GL  +A GC  L  L L  C GIT  +
Sbjct: 76   INDSGLACL-TNCKMLMSLKLNSTPEITSRGLLSLAVGCKTLSSLHLNNCKGITSST 131



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 13/77 (16%)
 Frame = +1

Query: 988  GLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCP------------- 1128
            GL+ +   C SL  LSL  +S + D  +  ++  C  L+ + L   P             
Sbjct: 224  GLRFLLGKCRSLEKLSLEYVSGLIDNDMIALSQTCKNLKSISLWLKPEHYNVGDDIIFRT 283

Query: 1129 GITDKSLMAIAKSCPNL 1179
            G TD+SL A+A +CP L
Sbjct: 284  GFTDESLKALALNCPFL 300



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 3/63 (4%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSIS---DEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            C  L+ L L +I +     + GL  +   C  LEKL L    G+ D  ++A++++C NL 
Sbjct: 203  CEGLKDLRLVHIVTEPKGPEIGLRFLLGKCRSLEKLSLEYVSGLIDNDMIALSQTCKNLK 262

Query: 1183 SVT 1191
            S++
Sbjct: 263  SIS 265



>gb:AK085980_1174634 Mus musculus 16 days neonate heart cDNA, RIKEN
            full-length enriched library, clone:D830037K07
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 230

 Score = 40.0 bits (92), Expect = 0.093
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  L  +   CP LR L L N + +++  L  +A+    L+ L +  C  ++   L+ 
Sbjct: 121  VTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDFCRNVSAAGLLR 180

Query: 1156 IAKSCPNL 1179
            +  +CPNL
Sbjct: 181  LRAACPNL 188



>gb:AK084845_1174342 Mus musculus 13 days embryo heart cDNA, RIKEN
            full-length enriched library, clone:D330050P14
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 221

 Score = 40.0 bits (92), Expect = 0.093
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  L  +   CP LR L L N + +++  L  +A+    L+ L +  C  ++   L+ 
Sbjct: 112  VTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDFCRNVSAAGLLR 171

Query: 1156 IAKSCPNL 1179
            +  +CPNL
Sbjct: 172  LRAACPNL 179



>gb:AK052175_1169918 Mus musculus 13 days embryo heart cDNA, RIKEN
            full-length enriched library, clone:D330003E11
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 236

 Score = 40.0 bits (92), Expect = 0.093
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            VTD  L  +   CP LR L L N + +++  L  +A+    L+ L +  C  ++   L+ 
Sbjct: 127  VTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDFCRNVSAAGLLR 186

Query: 1156 IAKSCPNL 1179
            +  +CPNL
Sbjct: 187  LRAACPNL 194



>gb:AE014134_1127557 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003608_1217664 Drosophila melanogaster
            chromosome 2L, section 17 of 83 of the complete sequence.
          Length = 319

 Score = 40.0 bits (92), Expect = 0.093
 Identities = 23/72 (31%), Positives = 38/72 (52%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L KL++    +   VTD  L  IG  C  L  +++   ++ISD G+  +   C +L  L 
Sbjct: 213  LNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLL 272

Query: 1114 LCQCPGITDKSL 1149
            + +CP +T+ SL
Sbjct: 273  IRRCPRVTELSL 284



>gb:BC084522_2563893 Xenopus tropicalis hypothetical LOC496536, mRNA
            (cDNA clone MGC:89812 IMAGE:7028351), complete cds.
          Length = 292

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 23/73 (31%), Positives = 38/73 (52%)
 Frame = +1

Query: 970  RGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            R + D  +  + +    L++LSL   ++ISD  + E A  C  LE LDL  C  + + S+
Sbjct: 170  RQLKDDTISYLVQKSTRLKSLSLAVNANISDIAVEETAKNCRDLEHLDLTGCLRVKNDSI 229

Query: 1150 MAIAKSCPNLASV 1188
              +A+ C  L S+
Sbjct: 230  RTLAEYCTKLKSL 242



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 20/77 (25%), Positives = 34/77 (44%)
 Frame = +1

Query: 961  NSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            NS   +T   L AI   CP L+ + L +   +    L  +   C  LE +DL  C  + D
Sbjct: 115  NSCGQLTRQSLVAISLSCPHLQNICLGHCEWVDCLSLRSLVDHCKCLEAIDLTACRQLKD 174

Query: 1141 KSLMAIAKSCPNLASVT 1191
             ++  + +    L S++
Sbjct: 175  DTISYLVQKSTRLKSLS 191



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +1

Query: 1054 ISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++D+ L  +    H L  ++L  C  +T +SL+AI+ SCP+L ++
Sbjct: 94   LTDKELLPVIGQNHHLIHINLNSCGQLTRQSLVAISLSCPHLQNI 138



>gb:BC020572_1977069 Homo sapiens F-box and leucine-rich repeat
            protein 13, mRNA (cDNA clone IMAGE:4412932), partial cds.
          Length = 569

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 2/80 (2%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPG 1131
            N S   +T+  ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  
Sbjct: 111  NLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQ 170

Query: 1132 ITDKSLMAIAKSCPNLASVT 1191
            I+ +    IA SC  +  +T
Sbjct: 171  ISVQGFRYIANSCTGIMHLT 190



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 427  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 486

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 487  LQIGCKQL 494



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S +SD  +  +A  C  L  L +  CP ITD ++  
Sbjct: 401  ITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEM 460

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 461  LSAKC 465



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 236  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 292

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D S+M +++ CPNL
Sbjct: 293  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNL 341



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 376  ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 434

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 435  LAIYCINLTSLS 446



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +1

Query: 1072 FEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
            F   S C  L++L++  CP  TD+S+  I++ CP +
Sbjct: 72   FRSVSHCRNLQELNVSDCPTFTDESMRHISEGCPGV 107



>gb:AP004159_1838375 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1175_B01.
          Length = 364

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 7/84 (8%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCP--- 1128
            N SF  +T   L  I R C  LR  + W + ++ DEGL  +A  C  L +L +       
Sbjct: 86   NFSFANLTAEELTPIIRNCVRLR--TFWVLDTVGDEGLRAVAETCSDLRELRVFPFDATE 143

Query: 1129 ----GITDKSLMAIAKSCPNLASV 1188
                 ++D  L AI++ C  L S+
Sbjct: 144  DSEGSVSDVGLQAISEGCRKLESI 167



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (1%)
 Frame = +1

Query: 844  DGFLSRCLDGKKATDVRLAAIAVGTARR--GGLGKLSIRGNNSFRGVTDSGLKAIGRGCP 1017
            DGF +  ++ KK T + ++ +    A    G  GKL    + +F G +D  L+++  GC 
Sbjct: 212  DGFGAIVMNCKKLTRLSVSGLLTDKAFAYIGKYGKLIKTLSVAFAGNSDMSLQSVFEGCT 271

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L+ L + + S  SD+GL    S  + +  L +  C  +T +    +A+  P+L
Sbjct: 272  RLQKLEVRD-SPFSDKGLLSGLSYFYNMRFLWMNSC-RLTMRGCRDVAQQMPDL 323



>gb:AP004159_1838374 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1175_B01.
          Length = 637

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 7/84 (8%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCP--- 1128
            N SF  +T   L  I R C  LR  + W + ++ DEGL  +A  C  L +L +       
Sbjct: 359  NFSFANLTAEELTPIIRNCVRLR--TFWVLDTVGDEGLRAVAETCSDLRELRVFPFDATE 416

Query: 1129 ----GITDKSLMAIAKSCPNLASV 1188
                 ++D  L AI++ C  L S+
Sbjct: 417  DSEGSVSDVGLQAISEGCRKLESI 440



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (1%)
 Frame = +1

Query: 844  DGFLSRCLDGKKATDVRLAAIAVGTARR--GGLGKLSIRGNNSFRGVTDSGLKAIGRGCP 1017
            DGF +  ++ KK T + ++ +    A    G  GKL    + +F G +D  L+++  GC 
Sbjct: 485  DGFGAIVMNCKKLTRLSVSGLLTDKAFAYIGKYGKLIKTLSVAFAGNSDMSLQSVFEGCT 544

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             L+ L + + S  SD+GL    S  + +  L +  C  +T +    +A+  P+L
Sbjct: 545  RLQKLEVRD-SPFSDKGLLSGLSYFYNMRFLWMNSC-RLTMRGCRDVAQQMPDL 596



>gb:AC084884_1733896 Oryza sativa chromosome 10 clone OSJNBa0031A07,
            complete sequence.
          Length = 299

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +1

Query: 1042 NISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            N +S +D GL  +  GC  LEKL L     I++K L+ IA  C NL S+
Sbjct: 136  NPTSFTDAGLLHLIEGCKGLEKLTLNWFLHISEKGLVGIANRCRNLQSL 184



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 48/202 (23%), Positives = 84/202 (41%), Gaps = 4/202 (1%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGG--QERSACAGVSKRWLMLLSTICRDELSTIKS--GEASEPEEG 744
            LPD+ L E+FRR+   G   +  +CA V +RW  +     R     +    G+A      
Sbjct: 12   LPDDLLAEVFRRVAAAGGKADLDSCALVCRRWRGVERASRRAARVPVDGPDGDAVVRCVA 71

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTAR 924
            D    +    +          S  +  +   +G    +  LD +    ++ + ++  T +
Sbjct: 72   DRFPGLADVFLDHGLYIAAGASAAAAERSRAQGWDNENPKLDEQH---MQCSTLSEDTQK 128

Query: 925  RGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE 1104
              G   ++     SF   TD+GL  +  GC  L  L+L     IS++GL  IA+ C  L+
Sbjct: 129  ENGSDGVN---PTSF---TDAGLLHLIEGCKGLEKLTLNWFLHISEKGLVGIANRCRNLQ 182

Query: 1105 KLDLCQCPGITDKSLMAIAKSC 1170
             L L     + +  L+ +A+ C
Sbjct: 183  SLAL-SGGYVQNHGLITLAEGC 203



>gb:AY484589_1608337 Musa acuminata clone MuH9, genomic sequence.
          Length = 313

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIA 1161
            DS L  +     ++R LSL+    IS+ GL  +++GC  L  + L +C  ITD  L  +A
Sbjct: 92   DSALLRLRDFGSNIRYLSLYCCFGISEHGLAHVSTGCPHLVSITLYRC-NITDIGLRILA 150

Query: 1162 KSCPNLASV 1188
            K C  L ++
Sbjct: 151  KHCKVLENI 159



 Score = 37.7 bits (86), Expect = 0.46
 Identities = 47/193 (24%), Positives = 79/193 (40%), Gaps = 7/193 (3%)
 Frame = +1

Query: 577  LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNAT 756
            LPD+CL  IF++L     +R+A      RWL + +   R    ++    + +P    N  
Sbjct: 12   LPDDCLLMIFQKLQ-NRADRNAFGLTCHRWLQIQNIAQR----SLALQFSYDPNIYRNYV 66

Query: 757  AMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAI--AVGTARRG 930
               P L+          S++S     E  D  L R  D    +++R  ++    G +  G
Sbjct: 67   IYLPRLLTRFPH----LSSISLAGCTELPDSALLRLRDF--GSNIRYLSLYCCFGISEHG 120

Query: 931  ----GLGKLSIRGNNSFR-GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH 1095
                  G   +     +R  +TD GL+ + + C  L  + L     ISD G+  ++S C 
Sbjct: 121  LAHVSTGCPHLVSITLYRCNITDIGLRILAKHCKVLENIDLSYCMQISDRGINALSSECT 180

Query: 1096 QLEKLDLCQCPGI 1134
            +L  L +  C  I
Sbjct: 181  KLHCLVISYCKAI 193



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            P L ++SL   + + D  L  +      +  L L  C GI++  L  ++  CP+L S+T
Sbjct: 77   PHLSSISLAGCTELPDSALLRLRDFGSNIRYLSLYCCFGISEHGLAHVSTGCPHLVSIT 135



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 26/67 (38%), Positives = 33/67 (49%), Gaps = 1/67 (1%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS-LRALSLWNISSISDEGLFEIASGCHQLE 1104
            GGL  L+I       GV   GL  IG G  + LR L+L     +SD+ +  IA GC  LE
Sbjct: 227  GGLEYLNISNPRICVGV--DGLAMIGAGSATKLRYLNLRMCRFVSDDSVIAIAQGCPLLE 284

Query: 1105 KLDLCQC 1125
            +  L  C
Sbjct: 285  EWSLSVC 291



>gb:AY168645_1586383 Oryza sativa (japonica cultivar-group) COI1 mRNA,
            complete cds.>gb:AP003279_1827121 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0529E05.
          Length = 595

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 23/69 (33%), Positives = 38/69 (55%)
 Frame = +1

Query: 973  GVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            G++D GL  IG+   +++ + L N+   SD GL   A GC  L+KL+L  C   ++++L 
Sbjct: 452  GLSDDGLSYIGQYSGNIQYMLLGNVGE-SDHGLIRFAVGCTNLQKLELRSC-CFSERALS 509

Query: 1153 AIAKSCPNL 1179
                  P+L
Sbjct: 510  LAVLQMPSL 518



>gb:AY070039_1566682 Arabidopsis thaliana unknown protein (At5g07670)
            mRNA, complete cds.>gb:AY096547_1576089 Arabidopsis
            thaliana unknown protein (At5g07670) mRNA, complete cds.
          Length = 476

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + + GLKA+  GC +LR L + N S +   GL  +A  C +L++L+L +C   +D  L+ 
Sbjct: 172  LVERGLKALAGGCSNLRKLVVTNTSEL---GLLNVAEECSRLQELELHKC---SDSVLLG 225

Query: 1156 I 1158
            I
Sbjct: 226  I 226



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 1048 SSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S +SD GL  +A GC +L KL+L  C G  D  +  I + C  L  +T
Sbjct: 247  SLVSDIGLMILAQGCKRLVKLELVGCEGGFD-GIKEIGECCQMLEELT 293



>gb:AB010070_1510876 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MBK20.
          Length = 445

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 22/61 (36%), Positives = 36/61 (59%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + + GLKA+  GC +LR L + N S +   GL  +A  C +L++L+L +C   +D  L+ 
Sbjct: 172  LVERGLKALAGGCSNLRKLVVTNTSEL---GLLNVAEECSRLQELELHKC---SDSVLLG 225

Query: 1156 I 1158
            I
Sbjct: 226  I 226



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 19/48 (39%), Positives = 26/48 (54%)
 Frame = +1

Query: 1048 SSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            S +SD GL  +A GC +L KL+L  C G  D  +  I + C  L  +T
Sbjct: 247  SLVSDIGLMILAQGCKRLVKLELVGCEGGFD-GIKEIGECCQMLEELT 293



>gb:AP004798_1845254 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0572D06.
          Length = 328

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 3/115 (2%)
 Frame = +1

Query: 844  DGFLSRCLDGKKATDVRLAAIAVGTARRG---GLGKLSIRGNNSFRGVTDSGLKAIGRGC 1014
            D  L R +D     D+     AV  AR       G +     +SF  VTD  L  I    
Sbjct: 60   DPTLWRRVDMSHQGDIMEVDEAVAMARAAVDRAAGTMEAFWADSF--VTDGLLLYISERA 117

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             SL++L L    ++S+EG+ E   G  +LE+LD+  C  +      ++ K+CP L
Sbjct: 118  SSLKSLQLSMCLNVSNEGMAEAMKGFPRLEELDITFC-SLYGDVCASVGKACPEL 171



>gb:AC121489_1740221 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1217B09, complete sequence.
          Length = 603

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISS-------ISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            V D GL+A  R C  L+ L +  +++       +S+ GL  IA GC  L +  L  C  +
Sbjct: 356  VRDEGLQATARTCKKLQVLHVLPLNALEDADELVSEVGLTAIAEGCRGL-RSTLYFCQSM 414

Query: 1135 TDKSLMAIAKSCPNL 1179
            T+ +++AI+++C +L
Sbjct: 415  TNAAVIAISQNCVDL 429



 Score = 37.4 bits (85), Expect = 0.60
 Identities = 31/86 (36%), Positives = 35/86 (40%), Gaps = 1/86 (1%)
 Frame = +1

Query: 871  GKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCP-SLRALSLWNI 1047
            G    D R  A AV  A    L  L ++       VTD  L  + R  P S R LSL   
Sbjct: 106  GWAGADFRPWAAAVAAAAFPALASLFLKRIT----VTDDDLDLVSRSLPASFRDLSLLLC 161

Query: 1048 SSISDEGLFEIASGCHQLEKLDLCQC 1125
               S  GL  IAS C  L  LD+  C
Sbjct: 162  DGFSSAGLASIASHCRGLRVLDVVDC 187



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 24/65 (36%), Positives = 35/65 (53%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +LS  G+     +TD   + IG+   SLR LS+   +  S+  L  I  GC +LEKL+
Sbjct: 464  LTRLSTSGH-----LTDRAFEYIGKYAKSLRTLSV-AFAGDSNLALQHILQGCSKLEKLE 517

Query: 1114 LCQCP 1128
            +  CP
Sbjct: 518  IRDCP 522



>gb:LES303342_1684552 Lycopersicon esculentum mRNA for hypothetical
            protein (ORF1), clone 21.>gb:LES303345_1684556
            Lycopersicon esculentum lateral suppressor gene, ORF1 and
            ORF2.
          Length = 607

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 19/77 (24%), Positives = 40/77 (51%), Gaps = 3/77 (3%)
 Frame = +1

Query: 946  SIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL--- 1116
            S+    +FR V + G+  +  GC  L ++ L   ++++D G   I + C +L+KL++   
Sbjct: 295  SMNYRTAFRRVNNMGMFLLSEGCGRLESVKLGGFANVTDAGFSTILNSCRKLKKLEVLNS 354

Query: 1117 CQCPGITDKSLMAIAKS 1167
            C    +   ++  +A+S
Sbjct: 355  CLLSDLAFHNMRGVARS 371



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 4/90 (4%)
 Frame = +1

Query: 883  TDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAI----GRGCPSLRALSLWNIS 1050
            TD  LA + +G     G+ +L IRG    + VTD G++ +    G+   +L  L +  + 
Sbjct: 433  TDKGLALLGMGNL---GITQLCIRG---CKRVTDKGIERLFCAEGKIGKTLSLLDVSRMP 486

Query: 1051 SISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
             I+D  +F IAS    L  L L  C  +TD
Sbjct: 487  GITDAAIFTIASAAKALTDLSLRYCFHVTD 516



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 4/76 (5%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK----LDLCQCPGITDK 1143
            +TD GL  +G G   +  L +     ++D+G+  +     ++ K    LD+ + PGITD 
Sbjct: 432  ITDKGLALLGMGNLGITQLCIRGCKRVTDKGIERLFCAEGKIGKTLSLLDVSRMPGITDA 491

Query: 1144 SLMAIAKSCPNLASVT 1191
            ++  IA +   L  ++
Sbjct: 492  AIFTIASAAKALTDLS 507



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 21/77 (27%), Positives = 33/77 (42%)
 Frame = +1

Query: 931  GLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKL 1110
            G G+L       F  VTD+G   I   C  L+ L + N   +SD     +      L +L
Sbjct: 316  GCGRLESVKLGGFANVTDAGFSTILNSCRKLKKLEVLNSCLLSDLAFHNMRGVARSLIEL 375

Query: 1111 DLCQCPGITDKSLMAIA 1161
             L  C  +T ++L  ++
Sbjct: 376  RLLSCRLLTSEALEGLS 392



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 29/109 (26%), Positives = 51/109 (46%), Gaps = 6/109 (5%)
 Frame = +1

Query: 847  GFLSRCLDG-KKATDVRLAAIAVGTARRGGLGK-LSIRGNNSFRGVTDSGLKAIGRGCPS 1020
            G    C+ G K+ TD  +  +       G +GK LS+   +   G+TD+ +  I     +
Sbjct: 446  GITQLCIRGCKRVTDKGIERLFCA---EGKIGKTLSLLDVSRMPGITDAAIFTIASAAKA 502

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQ----LEKLDLCQCPGITDKSLMA 1155
            L  LSL     ++D G+  +    +     L+KLDL +C G++   +M+
Sbjct: 503  LTDLSLRYCFHVTDAGVKMLLDRPNHKVSLLQKLDLYKCRGLSGDWIMS 551



>gb:CR382122_1655008 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1095

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 1/73 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC-PGITDKSLM 1152
            +TD+ +++I  GCP+L  L+L    S++D  +  +  G   LE+LD+  C   ++D SL+
Sbjct: 954  LTDNSIRSIVNGCPNLSHLNLSFCCSLTDVAIELLCVGGQNLEELDISFCGRAVSDISLL 1013

Query: 1153 AIAKSCPNLASVT 1191
             I+     L +++
Sbjct: 1014 NISMHLRKLQNIS 1026



>gb:AC007087_1535212 Arabidopsis thaliana chromosome 2 clone F14N22
            map mi551, complete sequence.>gb:AF305597_1784456
            Arabidopsis thaliana F-box containing protein ORE9 (ORE9)
            mRNA, complete cds.
          Length = 693

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 30/91 (32%), Positives = 43/91 (47%), Gaps = 2/91 (2%)
 Frame = +1

Query: 913  GTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIAS-G 1089
            G A  GGL  LSI+ +     +TD GL AIGRGC  L    +    +++ +GL  + S  
Sbjct: 342  GVALCGGLQSLSIKNSGD---LTDMGLVAIGRGCCKLTTFEIQGCENVTVDGLRTMVSLR 398

Query: 1090 CHQLEKLDLCQCPGI-TDKSLMAIAKSCPNL 1179
               L  + +  C  + T  SL AI   C  +
Sbjct: 399  SKTLTDVRISCCKNLDTAASLKAIEPICDRI 429



>gb:AK029566_1161558 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4921539K22
            product:hypothetical F-box domain containing protein,
            full insert sequence.
          Length = 745

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 19/68 (27%), Positives = 35/68 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  +K I   C  + +L++     I+D G+  +++ CH L  LD+  C  +TD+ +  
Sbjct: 599  LTDDIIKTIAIFCTRITSLNIAGCPKITDAGMEILSARCHYLHILDISGCIQLTDQIIQD 658

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 659  LQIGCKQL 666



 Score = 35.4 bits (80), Expect = 2.3
 Identities = 18/65 (27%), Positives = 34/65 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S ++D+ +  IA  C ++  L++  CP ITD  +  
Sbjct: 573  ITDFGIRAYCKTSLLLEHLDVSYCSQLTDDIIKTIAIFCTRITSLNIAGCPKITDAGMEI 632

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 633  LSARC 637



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 51/235 (21%), Positives = 92/235 (39%), Gaps = 28/235 (11%)
 Frame = +1

Query: 568  IEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDEL-STIKSGEASEPEEG 744
            I VLP++ + +IF  L    ++  AC+ V++ W+ ++    R  L ++I         + 
Sbjct: 195  ISVLPEQAILQIFLYLTF--KDMMACSRVNRSWMAMIQ---RGSLWNSIDFSTVKNIADK 249

Query: 745  DNATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRLAAIAVGTAR 924
               T +Q             +  ++ ++ N  G  F ++ L             AV   +
Sbjct: 250  CVVTTLQ-------------KWRLNVLRLNFRGCDFRTKTLK------------AVSHCK 284

Query: 925  RGGLGKLSIRGNNSFRGVTDSGLKAIGRGCP-------------------------SLRA 1029
               L +L++    SF   TD  ++ I  GCP                         +L+ 
Sbjct: 285  N--LQELNVSDCQSF---TDESMRHISEGCPGVLYLNLSNTTITNRTMRLLPKYFHNLQN 339

Query: 1030 LSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LSL      +D+GL    + +GCH+L  LDL  C  +       + + CP ++SV
Sbjct: 340  LSLAYCEKFTDKGLQYLNLGNGCHKLIYLDLSGCTQV-------LVEKCPRISSV 387



>pir|A85046|A85046 probable nodulin [imported] - Arabidopsis
            thaliana>gb:AC005142_1532204 Arabidopsis thaliana BAC
            T5L23 from chromosome IV, near 19 cM, complete
            sequence.>gb:ATCHRIV9_1547843 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 9.
          Length = 220

 Score = 38.9 bits (89), Expect = 0.21
 Identities = 35/93 (37%), Positives = 44/93 (47%), Gaps = 2/93 (2%)
 Frame = +1

Query: 853  LSRCL-DGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVT-DSGLKAIGRGCPSLR 1026
            LS CL  GK    +  A + + T       KL+ +G   F G T D     I +  P LR
Sbjct: 95   LSYCLIKGKNLEAIGFACLHLKTL------KLNCQGFK-FPGFTYDHDALGIAKRMPELR 147

Query: 1027 ALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
             L L+  + +SD GL  I  GC  LE LDL QC
Sbjct: 148  CLQLFG-NRVSDVGLNAIFDGCPHLEHLDLRQC 179



>gb:AC135205_1742015 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1012B02, complete sequence.
          Length = 589

 Score = 38.5 bits (88), Expect = 0.27
 Identities = 19/50 (38%), Positives = 32/50 (64%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            ++D GL  IG    ++R + L N+   SD+GL ++++GC  L+KL+L  C
Sbjct: 455  LSDVGLGYIGEFSKTIRYMLLGNVGE-SDQGLLQLSTGCPSLQKLELRGC 503



>gb:AC099399_1737109 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1006F06, complete sequence.
          Length = 622

 Score = 38.5 bits (88), Expect = 0.27
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 2/66 (3%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC--HQLEKLDLCQCPGITDKSL 1149
            ++D  LK +G G   L +LSL     ++++ +  + +G     L+ LDL + PGITD  +
Sbjct: 419  ISDQALKYLGLGTCPLASLSLRGCRKLTNDCIPLLFAGSVKQSLQVLDLSRIPGITDDGI 478

Query: 1150 MAIAKS 1167
            M +A+S
Sbjct: 479  MLLARS 484



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 20/59 (33%), Positives = 27/59 (45%)
 Frame = +1

Query: 964  SFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            SFR V D G+  +   C SL ++ L   S ++D G   I   C  L KL +      TD
Sbjct: 288  SFRRVNDLGILLMAEKCSSLESVCLGGFSRVTDTGFRAIIHSCSGLHKLRVSHGSQFTD 346



>pir|T48087|T48087 transport inhibitor response protein TIR1
            [imported] - Arabidopsis thaliana>gb:ATT20O10_1555086
            Arabidopsis thaliana DNA chromosome 3, BAC clone
            T20O10.>gb:BT001946_1635549 Arabidopsis thaliana clone
            C105370 putative transport inhibitor response TIR1,
            AtFBL1 protein (At3g62980) mRNA, complete
            cds.>gb:AF005047_1760767 Arabidopsis thaliana transport
            inhibitor response 1 (TIR1) gene, complete
            cds.>gb:AF005048_1760768 Arabidopsis thaliana transport
            inhibitor response 1 (TIR1) mRNA, complete cds.
          Length = 594

 Score = 38.5 bits (88), Expect = 0.27
 Identities = 21/76 (27%), Positives = 43/76 (56%), Gaps = 8/76 (10%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNIS--------SISDEGLFEIASGCHQLEKLDLCQCPG 1131
            + D+GL+ +   C  LR L ++           +++++GL  ++ GC +LE + L  C  
Sbjct: 325  IEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESV-LYFCRQ 383

Query: 1132 ITDKSLMAIAKSCPNL 1179
            +T+ +L+ IA++ PN+
Sbjct: 384  MTNAALITIARNRPNM 399



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD   + IG     +  LS+   +  SD G+  + SGC  L KL++  CP   DK+L+A
Sbjct: 443  LTDKVFEYIGTYAKKMEMLSV-AFAGDSDLGMHHVLSGCDSLRKLEIRDCP-FGDKALLA 500

Query: 1156 IAKSCPNLASV 1188
             A     + S+
Sbjct: 501  NASKLETMRSL 511



>gb:BC020575_1977070 Homo sapiens F-box and leucine-rich repeat
            protein 13, mRNA (cDNA clone IMAGE:4447876), partial cds.
          Length = 247

 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 105  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 164

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 165  LQIGCKQL 172



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S +SD  +  +A  C  L  L +  CP ITD ++  
Sbjct: 79   ITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEM 138

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 139  LSAKC 143



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 54   ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 112

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 113  LAIYCINLTSLS 124



>gb:AK095387_1914352 Homo sapiens cDNA FLJ38068 fis, clone
            CTONG2015358.
          Length = 456

 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 314  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 373

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 374  LQIGCKQL 381



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S +SD  +  +A  C  L  L +  CP ITD ++  
Sbjct: 288  ITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEM 347

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 348  LSAKC 352



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 263  ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 321

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 322  LAIYCINLTSLS 333



>gb:AE016817_1747445 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 392

 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LR L+L     +SD+ L E      +L+ LDL  C  ++D  ++A+A +CP L +V
Sbjct: 187  LRRLALPGNKLVSDDFLIEACVHLPRLQVLDLRACDRVSDAGVVAVATNCPRLHTV 242



>gb:HSM803079_1186896 Homo sapiens mRNA; cDNA DKFZp434L2422 (from
            clone DKFZp434L2422).
          Length = 448

 Score = 38.1 bits (87), Expect = 0.35
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            ++D  +KA+   C +L +LS+     I+D  +  +++ CH L  LD+  C  +TD+ L  
Sbjct: 306  LSDMIIKALAIYCINLTSLSIAGCPKITDSAMEMLSAKCHYLHILDISGCVLLTDQILED 365

Query: 1156 IAKSCPNL 1179
            +   C  L
Sbjct: 366  LQIGCKQL 373



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLMAIAK 1164
            ++ + R   +L+ LSL      +D+GL    + +GCH+L  LDL  C  I+ +    IA 
Sbjct: 1    MRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIAN 60

Query: 1165 SCPNLASVT 1191
            SC  +  +T
Sbjct: 61   SCTGIMHLT 69



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD G++A  +    L  L +   S +SD  +  +A  C  L  L +  CP ITD ++  
Sbjct: 280  ITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKALAIYCINLTSLSIAGCPKITDSAMEM 339

Query: 1156 IAKSC 1170
            ++  C
Sbjct: 340  LSAKC 344



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 255  ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 313

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 314  LAIYCINLTSLS 325



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 115  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 171

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D  +M +++ CPNL
Sbjct: 172  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDAFVMKLSERCPNL 220



>sp|P24814|GRR1_YEAST Ubiquitin ligase complex F-box protein
            GRR1.>pir|A41529|A41529 GRR1 protein - yeast
            (Saccharomyces cerevisiae)>gb:SCYJR090C_1712885
            S.cerevisiae chromosome X reading frame ORF
            YJR090c.>gb:YSCGRR1_1728980 Saccharomyces cerevisiae GRR1
            gene, complete cds.>gb:YSCORFSAA_1730095 Saccharomyces
            cerevisiae ORF genes, complete cds.
          Length = 1151

 Score = 38.1 bits (87), Expect = 0.35
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  +++I    P LR + L   S I+D  LF+++     L+ +    C  ITD  + A
Sbjct: 586  ITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRA 645

Query: 1156 IAKSCPNLASV 1188
            +  SC  +  V
Sbjct: 646  LFHSCTRIQYV 656



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            PSLR + L    +I+D+ +  I +   +L  + L +C  ITD SL  ++K   NL +V
Sbjct: 573  PSLRLIDLSGCENITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLSKLGKNLQTV 630



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 3/74 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISD---EGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            VTDS L  +      LR   + + ++I+D   + L ++      L  +DL  C  ITDK+
Sbjct: 531  VTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKT 590

Query: 1147 LMAIAKSCPNLASV 1188
            + +I    P L +V
Sbjct: 591  IESIVNLAPKLRNV 604



>gb:AP004586_1841932 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0493A04.
          Length = 901

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            +T S +K I   CP L +L L N++ + D  +  + +GC  ++K+ L
Sbjct: 741  LTSSSIKTIAGNCPQLSSLDLRNLNRLRDSAMRHLRNGCRLIKKIKL 787



>gb:CR382132_1665004 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 964

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 19/56 (33%), Positives = 31/56 (55%)
 Frame = +1

Query: 1021 LRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LR L L + + +SD+ +  I      LE LDL  C  ++D S+  ++  CP+L S+
Sbjct: 833  LRELVLADCTFLSDKAIISIVGAAKNLEFLDLSFCCALSDVSVEVLSLGCPSLKSL 888



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSL-WNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            ++D  ++ +  GCPSL++L+L +  S++SD  L  +A     LE L +  C  +T   + 
Sbjct: 870  LSDVSVEVLSLGCPSLKSLNLSFCGSAVSDANLRAVAMHLLDLEHLSVRGCVRVTAVGVD 929

Query: 1153 AIAKSCPNLASV 1188
             I   C  L ++
Sbjct: 930  TILAGCLKLKTL 941



>gb:CR382122_1655229 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 424

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 51/212 (24%), Positives = 90/212 (42%), Gaps = 6/212 (2%)
 Frame = +1

Query: 547  DEKKQASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEA 726
            D+ K   I  +P E L  IF  L      R  C+ V+  W  + S+I   +L   +S  +
Sbjct: 98   DDSKSNPIFHIP-ELLHRIFNFLDHESLYR--CSKVNPVWAAVASSIINKDLVIQQSSIS 154

Query: 727  SEPEEGDNATAMQPELI---KSDKKDGFVQSNVSEVQDNEEGDGFLSRCLDGKKATDVRL 897
             + +  +    + P+ +   K  +   F+++ +  ++         +R           L
Sbjct: 155  GDLKIVELDQKVHPKSLTFYKLKQHRNFIENQLPRIR--------FTRLNSLNFYISPVL 206

Query: 898  AAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFE 1077
             AI         L KL+I GN     + D  L ++  G P+L  L L   S ISD  +  
Sbjct: 207  PAIFDDVTISNNLTKLTIAGNKK---INDEELISLILGLPNLIDLDLRACSQISDISIVS 263

Query: 1078 IASGCHQLEKLDLCQCPG---ITDKSLMAIAK 1164
            I + C +L+ ++L +      ITD S+MA+++
Sbjct: 264  IVTHCPKLQSINLGRHENSHLITDLSIMALSE 295



 Score = 37.0 bits (84), Expect = 0.79
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            +L  L++     I+DE L  +  G   L  LDL  C  I+D S+++I   CP L S+
Sbjct: 218  NLTKLTIAGNKKINDEELISLILGLPNLIDLDLRACSQISDISIVSIVTHCPKLQSI 274



>gb:AB025621_1516430 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFG13.>gb:BT020276_1642671 Arabidopsis thaliana
            At5g51380 mRNA, complete cds.>gb:BT020447_1642841
            Arabidopsis thaliana At5g51380 mRNA, complete cds.
          Length = 479

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 6/77 (7%)
 Frame = +1

Query: 979  TDSGLKAIGRGCPSLRALSLWNI------SSISDEGLFEIASGCHQLEKLDLCQCPGITD 1140
            +D+ L+ I   C +LR L L         SS+SD GL  +A GC +L KL+L  C G  D
Sbjct: 221  SDNLLRGIA-ACENLRGLRLVGSVDGLYSSSVSDIGLTILAQGCKRLVKLELSGCEGSFD 279

Query: 1141 KSLMAIAKSCPNLASVT 1191
              + AI + C  L  ++
Sbjct: 280  -GIKAIGQCCEVLEELS 295



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 24/68 (35%), Positives = 37/68 (54%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            + D GL+ +GRG   L  L + N + +   GL  +A  C  L++L+L +C   +D  L  
Sbjct: 174  MVDKGLRVLGRGSFDLIKLVVINATEL---GLLSLAEDCSDLQELELHKC---SDNLLRG 227

Query: 1156 IAKSCPNL 1179
            IA +C NL
Sbjct: 228  IA-ACENL 234



>gb:AE017329_444476 Listeria monocytogenes str. 4b F2365, section 8 of
            10 of the complete genome.>gb:AE017262_1076832 Listeria
            monocytogenes str. 4b F2365, complete genome.
          Length = 664

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 23/87 (26%), Positives = 43/87 (49%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            GG   L     + F   + + ++ +  GC SL AL + N ++ S   +  + +GC+ LE+
Sbjct: 316  GGCNSLEALDVSHFDTSSVTTMETMFAGCNSLEALDVSNFNTSSVTNMKTMFNGCNSLEE 375

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNLASV 1188
            LDL      +  ++ ++ K C  L S+
Sbjct: 376  LDLSNFDTSSVTTMASMFKDCTALKSL 402



>pir|B85069|B85069 hypothetical protein AT4g05500 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV15_1544394 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            15.>gb:T1J24_1723615 Arabidopsis thaliana BAC T1J24.
          Length = 449

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 21/48 (43%), Positives = 26/48 (54%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQC 1125
            D   KAI    P LR L L   + ++++GL  I  GC  LE LDL QC
Sbjct: 349  DDNAKAIAESMPELRHLQLLG-NGLTNKGLNAILDGCPHLEHLDLRQC 395



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 6/69 (8%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSIS------DEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            L+ IGR CP+L+ L L     I       D+    IA    +L  L L    G+T+K L 
Sbjct: 320  LRDIGRSCPNLKTLKLNRAPEIMFSNSGFDDNAKAIAESMPELRHLQLLG-NGLTNKGLN 378

Query: 1153 AIAKSCPNL 1179
            AI   CP+L
Sbjct: 379  AILDGCPHL 387



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            +L++L L     I+DEG+ +  S    LE L++  C   + +SL  I +SCPNL ++
Sbjct: 278  NLKSLGLVRCFPITDEGVAKAVSKVPLLEYLEVSYCL-FSGESLRDIGRSCPNLKTL 333



>pir|H86453|H86453 avr9 homolog F9L11.10 [imported] - Arabidopsis
           thaliana>gb:AE005172_892124 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006424_1534184 Arabidopsis thaliana
           chromosome I BAC F9L11 genomic sequence, complete
           sequence.>gb:BT006435_1639322 Arabidopsis thaliana
           At1g32930 gene, complete cds.
          Length = 399

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 11/82 (13%)
 Frame = +1

Query: 619 VGGQERSACAGVSKRWL-------MLLSTICRDEL----STIKSGEASEPEEGDNATAMQ 765
           +G  ++SA +GVS RW+        LL  +  + L     T+   E + PE+ D + ++ 
Sbjct: 3   MGRYQKSATSGVSARWVFVLCISSFLLGVLVVNRLLASFETVDGIERASPEQNDQSRSLN 62

Query: 766 PELIKSDKKDGFVQSNVSEVQD 831
           P L+  + K+G + S VS   D
Sbjct: 63  P-LVDCESKEGDILSRVSHTHD 83



>sp|O13695|YEN1_SCHPO Hypothetical serine-rich protein C11G7.01 in
           chromosome I.>pir|T37544|T37544 hypothetical serine-rich
           protein - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC11G7_1716360 S.pombe chromosome I cosmid
           c11G7.
          Length = 536

 Score = 37.7 bits (86), Expect = 0.46
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -3

Query: 794 SFLSDLMSSGCIAVALSPSSGSEASPLLMVESSSLQIVLKSISHRLETPAQALLSCPPTG 615
           SF++ L+SS     + S +S + +S   +  SSS      S SH L + + +L++   + 
Sbjct: 78  SFITSLVSSSSQQSSSSSASLTSSSSATLTSSSSASPTSSSSSHALSSSSSSLVASSSSS 137

Query: 614 RRLKISKRHSSGRTSIEACFFSS--TFSPLNTKGALMRDLLREG 489
                S  HSS   S  + + SS  T S L++  +++    R+G
Sbjct: 138 GMSSSSLSHSSSVPSSSSSYHSSSMTTSGLSSSASIVSSTYRDG 181



>gb:AC145780_1744491 Oryza sativa chromosome 3 BAC OSJNBb0069P02
            genomic sequence, complete sequence.
          Length = 629

 Score = 37.4 bits (85), Expect = 0.60
 Identities = 41/141 (29%), Positives = 60/141 (42%), Gaps = 18/141 (12%)
 Frame = +1

Query: 811  NVSEV------QDNEEGDGFLSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFR 972
            N+SE+      Q N+  D  L   +DG   T   L  + + +A+       ++ G  S R
Sbjct: 311  NMSEISLCFTQQSNDCTD--LVTLMDGLGRTCPNLKNMHISSAQLSNEAVFALEGA-SLR 367

Query: 973  G-----------VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGC-HQLEKLDL 1116
            G           +TD+ + +I R C SL  L L + SSISD G+  I     H L +L L
Sbjct: 368  GLCMLSLILGSKITDAAVASIVRSCASLELLDL-SGSSISDNGVGMICKAFPHTLSRLLL 426

Query: 1117 CQCPGITDKSLMAIAKSCPNL 1179
              CP +T   +       P L
Sbjct: 427  ALCPNVTTCGIQFATAQLPLL 447



>gb:AY069367_1294097 Drosophila melanogaster LD07444 full length cDNA.
          Length = 319

 Score = 37.4 bits (85), Expect = 0.60
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L KL++    +   VT   L  IG  C  L  +++   ++ISD G+  +   C +L  L 
Sbjct: 213  LNKLTVLSLANTPSVTHQVLIQIGNYCRELEHINVIGCAAISDYGVHALTVHCLRLRTLL 272

Query: 1114 LCQCPGITDKSL 1149
            + +CP +T+ SL
Sbjct: 273  IRRCPRVTELSL 284



>gb:BX908798_831011 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1866

 Score = 37.4 bits (85), Expect = 0.60
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 6/110 (5%)
 Frame = +1

Query: 856  SRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS---LR 1026
            S  L+GK+ +D  + AIA   A    L  LS+ G    + ++D G++A  +   S   L 
Sbjct: 1682 SLSLNGKQISDKGMEAIAQALASNTTLKSLSLNG----KQISDKGMEAFAQTLASNTTLE 1737

Query: 1027 ALSLWNISSISDEGLFEIA---SGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
            +L L N + ISD+G+   A   +    LE LDL +   I DK + AIA++
Sbjct: 1738 SLDLRN-NQISDKGMQAFAQTLASNTTLESLDL-RNNQINDKGMEAIAQA 1785



>gb:AP005295_1850048 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1695_D07.
          Length = 281

 Score = 37.0 bits (84), Expect = 0.79
 Identities = 20/60 (33%), Positives = 35/60 (58%)
 Frame = +1

Query: 1012 CPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            C +++ L L +I +  + GL  +   C  LEKL L    G+TD  ++A+ ++C NL S++
Sbjct: 36   CENMKELRLAHIVTKPEIGLRFLLGKCRALEKLWLEYVIGLTDNDVIALFQNCGNLRSLS 95



>gb:OSJN00275_1697802 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0042I07, complete sequence.
          Length = 482

 Score = 37.0 bits (84), Expect = 0.79
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 11/75 (14%)
 Frame = +1

Query: 988  GLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCP-----------GI 1134
            GL+ + R C +L  L L  +  + D+ +  ++  C  L+ + L   P           G 
Sbjct: 257  GLRFLLRKCKALEKLCLEYVGGLIDKDMIVLSQSCKNLKSISLWMMPRRFHEHEVLRMGF 316

Query: 1135 TDKSLMAIAKSCPNL 1179
            TD+SL  +A +CP L
Sbjct: 317  TDESLEMLAHNCPLL 331



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 18/53 (33%), Positives = 28/53 (52%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            + D+G+ ++   C  L +L L +I  ++  GL  +A GC  L  L L  C GI
Sbjct: 108  INDAGIASLTY-CKKLMSLKLNSIPDVTSSGLLLVAFGCKALSSLYLNDCKGI 159



>gb:CR382131_1663636 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 717

 Score = 37.0 bits (84), Expect = 0.79
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +1

Query: 910  VGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASG 1089
            +G    G L K+ + G      V D+ LK +   CP L+   L     +S+EGL  +A  
Sbjct: 451  LGLLAGGSLQKIVLPGCTK---VDDAFLKLVAENCPRLQIADLRACEKVSNEGLVALAGK 507

Query: 1090 CHQLEKLDL 1116
            C QL+ L++
Sbjct: 508  CPQLKLLNV 516



>gb:AB025621_1516429 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MFG13.>gb:BT020245_1642640 Arabidopsis thaliana
            At5g51370 gene, complete cds.
          Length = 446

 Score = 37.0 bits (84), Expect = 0.79
 Identities = 33/98 (33%), Positives = 45/98 (45%), Gaps = 12/98 (12%)
 Frame = +1

Query: 934  LGKLSIRGNNS------FRGVTDSGLKAIGRGCPSLRALSLWNI------SSISDEGLFE 1077
            LG LS+ G+ S           D+ L  I   C +L+ L L         SS+SD GL  
Sbjct: 164  LGLLSLAGDCSDLQELELHKCNDNLLHGIA-ACKNLKGLRLVGSVDGLYSSSVSDIGLTF 222

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            +A GC  L KL+L  C G  D  + AI + C  L  ++
Sbjct: 223  LAQGCRSLVKLELSGCEGSFD-GIKAIGQCCEVLEELS 259



>sp|O74783|POF2_SCHPO F-box/LRR-repeat protein 2 (F-box and
            leucine-rich repeat protein 2) (F-box protein
            pof2).>pir|T39987|T39987 probable regulatory protein -
            fission yeast  (Schizosaccharomyces
            pombe)>gb:AB062778_1522164 Schizosaccharomyces pombe gene
            for Pof2 F-box protein, complete cds.>gb:SPBC25B2_1719638
            S.pombe chromosome II cosmid c25B2.
          Length = 463

 Score = 37.0 bits (84), Expect = 0.79
 Identities = 19/57 (33%), Positives = 33/57 (57%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++RALSL N+  + D  +  I     +L  L L +C G+TD SL+++ K   +L ++
Sbjct: 252  AMRALSLNNLPDLKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQSLTTL 308



>gb:OSJN00053_1693973 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0081L15, complete
            sequence.>gb:OSJN00125_1695295 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OJ000223_09, complete sequence.
          Length = 453

 Score = 36.6 bits (83), Expect = 1.0
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCP-SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            ++D+GL  + + CP +L+ LS+    +I+D+GL  +     +L KL +  CP +T   L+
Sbjct: 250  ISDAGLLHLTQKCPDTLQCLSIACCVNITDQGLKAVLESNPRLTKLSILGCPRLTLDGLI 309

Query: 1153 AIAKS 1167
            +  KS
Sbjct: 310  SNLKS 314



>gb:CR382134_1667128 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 630

 Score = 36.6 bits (83), Expect = 1.0
 Identities = 18/59 (30%), Positives = 29/59 (49%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            P L+ L  W+ S++  + L +IAS C  LE L L  C    + +L   +    NL  ++
Sbjct: 253  PGLKVLDFWDCSNVDSDSLNKIASYCPNLESLTLFMCGYFHNDNLKYYSSHLQNLTELS 311



>gb:BC084456_2563830 Xenopus tropicalis hypothetical LOC496483, mRNA
            (cDNA clone MGC:89244 IMAGE:7018161), complete cds.
          Length = 660

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKA--IGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +TD GL+   IG G P+L  L+L    +++  GL ++ S C  L       C  I+    
Sbjct: 580  ITDHGLRVLTIGGGLPNLEHLNLSGCLNVTGSGLQDLVSACPSLNDEHFYYCDNISGPH- 638

Query: 1150 MAIAKSCPNL 1179
             A A  C NL
Sbjct: 639  AATASGCQNL 648



>gb:AC005250_1874894 Homo sapiens BAC clone CTA-318M5 from 7, complete
            sequence.
          Length = 325

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 27/109 (24%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCP----------------SLRALS---------L 1038
            L K+   GN   + VTD+  K I +  P                SLR+LS         L
Sbjct: 109  LRKIRFEGN---KRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNL 165

Query: 1039 WNISSISDEGLFEIASG--CHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             N   I D GL +   G    ++ +L+L  C  ++D S+M +++ CPNL
Sbjct: 166  ANCVRIGDMGLKQFLDGPASMRIRELNLSNCVRLSDASVMKLSERCPNL 214



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGL--FEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASVT 1191
            +L+ LSL      +D+GL    + +GCH+L  LDL  C  I+ +    IA SC  +  +T
Sbjct: 4    NLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLT 63



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/72 (29%), Positives = 37/72 (51%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +++ GL  + R    L+ LS+     I+D+G+         LE LD+  C  ++D  + A
Sbjct: 249  ISNEGLNVLSRH-KKLKELSVSECYRITDDGIQAFCKSSLILEHLDVSYCSQLSDMIIKA 307

Query: 1156 IAKSCPNLASVT 1191
            +A  C NL S++
Sbjct: 308  LAIYCINLTSLS 319



>gb:AP005295_1850049 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1695_D07.
          Length = 207

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 25/83 (30%), Positives = 40/83 (48%)
 Frame = +1

Query: 937  GKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDL 1116
            G +SI G      + + GL  +   C SL  L+L   S I D G+  +A  C +L    L
Sbjct: 75   GWISIHGKQ----LDNQGLLVLSSHCSSLTDLTLNFCSYIDDSGIGYLAY-CKKLRSFRL 129

Query: 1117 CQCPGITDKSLMAIAKSCPNLAS 1185
               P I+ + L+++A  C +L +
Sbjct: 130  NFAPAISSRGLLSVAVGCKSLCT 152



>gb:AP004746_1844284 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0035F08.>gb:AP005499_1852909 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0412D08.
          Length = 346

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 925  RGGLGKLSIRGN----NSFRGV---TDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIA 1083
            RGGL   ++R +     +F G     D  L  +      L++L L +   +S+EG+ E  
Sbjct: 86   RGGLACAAVRRSAGQCEAFCGEYAGDDGFLVYLTEQASCLKSLRLISCLGVSNEGIEEAT 145

Query: 1084 SGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
                 LE+L+L  C  +T ++  AI  +CP L
Sbjct: 146  KEFPLLEELELSFCYNVTHEAYAAIGAACPQL 177



>gb:AP004560_1841592 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0462E11.
          Length = 249

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 22/40 (55%), Positives = 24/40 (60%)
 Frame = +1

Query: 586 ECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTICRDELS 705
           ECLFEI RRLP GG ER A   VS  W ++      DELS
Sbjct: 209 ECLFEILRRLP-GGCERGASTCVSHSWFVMED----DELS 243



>gb:AF536527_1809667 Glycine max putative coronatine-insensitive 1
            (COI1) gene, partial cds.
          Length = 237

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 26/92 (28%)
 Frame = +1

Query: 982  DSGLKAIGRGCPSLRALSLW----NISSI----------------------SDEGLFEIA 1083
            D+G++A+ RGC  LR  +L+     ++ +                      SD GL E A
Sbjct: 66   DNGVRALLRGCDKLRRFALYLRRGGLTDVGLGYIGQYSPNVRWMLLGYVGESDAGLLEFA 125

Query: 1084 SGCHQLEKLDLCQCPGITDKSLMAIAKSCPNL 1179
             GC  L+KL++  C   ++++L   A    +L
Sbjct: 126  KGCPSLQKLEMRGCLFFSERALAVAATQLTSL 157



>gb:T1J24_1723616 Arabidopsis thaliana BAC T1J24.
          Length = 246

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 21/71 (29%), Positives = 35/71 (49%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            V  S L  I     +LR L + + + +   G+ E A     LE+LD+     I ++ L  
Sbjct: 107  VNTSFLNYIADRSSNLRRLGVVDCAPVLSRGVVEAAMKLPLLEELDITYKSSIREQELKV 166

Query: 1156 IAKSCPNLASV 1188
            + +SCPNL ++
Sbjct: 167  VGQSCPNLRTL 177



>gb:CR382130_1663187 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 568

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 23/91 (25%), Positives = 48/91 (52%), Gaps = 5/91 (5%)
 Frame = +1

Query: 931  GLGKLSIR-----GNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCH 1095
            GL ++ +R     G++SFR + D+         P+L+++S+ + + I  + +  +     
Sbjct: 457  GLSEIHMRKCIALGDDSFRVLVDNS-------GPTLKSISVNSWAEIGVDTVKTVCKSLP 509

Query: 1096 QLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
             L+ +DL  C GI D+ +  +A++CP L  +
Sbjct: 510  GLQDIDLGFCKGINDECVELLAENCPLLQKI 540



>gb:BX908798_829820 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 1805

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 5/113 (4%)
 Frame = +1

Query: 865  LDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPS---LRALS 1035
            L+G + +D    AIA   A    L KLS+ GN     ++D G++A  +   S   L  LS
Sbjct: 1403 LNGNQISDKGAEAIAQSLASNAALWKLSLNGNQ----ISDQGMEAFAQALASNTILMDLS 1458

Query: 1036 LWNISSISDEGLFEIASGCHQLEKLDLCQC--PGITDKSLMAIAKSCPNLASV 1188
            L N + ISD+G+   A        + +       I+DK + A A++  +  S+
Sbjct: 1459 L-NGNQISDQGMKAFAQALASNTSIRVLSLNENQISDKEMEAFAQALASNTSI 1510



>gb:AE016818_1748541 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 1150

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +1

Query: 1015 PSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            P+LR + L    SI+D+ + ++     +L  + L +C  ITD SL+A++K   NL +V
Sbjct: 623  PALRLVDLSACESITDKTVVKLVQLAPKLRNVYLGKCSRITDNSLIALSKLGKNLQTV 680



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 18/71 (25%), Positives = 34/71 (47%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMA 1155
            +TD  +  + +  P LR + L   S I+D  L  ++     L+ +    C  ITD+ +  
Sbjct: 636  ITDKTVVKLVQLAPKLRNVYLGKCSRITDNSLIALSKLGKNLQTVHFGHCFNITDEGVKV 695

Query: 1156 IAKSCPNLASV 1188
            + ++CP +  V
Sbjct: 696  LIQNCPRIQYV 706



 Score = 33.9 bits (76), Expect = 6.6
 Identities = 14/59 (23%), Positives = 36/59 (61%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLM 1152
            +TD G+K + + CP ++ +     +++++  L+E+     +L+++ L +C  +TD+ L+
Sbjct: 688  ITDEGVKVLIQNCPRIQYVDFACCTNLTNHTLYELGD-LTKLKRIGLVKCSQMTDEGLL 745



 Score = 33.5 bits (75), Expect = 8.7
 Identities = 26/99 (26%), Positives = 47/99 (47%)
 Frame = +1

Query: 853  LSRCLDGKKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRAL 1032
            LS C      T V+L  +A    R   LGK S         +TD+ L A+ +   +L+ +
Sbjct: 630  LSACESITDKTVVKLVQLAP-KLRNVYLGKCS--------RITDNSLIALSKLGKNLQTV 680

Query: 1033 SLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
               +  +I+DEG+  +   C +++ +D   C  +T+ +L
Sbjct: 681  HFGHCFNITDEGVKVLIQNCPRIQYVDFACCTNLTNHTL 719



>pir|B84547|B84547 hypothetical protein At2g17020 [imported] -
            Arabidopsis thaliana>gb:AC002354_1530563 Arabidopsis
            thaliana chromosome II section 98 of 255 of the complete
            sequence. Sequence from clones F12A24,
            F6P23.>gb:AY133615_1581438 Arabidopsis thaliana
            At2g17020/At2g17020 mRNA, complete
            cds.>gb:AF367303_1791755 Arabidopsis thaliana At2g17020
            mRNA, complete cds.
          Length = 656

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 20/67 (29%), Positives = 34/67 (50%)
 Frame = +1

Query: 967  FRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            F  VTD+G K I   C SL   S+++   ++D    +I +    L  + L +C  +TD +
Sbjct: 336  FCRVTDAGFKTILHSCASLSKFSIYHGPKLTDLVFHDILATTLSLSHVSLRRCHLLTDHA 395

Query: 1147 LMAIAKS 1167
            +  +A S
Sbjct: 396  IQKLASS 402



 Score = 34.7 bits (78), Expect = 3.9
 Identities = 21/67 (31%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +1

Query: 976  VTDSGLKAIGRGC-PSLRALSLWNISSISDEGLFEIASGCHQL--EKLDLCQCPGITDKS 1146
            ++D+GL  +  G   SL +LS+    +++D+ +  +  G  +L   +LDL   P +TD +
Sbjct: 440  ISDTGLSYLKEGVLDSLVSLSVRGCRNLTDKFMSTLFDGSSKLALRELDLSNLPNLTDAA 499

Query: 1147 LMAIAKS 1167
            + A+AKS
Sbjct: 500  IFALAKS 506



>gb:OSJN00216_1696873 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0076A22, complete sequence.
          Length = 479

 Score = 35.4 bits (80), Expect = 2.3
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 13/80 (16%)
 Frame = +1

Query: 988  GLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCP------------- 1128
            GL+ +   C +L  L L  ++ + D  +  ++  C  L+ + L   P             
Sbjct: 255  GLRFLLGKCKALEKLCLEYVTGVIDNDMIVLSQACKNLKSISLWLKPEHYVVGGHIEFRT 314

Query: 1129 GITDKSLMAIAKSCPNLASV 1188
            G TD+SL A+A +CP L  V
Sbjct: 315  GFTDESLKALALNCPLLQDV 334



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGI 1134
            + D+G+  +   C  L +L L +I  ++  GL  +A GC  L  L L  C GI
Sbjct: 108  INDAGIACLTY-CKKLMSLKLNSIPEVTSSGLLMVAFGCKALSSLYLNDCKGI 159



>gb:AY045799_1561315 Arabidopsis thaliana putative F-box protein GRR1
            protein 1, AtFBL18 (At4g03190) mRNA, complete cds.
          Length = 585

 Score = 35.4 bits (80), Expect = 2.3
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 9/86 (10%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK---------L 1110
            N S+  V    L  + R C  L+   LW +  I D+GL  +AS C +L +         L
Sbjct: 291  NLSYATVRMPDLVELLRRCSKLQ--KLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDL 348

Query: 1111 DLCQCPGITDKSLMAIAKSCPNLASV 1188
            D    P +T++ L+ ++K C  L SV
Sbjct: 349  DATNIP-LTEQGLVFVSKGCRKLESV 373



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +LS+ G      ++D   K IG+    +R LS+   +  SD  L  + SGC  L+KL+
Sbjct: 430  LRRLSVSGL-----LSDKAFKYIGKHAKKVRMLSI-AFAGDSDLMLHHLLSGCESLKKLE 483

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            +  CP   D +L+  A     + S+
Sbjct: 484  IRDCP-FGDTALLEHAAKLETMRSL 507



>gb:BX908798_830697 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 194

 Score = 35.4 bits (80), Expect = 2.3
 Identities = 21/58 (36%), Positives = 33/58 (56%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            +TD+ L A+ +GC +L+ L L     ++D+GL  +      L+ LDL  C  +TDK L
Sbjct: 103  LTDAHLLAL-KGCKNLKILHLEKCWDLTDDGLAHLTP-LTSLQHLDLSSCKKLTDKGL 158



>pir|H85068|H85068 N7-like protein [imported] - Arabidopsis
            thaliana>gb:ATCHRIV15_1544392 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 15.
          Length = 322

 Score = 35.4 bits (80), Expect = 2.3
 Identities = 23/63 (36%), Positives = 32/63 (50%)
 Frame = +1

Query: 991  LKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSC 1170
            LKAIG  CP L+ L L ++ S       E+A    Q+  + L +C    D   +AIA+S 
Sbjct: 175  LKAIGHACPQLKTLKLNSLGS-------ELAHDISQVGYIPLLEC----DDDALAIAESM 223

Query: 1171 PNL 1179
            P L
Sbjct: 224  PKL 226



>pir|E85040|E85040 hypothetical protein AT4g03190 [imported] -
            Arabidopsis thaliana>gb:AC005275_1532350 Arabidopsis
            thaliana BAC F4C21 from chromosome IV, top arm, near 17
            cM, complete sequence.>gb:ATCHRIV8_1547300 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            8.>gb:AY150427_1584992 Arabidopsis thaliana putative
            F-box protein AtFBL18 (At4g03190) mRNA, complete cds.
          Length = 585

 Score = 35.4 bits (80), Expect = 2.3
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 9/86 (10%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK---------L 1110
            N S+  V    L  + R C  L+   LW +  I D+GL  +AS C +L +         L
Sbjct: 291  NLSYATVRMPDLVELLRRCSKLQ--KLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDL 348

Query: 1111 DLCQCPGITDKSLMAIAKSCPNLASV 1188
            D    P +T++ L+ ++K C  L SV
Sbjct: 349  DATNIP-LTEQGLVFVSKGCRKLESV 373



 Score = 35.0 bits (79), Expect = 3.0
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +LS+ G      ++D   K IG+    +R LS+   +  SD  L  + SGC  L+KL+
Sbjct: 430  LRRLSVSGL-----LSDKAFKYIGKHAKKVRMLSI-AFAGDSDLMLHHLLSGCESLKKLE 483

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            +  CP   D +L+  A     + S+
Sbjct: 484  IRDCP-FGDTALLEHAAKLETMRSL 507



>gb:AP004740_1844148 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0092H22.
          Length = 193

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = +1

Query: 583 DECLFEIFRRLPVGGQERSACAGVSKRWLML 675
           +ECLFEI   LP GG ER A   VS+RW ++
Sbjct: 152 EECLFEILHCLP-GGIERGASTCVSRRWFVM 181



>gb:AP003488_1829887 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0436F11.
          Length = 317

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 25/65 (38%), Positives = 33/65 (50%)
 Frame = +1

Query: 994  KAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCP 1173
            +AI    P LR L +     I+ + + EIAS CH L+ LDL  C  + DK L    +S P
Sbjct: 182  RAIACNMPKLRHLEI-GYMLIATKAVVEIASQCHDLKFLDLRGCWNVDDKLLQ---ESYP 237

Query: 1174 NLASV 1188
             L  V
Sbjct: 238  GLKVV 242



>gb:AF291816_1783718 Arabidopsis thaliana GRR1-like protein 1 (GRH1)
            mRNA, complete cds.
          Length = 585

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 26/85 (30%), Positives = 42/85 (49%)
 Frame = +1

Query: 934  LGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLD 1113
            L +LS+ G      ++D   K IG+    +R LS+   +  SD  L  + SGC  L+KL+
Sbjct: 430  LRRLSVSGL-----LSDKAFKYIGKHAKKVRMLSI-AFAGDSDLMLHHLLSGCESLKKLE 483

Query: 1114 LCQCPGITDKSLMAIAKSCPNLASV 1188
            +  CP   D +L+  A     + S+
Sbjct: 484  IRDCP-FGDTALLEHAAKLETMRSL 507



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 9/86 (10%)
 Frame = +1

Query: 958  NNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK---------L 1110
            N ++  V    L  + R C  L+   LW +  I D+GL  +AS C +L +         L
Sbjct: 291  NLTYATVRMPDLVELLRRCSKLQ--KLWVMDLIEDKGLEAVASYCKELRELRVFPSEPDL 348

Query: 1111 DLCQCPGITDKSLMAIAKSCPNLASV 1188
            D    P +T++ L+ ++K C  L SV
Sbjct: 349  DATNIP-LTEQGLVFVSKGCRKLESV 373



>gb:AC149287_1744901 Solanum demissum chromosome 5 clone PGEC568D21
           map MAP_LOC, complete sequence.
          Length = 427

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)
 Frame = +1

Query: 526 VFSGEKVDEKKQASIEV-----LPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLST 684
           +F G   D    AS  +     LPDE + EI  +LPV    +  C  VSK WL L+S+
Sbjct: 31  LFWGTNTDPSAMASDSIIPLLLLPDELITEILLKLPVKSLSKFMC--VSKSWLQLISS 86



>gb:AC114474_1739151 Genomic sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0032N04, from chromosome 10,
           complete sequence.
          Length = 393

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +1

Query: 562 ASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTIC 690
           A+ ++LPD+ L EI RRL    +  +AC  V K W   + T C
Sbjct: 2   AAADLLPDDVLEEILRRLAPSPRSLAACRVVCKAWRAAVDTRC 44



>gb:AC092748_1735594 Genomic sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0019N10, from chromosome 10,
           complete sequence.
          Length = 446

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +1

Query: 562 ASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTIC 690
           A+ ++LPD+ L EI RRL    +  +AC  V K W   + T C
Sbjct: 2   AAADLLPDDVLEEILRRLAPSPRSLAACRVVCKAWRAAVDTRC 44



>gb:AE016959_1022269 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017087_1752088
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 41 of 77 of the complete sequence.
          Length = 428

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 17/43 (39%), Positives = 24/43 (55%)
 Frame = +1

Query: 562 ASIEVLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLSTIC 690
           A+ ++LPD+ L EI RRL    +  +AC  V K W   + T C
Sbjct: 2   AAADLLPDDVLEEILRRLAPSPRSLAACRVVCKAWRAAVDTRC 44



>sp|Q12196|RIO1_YEAST RIO1 protein.>pir|S61006|S61006 RIO1 protein -
           yeast (Saccharomyces cerevisiae)>gb:SC130KBXV_1705020
           S.cerevisiae 130kb DNA fragment from chromosome
           XV.>gb:SCXVORFS_1711052 S.cerevisiae DNA of 51 Kb from
           chromosome XV right arm.>gb:SCYOR119C_1714346
           S.cerevisiae chromosome XV reading frame ORF YOR119c.
          Length = 484

 Score = 35.0 bits (79), Expect = 3.0
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 8/110 (7%)
 Frame = +1

Query: 583 DECLFEIFRRLPV-----GGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGD 747
           DE   EIFR L +     G +ER        ++ +L S I  D      + E  E +  D
Sbjct: 339 DEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNERNFAASEQFEFDNAD 398

Query: 748 NATAMQPELIKSDKKDGFVQSNVSEVQDNEEGDGFLS---RCLDGKKATD 888
           +  +   E    D++DG   S+ SE  D EEG+ +     + L GKK  D
Sbjct: 399 HECSSGTEEFSDDEEDG---SSGSEEDDEEEGEYYDDDEPKVLKGKKHED 445



>gb:BC072202_2556461 Xenopus laevis hypothetical protein MGC81139,
            mRNA (cDNA clone MGC:81139 IMAGE:6317694), complete cds.
          Length = 678

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 51/163 (31%), Positives = 66/163 (40%), Gaps = 1/163 (0%)
 Frame = +1

Query: 619  VGGQERSACAGVSKRWLMLLSTICRDELSTIKSGEASEPEEGDNATAMQPELIKSDKKDG 798
            VG QE    A VS        T+C + L TI +       E      +    + SD  D 
Sbjct: 522  VGWQEHCKAATVS----YCGHTLCGNTLRTIHT-----LPEASALCNIGTRTLHSDITDC 572

Query: 799  FVQSNVSEVQDNEEGDGFLSRCLDG-KKATDVRLAAIAVGTARRGGLGKLSIRGNNSFRG 975
            F  S  S+ Q       FLS  L G  + TD  L A+ +G    GGL KL     +    
Sbjct: 573  FPGSAKSD-QQAARALQFLS--LSGCHQITDHGLRALTIG----GGLPKLEHLNLSGCLN 625

Query: 976  VTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLE 1104
            VT SGL+ +   CPSL     +   +IS       ASGC  L+
Sbjct: 626  VTGSGLQDLVATCPSLNDEHFYYCDNISGPH-GATASGCQNLQ 667



>gb:AY057563_1563980 Arabidopsis thaliana AT5g56420/MCD7_18 mRNA,
            complete cds.
          Length = 401

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            SL+ L L ++  + D+ L  I S C  LE L + +CPG   K +   A S   L+
Sbjct: 134  SLKTLHLLDVKYLDDQSLPRIISSCSSLEDLVVQRCPGDNVKVVTVTAPSLKTLS 188



>gb:AB009049_1510609 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MCD7.
          Length = 422

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 19/55 (34%), Positives = 28/55 (50%)
 Frame = +1

Query: 1018 SLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLA 1182
            SL+ L L ++  + D+ L  I S C  LE L + +CPG   K +   A S   L+
Sbjct: 155  SLKTLHLLDVKYLDDQSLPRIISSCSSLEDLVVQRCPGDNVKVVTVTAPSLKTLS 209



>gb:BTA518953_1436722 Bos taurus partial fbxl6 gene for F-box and
            leucine-rich repeat protein 6, exons 2-8.
          Length = 336

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +1

Query: 1078 IASGCHQLEKLDLCQCPGITDKSLMAIAKSCPNLASV 1188
            ++  C +L  L L  C G+T  +L+ +AK+CP L S+
Sbjct: 76   VSESCPRLSFLKLSDCHGVTPDALIMLAKACPQLHSL 112



>gb:AE014298_1125616 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003495_1212625 Drosophila melanogaster
            chromosome X, section 47 of 74 of the complete
            sequence.>gb:AY069093_1293823 Drosophila melanogaster
            GH11272 full length cDNA.
          Length = 669

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 21/64 (32%), Positives = 31/64 (48%)
 Frame = +1

Query: 988  GLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKSLMAIAKS 1167
            GL  +   CP L+ L L  +   ++  L  IA+    LE+LDL     IT + +  I  +
Sbjct: 570  GLFQLLSNCPKLKKLFLSAVRGTTERDLMHIAALGKNLEQLDLMGILNITHERVYDILVN 629

Query: 1168 CPNL 1179
            CP L
Sbjct: 630  CPKL 633



 Score = 34.3 bits (77), Expect = 5.1
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%)
 Frame = +1

Query: 976  VTDSGLKAIGRGCPSLRALSL-WNISSIS-DEGLFEIASGCHQLEKLDLCQCPGITDKSL 1149
            ++  GL+++ R    L  L L W +   S  +GLF++ S C +L+KL L    G T++ L
Sbjct: 539  LSSRGLQSLAR-LHQLEELDLGWCMREASLGDGLFQLLSNCPKLKKLFLSAVRGTTERDL 597

Query: 1150 MAIAKSCPNL 1179
            M IA    NL
Sbjct: 598  MHIAALGKNL 607



>pir|F85090|F85090 hypothetical protein AT4g08980 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV25_1544613 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            25.>gb:AY084585_1569673 Arabidopsis thaliana clone 11257
            mRNA, complete sequence.>gb:BT002431_1636034 Arabidopsis
            thaliana F-box protein family, AtFBW2 (At4g08980) mRNA,
            complete cds.>gb:BT008715_1639911 Arabidopsis thaliana
            At4g08980 gene, complete cds.>gb:T3H13_1724065
            Arabidopsis thaliana BAC T3H13.
          Length = 317

 Score = 34.7 bits (78), Expect = 3.9
 Identities = 26/84 (30%), Positives = 40/84 (47%)
 Frame = +1

Query: 928  GGLGKLSIRGNNSFRGVTDSGLKAIGRGCPSLRALSLWNISSISDEGLFEIASGCHQLEK 1107
            G L KLS+ G  +     DS    I +   SL+ L +   S +++ G+  +A     L  
Sbjct: 82   GSLRKLSVTGLRN-----DSIFSFIAQHAGSLKTLKVPR-SGLTNSGVVNVAEKLSSLTF 135

Query: 1108 LDLCQCPGITDKSLMAIAKSCPNL 1179
            LDL  C  I  +++ AI K C +L
Sbjct: 136  LDLSYCCKIGPEAIQAIGKHCKSL 159



>gb:AK095556_1914384 Homo sapiens cDNA FLJ38237 fis, clone
            FCBBF2005637.>gb:AL133215_1918237 Human DNA sequence from
            clone RP11-108L7 on chromosome 10 Contains the 3' end of
            the C10orf6 gene for chromosome 10 open reading frame 6,
            the SEMA4G gene for sema domain immunoglobulin domain
            (Ig) transmembrane domain (TM) and short cytoplasmic
            domain (semaphorin) 4G, the MRPL43 gene for mitochondrial
            ribosomal protein L43, the C10orf2 gene for chromosome 10
            open reading frame 2, the gene for a novel protein
            (KIAA1813) (LAPSER1), a novel gene, the gene for a novel
            protein (FLJ23209 FLJ00011), the gene for a novel
            tricarboxylate carrier domain containing protein
            (FLJ34185 FLJ35692), the gene for a novel kazal-type
            serine protease inhibitor domain and immunoglobulin
            domain containing protein (FKSG28) (FKSG4), the 3' end of
            a novel gene and six CpG islands, complete
            sequence.>gb:BC041165_1983007 Homo sapiens mitochondrial
            ribosomal protein L43, transcript variant 2, mRNA (cDNA
            clone MGC:48892 IMAGE:5590251), complete cds.
          Length = 215

 Score = 34.3 bits (77), Expect = 5.1
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -3

Query: 1130 PGHWQRSSFSS*WHPLAISNKPSSLMDEMFQRERALREGQP-RPIALRPESVTPRKELFP 954
            P H    S    WHP   +NKP++       R R +++  P +   LR  +V P+     
Sbjct: 118  PFHTDNPSIQGQWHPF--TNKPTTFRG---LRPREVQDPAPAQDTGLRLSAVAPQI---- 168

Query: 953  LIDSFPNPPRLAVPTAIAASLTS 885
            L+  +P+PP L     I++SLTS
Sbjct: 169  LLPGWPDPPDLPTVDPISSSLTS 191



>gb:AP003898_1834962 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC
            clone:OJ1663_D06.>gb:AP005734_1856844 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBb0032E15.
          Length = 889

 Score = 34.3 bits (77), Expect = 5.1
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%)
 Frame = +1

Query: 970  RGVTDSGLKAI-GRGCPSLRALSLWNISSISDEGLFEIASGCHQLEKLDLCQCPGITDKS 1146
            R +TD  L A+ GR   +LR+L L   + +SD GL  +      + +L + +C G+T + 
Sbjct: 643  RRLTDEALLALTGRAGGTLRSLRLLGCTRVSDAGLLRVVERNPGITELYMPRCTGLTAEG 702

Query: 1147 LMAIAK 1164
            ++ I +
Sbjct: 703  VVKIVQ 708



>gb:AC151815_1745152 Solanum demissum chromosome 5 clone PGEC472P22
           map MAP_LOC, complete sequence.
          Length = 383

 Score = 34.3 bits (77), Expect = 5.1
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 574 VLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLST 684
           +LPDE + EI  RLP+    +  C  VSK WL L+S+
Sbjct: 10  LLPDELITEILLRLPIKSLSKFMC--VSKSWLQLISS 44



>gb:AC149301_1744993 Solanum demissum chromosome 5 clone PGEC517A09
           map MAP_LOC, complete sequence.
          Length = 384

 Score = 34.3 bits (77), Expect = 5.1
 Identities = 17/37 (45%), Positives = 23/37 (62%)
 Frame = +1

Query: 574 VLPDECLFEIFRRLPVGGQERSACAGVSKRWLMLLST 684
           +LPDE + EI  RLP+    +  C  VSK WL L+S+
Sbjct: 11  LLPDELITEILLRLPIKSLSKFMC--VSKSWLQLISS 45


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,224,490,959
Number of Sequences: 1806583
Number of extensions: 26108973
Number of successful extensions: 92500
Number of sequences better than 10.0: 262
Number of HSP's better than 10.0 without gapping: 85223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91945
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 94817640246
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)