BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3367
         (1483 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47827|T47827 squamosa promoter binding protein-like 12 [imp...   257   8e-72   Arabidopsis thaliana [mouse-ear cress]
pir|T52601|T52601 squamosa promoter binding protein 1 [imported]...   231   3e-59   Arabidopsis thaliana [mouse-ear cress]
pir|T52602|T52602 squamosa promoter binding protein 1 [imported]...   228   2e-58   Arabidopsis thaliana [mouse-ear cress]
pir|T02180|T02180 probable squamosa-promoter binding protein [im...   211   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AC092557_1735502 Oryza sativa chromosome 3 BAC OSJNBa0096I06 ...   202   2e-51   
pir|G86342|G86342 hypothetical protein F9H16.3 - Arabidopsis tha...   157   5e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AP002482_1822186 Oryza sativa (japonica cultivar-group) genom...   155   3e-36   
pir|H96793|H96793 unknown protein F14G6.18 [imported] - Arabidop...   154   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AP004765_1844678 Oryza sativa (japonica cultivar-group) genom...   149   1e-34   
gb:AP004324_1840165 Oryza sativa (japonica cultivar-group) genom...   129   1e-28   
gb:AY779340_1628294 Gossypium hirsutum SBP transcription factor ...   128   3e-28   
gb:AY084312_1569404 Arabidopsis thaliana clone 10375 mRNA, compl...   128   3e-28   
pir|T52597|T52597 squamosa promoter binding protein 3 [imported]...   128   3e-28   Arabidopsis thaliana [mouse-ear cress]
pir|H84749|H84749 probable squamosa-promoter binding protein [im...   128   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF370612_1792395 Arabidopsis thaliana similar to squamosa-pro...   127   8e-28   
gb:AC008262_1536605 Genomic sequence for Arabidopsis thaliana BA...   127   8e-28   
pir|T52592|T52592 squamosa-promoter binding protein 6 [imported]...   127   8e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP005294_1850023 Oryza sativa (japonica cultivar-group) genom...   126   1e-27   
gb:AMA011623_1819136 Antirrhinum majus mRNA for squamosa promote...   125   2e-27   
pir|T52297|T52297 squamosa promoter binding protein-homolog 5 [i...   125   2e-27   Antirrhinum majus [garden snapdragon]
gb:AP005186_1849052 Oryza sativa (japonica cultivar-group) genom...   125   3e-27   
sp|Q38741|SBP1_ANTMA|SBP1_ANTMA Squamosa-promoter binding protein 1.>pir|S6...   124   4e-27   Antirrhinum majus [garden snapdragon]
pir|T52299|T52299 squamosa promoter binding protein-homolog 3 [i...   124   7e-27   Antirrhinum majus [garden snapdragon]
gb:AMA011622_1819135 Antirrhinum majus mRNA for squamosa promote...   123   1e-26   
pir|T52298|T52298 squamosa promoter binding protein-homolog 4 [i...   123   1e-26   Antirrhinum majus [garden snapdragon]
gb:ATH011632_1551940 Arabidopsis thaliana (ecotype Landsberg ere...   122   2e-26   
pir|T52599|T52599 squamosa promoter binding protein 4 [imported]...   122   2e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T52600|T52600 squamosa promoter binding protein 4 [imported]...   122   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP005816_1858353 Oryza sativa (japonica cultivar-group) genom...   121   3e-26   
gb:AK118174_1816166 Arabidopsis thaliana At1g02065 mRNA for puta...   121   3e-26   
gb:AY074853_1567705 Arabidopsis thaliana At1g27370/F17L21_16 mRN...   121   3e-26   
gb:AE005172_891614 Arabidopsis thaliana chromosome 1, top arm co...   121   3e-26   
pir|T52596|T52596 squamosa promoter binding protein homolog 10 [...   121   3e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T52594|T52594 squamosa promoter binding protein 8 [imported]...   121   3e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AY084609_1569697 Arabidopsis thaliana clone 113229 mRNA, comp...   121   4e-26   
gb:AB023037_1515381 Arabidopsis thaliana genomic DNA, chromosome...   121   4e-26   
gb:AJ628864_1812643 Arabidopsis thaliana mRNA for putative squam...   120   6e-26   
gb:AY046007_1561500 Arabidopsis thaliana putative squamosa-promo...   120   6e-26   
pir|T52598|T52598 squamosa-promoter binding protein 11 [imported...   120   6e-26   Arabidopsis thaliana [mouse-ear cress]
pir|B86399|B86399 protein F17L21.14 [imported] - Arabidopsis tha...   120   6e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T52593|T52593 squamosa promoter binding protein homolog 9 [i...   120   6e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T00929|T00929 squamosa-promoter binding protein 9 [imported]...   120   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP005529_1853552 Oryza sativa (japonica cultivar-group) genom...   120   7e-26   
gb:ATH242960_1552082 Arabidopsis thaliana mRNA for Squamosa prom...   120   7e-26   
pir|T52567|T52567 squamosa promoter binding protein-like 5 [impo...   120   7e-26   Arabidopsis thaliana [mouse-ear cress]
pir|T52607|T52607 squamosa promoter binding protein 5 [imported]...   120   7e-26   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00090_1694724 Oryza sativa genomic DNA, chromosome 4, BAC...   119   1e-25   
pir|T52604|T52604 squamosa promoter binding protein 2 [imported]...   118   3e-25   Arabidopsis thaliana [mouse-ear cress]
pir|T52603|T52603 squamosa promoter binding protein 2 [imported]...   118   3e-25   Arabidopsis thaliana [mouse-ear cress]
sp|O04003|LG1_MAIZE|LG1_MAIZE LIGULELESS1 protein.>pir|T04328|T04328 ligul...   117   5e-25   Zea mays [maize]
pir|T46014|T46014 squamosa promoter-binding protein homolog - Ar...   117   8e-25   Arabidopsis thaliana [mouse-ear cress]
sp|Q38740|SBP2_ANTMA|SBP2_ANTMA Squamosa-promoter binding protein 2.>pir|S6...   116   1e-24   Antirrhinum majus [garden snapdragon]
gb:ZMA011616_1731428 Zea mays mRNA for SBP-domain protein 3.          116   1e-24   
gb:OSJN00060_1694105 Oryza sativa genomic DNA, chromosome 4, BAC...   115   2e-24   
gb:BPE558183_1634075 Betula pendula mRNA for squamosa promoter b...   115   2e-24   
gb:AP004838_1845761 Oryza sativa (japonica cultivar-group) genom...   113   9e-24   
gb:ZMA011617_1731429 Zea mays mRNA for SBP-domain protein 4.          113   9e-24   
gb:ZMA011614_1731426 Zea mays mRNA for SBP-domain protein 1.          112   2e-23   
gb:ZMA011615_1731427 Zea mays mRNA for SBP-domain protein 2.          112   3e-23   
gb:AP005772_1857598 Oryza sativa (japonica cultivar-group) genom...   111   3e-23   
gb:AP005772_1857597 Oryza sativa (japonica cultivar-group) genom...   111   3e-23   
gb:ZMA011619_1731431 Zea mays mRNA for SBP-domain protein 6, par...   108   4e-22   
gb:ZMA011618_1731430 Zea mays mRNA for SBP-domain protein 5, par...   106   1e-21   
gb:AP005760_1857399 Oryza sativa (japonica cultivar-group) genom...   104   4e-21   
gb:AP004744_1844237 Oryza sativa (japonica cultivar-group) genom...   104   4e-21   
gb:ATH011611_1551929 Arabidopsis thaliana (ecotype Landsberg ere...    97   7e-19   
pir|T52606|T52606 squamosa promoter binding protein 7 [imported]...    97   7e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY078050_1568019 Arabidopsis thaliana AT5g18830/F17K4_80 mRNA...    97   9e-19   
gb:AY063815_1565765 Arabidopsis thaliana putative squamosa promo...    97   9e-19   
pir|T52605|T52605 squamosa promoter binding protein 7 [imported]...    97   9e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY484394_1608307 Chlamydomonas reinhardtii copper responsive ...    94   7e-18   
gb:AC137620_1743671 Oryza sativa (japonica cultivar-group) chrom...    93   2e-17   
gb:AP005772_1857599 Oryza sativa (japonica cultivar-group) genom...    68   6e-10   
gb:ZMA011620_1731432 Zea mays mRNA for SBP-domain protein 7, par...    64   6e-09   
gb:BA000009_1632225 Beta vulgaris subsp. vulgaris mitochondrial ...    64   6e-09   
gb:CR382138_1671769 Debaryomyces hansenii chromosome F of strain...    35   5.2     
gb:CP000013_869742 Borrelia garinii PBi, complete genome.              34   8.9     
gb:BX571660_778667 Wolinella succinogenes, complete genome; segm...    34   8.9     
pir|JU0096|SXBPT4 NAD+-protein ADP-ribosyltransferase (EC 2.4.2....    34   8.9     
sp|P12726|ALT_BPT4|ALT_BPT4 NAD--protein ADP-ribosyltransferase (EC 2.4.2...    34   8.9     Escherichia virus T4


>pir|T47827|T47827 squamosa promoter binding protein-like 12
            [imported] - Arabidopsis thaliana>gb:ATH132096_1552000
            Arabidopsis thaliana mRNA for squamosa promoter binding
            protein-like 12.>gb:ATH132097_1552001 Arabidopsis
            thaliana spl12 gene, exons 1-10.>gb:ATT2O9_1555753
            Arabidopsis thaliana DNA chromosome 3, BAC clone
            T2O9.>gb:BT003817_1636948 Arabidopsis thaliana clone
            C105276 putative squamosa promoter binding protein 12
            (At3g60030) mRNA, complete cds.
          Length = 927

 Score =  257 bits (656), Expect(2) = 8e-72
 Identities = 150/314 (47%), Positives = 191/314 (60%), Gaps = 7/314 (2%)
 Frame = +2

Query: 272  GKRSLEWDPSDWKWDGHLFLARPLNPNPSSNYQSRQFFPLETGIXXXXXXXXXXXXXXXX 451
            GKRS+EWD +DWKW+G LF+A  LN + SSN  S                          
Sbjct: 20   GKRSVEWDLNDWKWNGDLFVATQLN-HGSSNSSS-----------------------TCS 55

Query: 452  DEVNIG-SEKETRELEKRQR-----VIVVEEDNXXXXXXXXXXXXXXXRRFPSNDRELQT 613
            DE N+   E+   E+EK+++     V+ +EEDN                           
Sbjct: 56   DEGNVEIMERRRIEMEKKKKRRAVTVVAMEEDNLKDDDAHRLTLNLGGNN---------- 105

Query: 614  LDGTIGKKIKLSGPTSNRAVC-QVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQ 790
            ++G   KK KL G   +RA+C QV++CGADLSK KDYHRRHKVCE+HSKAT ALVG IMQ
Sbjct: 106  IEGNGVKKTKLGGGIPSRAICCQVDNCGADLSKVKDYHRRHKVCEIHSKATTALVGGIMQ 165

Query: 791  RFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSL 970
            RFCQQCSRFH L+EFD+GKRSCRRRLAGHNKRRRK  P+T+ N  +M+D Q S Y+L++L
Sbjct: 166  RFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKANPDTIGNGTSMSDDQTSNYMLITL 225

Query: 971  LKILANMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKSISGILNESSNLLNNGPAFRDS 1150
            LKIL+N+HSN+ + T DQDLLSHLLKSL SQ      +++ G+L     L     A ++ 
Sbjct: 226  LKILSNIHSNQSDQTGDQDLLSHLLKSLVSQAGEHIGRNLVGLLQGGGGL----QASQNI 281

Query: 1151 DMISALISNGSQAP 1192
              +SAL+S   QAP
Sbjct: 282  GNLSALLSL-EQAP 294



 Score = 38.1 bits (87), Expect(2) = 8e-72
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 1/71 (1%)
 Frame = +3

Query: 1272 EDMRASS-SQRPVNMFSVESSSLVTAPGQESSAGRNKLITFDLNDMYVDSDDGTEDVXRL 1448
            ED++  S S+ P       S+    AP  + S  + K+  FDLND+Y+DSDD T+     
Sbjct: 296  EDIKHHSVSETPWQEVYANSAQERVAP--DRSEKQVKVNDFDLNDIYIDSDDTTDIERSS 353

Query: 1449 PVPADVVTGSL 1481
            P P +  T SL
Sbjct: 354  PPPTNPATSSL 364



>pir|T52601|T52601 squamosa promoter binding protein 1 [imported] -
            Arabidopsis thaliana>gb:ATH011577_1551924 Arabidopsis
            thaliana SPL1 gene.>gb:ATH011629_1551937 Arabidopsis
            thaliana (ecotype Columbia) mRNA for squamosa promoter
            binding protein-like 1.
          Length = 881

 Score =  231 bits (589), Expect = 3e-59
 Identities = 136/279 (48%), Positives = 159/279 (56%)
 Frame = +2

Query: 266  AVGKRSLEWDPSDWKWDGHLFLARPLNPNPSSNYQSRQFFPLETGIXXXXXXXXXXXXXX 445
            +VGKRS+EWD +DWKWDG LFLA       +   + RQFFPL                  
Sbjct: 17   SVGKRSVEWDLNDWKWDGDLFLA-------TQTTRGRQFFPLGNS---------SNSSSS 60

Query: 446  XXDEVNIGSEKETRELEKRQRVIVVEEDNXXXXXXXXXXXXXXXRRFPSNDRELQTLDGT 625
              DE N          +K++R + ++ D                             DG 
Sbjct: 61   CSDEGN----------DKKRRAVAIQGDTNGALTLNLNGES----------------DGL 94

Query: 626  IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
               K   SG     AVCQVE+C ADLSK KDYHRRHKVCEMHSKAT A VG I+QRFCQQ
Sbjct: 95   FPAKKTKSG-----AVCQVENCEADLSKVKDYHRRHKVCEMHSKATSATVGGILQRFCQQ 149

Query: 806  CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
            CSRFH LQEFD+GKRSCRRRLAGHNKRRRKT PE   N N  +D  +S YLL++LLKIL+
Sbjct: 150  CSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNPEPGANGNP-SDDHSSNYLLITLLKILS 208

Query: 986  NMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKSISGIL 1102
            NMH    N T DQDL+SHLLKSL S       K++  +L
Sbjct: 209  NMH----NHTGDQDLMSHLLKSLVSHAGEQLGKNLVELL 243



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 24/62 (38%), Positives = 29/62 (46%)
 Frame = +3

Query: 1296 QRPVNMFSVESSSLVTAPGQESSAGRNKLITFDLNDMYVDSDDGTEDVXRLPVPADVVTG 1475
            Q  +  FS       T    E      K+  FDLND+Y+DSDD   DV R P P +  T 
Sbjct: 268  QEELKQFSARQDGTATENRSEKQV---KMNDFDLNDIYIDSDD--TDVERSPPPTNPATS 322

Query: 1476 SL 1481
            SL
Sbjct: 323  SL 324



>pir|T52602|T52602 squamosa promoter binding protein 1 [imported] -
            Arabidopsis thaliana>gb:ATH011628_1551936 Arabidopsis
            thaliana (ecotype Landsberg erecta) mRNA for squamosa
            promoter binding protein-like 1.
          Length = 881

 Score =  228 bits (581), Expect = 2e-58
 Identities = 135/279 (48%), Positives = 158/279 (56%)
 Frame = +2

Query: 266  AVGKRSLEWDPSDWKWDGHLFLARPLNPNPSSNYQSRQFFPLETGIXXXXXXXXXXXXXX 445
            +VGKRS+EWD +DWKWDG LFLA       +   + RQFFPL                  
Sbjct: 17   SVGKRSVEWDLNDWKWDGDLFLA-------TQTTRGRQFFPLGNS---------SNSSSS 60

Query: 446  XXDEVNIGSEKETRELEKRQRVIVVEEDNXXXXXXXXXXXXXXXRRFPSNDRELQTLDGT 625
              DE N          +K++R + ++ D                             DG 
Sbjct: 61   CSDEGN----------DKKRRAVAIQGDTNGALTLNLNGES----------------DGL 94

Query: 626  IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
               K   SG     AVCQVE+C ADLSK KDYHRRHKVCEMHSKAT A V  I+QRFCQQ
Sbjct: 95   FPAKKTKSG-----AVCQVENCEADLSKVKDYHRRHKVCEMHSKATSATVEGILQRFCQQ 149

Query: 806  CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
            CSRFH LQEFD+GKRSCRRRLAGHNKRRRKT PE   N N  +D  +S YLL++LLKIL+
Sbjct: 150  CSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNPEPGANGNP-SDDHSSNYLLITLLKILS 208

Query: 986  NMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKSISGIL 1102
            NMH    N T DQDL+SHLLKSL S       K++  +L
Sbjct: 209  NMH----NHTGDQDLMSHLLKSLVSHAGEQLGKNLVELL 243



 Score = 39.7 bits (91), Expect = 0.16
 Identities = 24/62 (38%), Positives = 29/62 (46%)
 Frame = +3

Query: 1296 QRPVNMFSVESSSLVTAPGQESSAGRNKLITFDLNDMYVDSDDGTEDVXRLPVPADVVTG 1475
            Q  +  FS       T    E      K+  FDLND+Y+DSDD   DV R P P +  T 
Sbjct: 268  QEELKQFSARQDGTATENRSEKQV---KMNDFDLNDIYIDSDD--TDVERSPPPTNPATS 322

Query: 1476 SL 1481
            SL
Sbjct: 323  SL 324



>pir|T02180|T02180 probable squamosa-promoter binding protein
           [imported] - Arabidopsis thaliana>gb:AC004411_1531672
           Arabidopsis thaliana chromosome 2 clone F14M4 map
           CIC06C03, complete sequence.
          Length = 240

 Score =  211 bits (538), Expect = 2e-53
 Identities = 121/244 (49%), Positives = 140/244 (57%)
 Frame = +2

Query: 266 AVGKRSLEWDPSDWKWDGHLFLARPLNPNPSSNYQSRQFFPLETGIXXXXXXXXXXXXXX 445
           +VGKRS+EWD +DWKWDG LFLA       +   + RQFFPL                  
Sbjct: 17  SVGKRSVEWDLNDWKWDGDLFLA-------TQTTRGRQFFPLGNS---------SNSSSS 60

Query: 446 XXDEVNIGSEKETRELEKRQRVIVVEEDNXXXXXXXXXXXXXXXRRFPSNDRELQTLDGT 625
             DE N          +K++R + ++ D                             DG 
Sbjct: 61  CSDEGN----------DKKRRAVAIQGDTNGALTLNLNGES----------------DGL 94

Query: 626 IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
              K   SG     AVCQVE+C ADLSK KDYHRRHKVCEMHSKAT A VG I+QRFCQQ
Sbjct: 95  FPAKKTKSG-----AVCQVENCEADLSKVKDYHRRHKVCEMHSKATSATVGGILQRFCQQ 149

Query: 806 CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
           CSRFH LQEFD+GKRSCRRRLAGHNKRRRKT PE   N N  +D  +S YLL++LLKIL+
Sbjct: 150 CSRFHLLQEFDEGKRSCRRRLAGHNKRRRKTNPEPGANGNP-SDDHSSNYLLITLLKILS 208

Query: 986 NMHS 997
           NMHS
Sbjct: 209 NMHS 212



>gb:AC092557_1735502 Oryza sativa chromosome 3 BAC OSJNBa0096I06
            genomic sequence, complete sequence.
          Length = 969

 Score =  202 bits (514), Expect(2) = 2e-51
 Identities = 117/344 (34%), Positives = 175/344 (50%), Gaps = 22/344 (6%)
 Frame = +2

Query: 257  DLRAVGKRSLEWDPSDWKWDGHLFLARP----------LNPNPSSNYQSRQFFPLETGIX 406
            D+    KR   WD +DW+WD   F+A P          LN +PSS+ ++           
Sbjct: 22   DMDRRDKRLFGWDLNDWRWDSDRFVATPVPAAEASGLALNSSPSSSEEA----------- 70

Query: 407  XXXXXXXXXXXXXXXDEVNIGSEKETRELEKRQRVIVVEEDNXXXXXXXXXXXXXXXRRF 586
                              ++ +     + +KR+RV+V+++D+                R 
Sbjct: 71   ---------------GAASVRNVNARGDSDKRKRVVVIDDDDVEDDELVENGGGSLSLRI 115

Query: 587  PSN------------DRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRR 730
              +            D E +      GKKI++ G + +   CQVE C ADL+  +DYHRR
Sbjct: 116  GGDAVAHGAGVGGGADEEDRN-----GKKIRVQGGSPSGPACQVEGCTADLTGVRDYHRR 170

Query: 731  HKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPET 910
            HKVCEMH+KAT A+VGN +QRFCQQCSRFH LQEFD+GKRSCRRRLAGHN+RRRKT+PE 
Sbjct: 171  HKVCEMHAKATTAVVGNTVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRPEV 230

Query: 911  VINSNTMNDSQASGYLLMSLLKILANMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKSI 1090
             +  +   + + S YLL+ LL + AN++++       Q+L+S LL++L +       K +
Sbjct: 231  AVGGSAFTEDKISSYLLLGLLGVCANLNADNAEHLRGQELISGLLRNLGAVAKSLDPKEL 290

Query: 1091 SGILNESSNLLNNGPAFRDSDMISALISNGSQAPSRPKEQPCTF 1222
              +L E+   + +G     S+  +AL++      + P      F
Sbjct: 291  CKLL-EACQSMQDGSNAGTSETANALVNTAVAEAAGPSNSKMPF 333



 Score = 24.3 bits (51), Expect(2) = 2e-51
 Identities = 28/87 (32%), Positives = 32/87 (36%)
 Frame = +3

Query: 1218 PSASKMPTKGLDVHDVGVEDMRASSSQRPVNMFSVESSSLVTAPGQESSAGRNKLITFDL 1397
            PS SKMP    D   +      ASSS  PV       S  V  P   +     K   FDL
Sbjct: 326  PSNSKMPFVNGDQCGL------ASSSVVPVQ----SKSPTVATPDPPAC----KFKDFDL 371

Query: 1398 NDMYVDSDDGTEDVXRLPVPADVVTGS 1478
            ND Y   +   +     P PA   T S
Sbjct: 372  NDTYGGMEGFEDGYEGSPTPAFKTTDS 398



>pir|G86342|G86342 hypothetical protein F9H16.3 - Arabidopsis
           thaliana>gb:AE005172_891058 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007369_1535803 Arabidopsis thaliana
           chromosome I BAC F9H16 genomic sequence, complete
           sequence.
          Length = 1035

 Score =  157 bits (397), Expect = 5e-37
 Identities = 80/126 (63%), Positives = 93/126 (73%), Gaps = 8/126 (6%)
 Frame = +2

Query: 632 KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           KK++   P  N  +CQV++C  DLS AKDYHRRHKVCE+HSKATKALVG  MQRFCQQCS
Sbjct: 106 KKVRSGSPGGNYPMCQVDNCTEDLSHAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCS 165

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK-TQPETVI-------NSNTMNDSQASGYLLMS 967
           RFH L EFD+GKRSCRRRLAGHN+RRRK TQPE V        N +T N++  +   LM+
Sbjct: 166 RFHLLSEFDEGKRSCRRRLAGHNRRRRKTTQPEEVASGVVVPGNHDTTNNTANANMDLMA 225

Query: 968 LLKILA 985
           LL  LA
Sbjct: 226 LLTALA 231



>gb:AP002482_1822186 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, clone:P0706B05.
          Length = 862

 Score =  155 bits (391), Expect = 3e-36
 Identities = 100/302 (33%), Positives = 157/302 (51%), Gaps = 10/302 (3%)
 Frame = +2

Query: 275  KRSLEWDPSDWKWDGHLFLARPLNPNPSSNYQSRQFFPLETGIXXXXXXXXXXXXXXXXD 454
            K+ LEWD +DW+WD +LFLA P N +PS    SR+      G                  
Sbjct: 7    KKGLEWDLNDWRWDSNLFLATPSNASPSKC--SRRELGRAEG------------------ 46

Query: 455  EVNIGSEKETRELEKRQRVIVVEEDNXX---XXXXXXXXXXXXXRRFPSNDRELQTLDGT 625
            E++ G       ++KR+RV   ++D                   +R  S++ E+    GT
Sbjct: 47   EIDFGV------VDKRRRVSPEDDDGEECINAATTNGDDGQISGQRGRSSEDEMPR-QGT 99

Query: 626  IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
                   SGP      CQV+ C  +LS A+DY++RHKVCE+H+K+    + N+  RFCQQ
Sbjct: 100  CSS----SGPC-----CQVDGCTVNLSSARDYNKRHKVCEVHTKSGVVRIKNVEHRFCQQ 150

Query: 806  CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
            CSRFH LQEFD+GK+SCR RLA HN+RRRK Q +  ++ N+++++ +    L+ LLK L+
Sbjct: 151  CSRFHFLQEFDEGKKSCRSRLAQHNRRRRKVQVQAGVDVNSLHENHSLSNTLLLLLKQLS 210

Query: 986  NMHSN-RGNSTEDQDLLSHLLKSLASQGALSGDKSI------SGILNESSNLLNNGPAFR 1144
             + S+         + L++L+K+LA+      ++ +      + I + + N +  G +  
Sbjct: 211  GLDSSGPSEQINGPNYLTNLVKNLAALAGTQRNQDMLKNANSAAIASHTGNYVAKGNSLH 270

Query: 1145 DS 1150
            DS
Sbjct: 271  DS 272



>pir|H96793|H96793 unknown protein F14G6.18 [imported] - Arabidopsis
            thaliana>gb:AE005173_895189 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC015450_1538050 Arabidopsis thaliana
            chromosome 1 BAC F14G6 genomic sequence, complete
            sequence.
          Length = 1020

 Score =  154 bits (388), Expect = 6e-36
 Identities = 95/216 (43%), Positives = 119/216 (55%), Gaps = 15/216 (6%)
 Frame = +2

Query: 593  NDRELQTLDGTI-GKKIKLSGPTS------NRAVCQVEDCGADLSKAKDYHRRHKVCEMH 751
            ND E   +D T   KK++   P S      N   CQV++C  DLS AKDYHRRHKVCE+H
Sbjct: 80   NDVEGTPVDLTRPSKKVRSGSPGSGGGGGGNYPKCQVDNCKEDLSIAKDYHRRHKVCEVH 139

Query: 752  SKATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVIN---- 919
            SKATKALVG  MQRFCQQCSRFH L EFD+GKRSCRRRL GHN+RRRKTQP+ + +    
Sbjct: 140  SKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSCRRRLDGHNRRRRKTQPDAITSQVVA 199

Query: 920  ----SNTMNDSQASGYLLMSLLKILANMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKS 1087
                 NT N++      L++ L      +    N +        LL+ L    AL    +
Sbjct: 200  LENRDNTSNNTNMDVMALLTALVCAQGRNEATTNGSPGVPQREQLLQILNKIKALPLPMN 259

Query: 1088 ISGILNESSNLLNNGPAFRDSDMISALISNGSQAPS 1195
            ++  LN    L    P  + S M      NG+ +PS
Sbjct: 260  LTSKLNNIGILARKNPE-QPSPMNPQNSMNGASSPS 294



>gb:AP004765_1844678 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0711H09.
          Length = 1140

 Score =  149 bits (377), Expect = 1e-34
 Identities = 88/196 (44%), Positives = 108/196 (55%), Gaps = 9/196 (4%)
 Frame = +2

Query: 671  VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKR 850
            +CQV+DC ADL+ AKDYHRRHKVCE+H K TKALVGN MQRFCQQCSRFH L EFD+GKR
Sbjct: 186  MCQVDDCRADLTNAKDYHRRHKVCEIHGKTTKALVGNQMQRFCQQCSRFHPLSEFDEGKR 245

Query: 851  SCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILANMHSNRGNSTEDQDL 1030
            SCRRRLAGHN+RRRKTQP  V +                   +L     N  N T  QD+
Sbjct: 246  SCRRRLAGHNRRRRKTQPTDVASQ-----------------LLLPGNQENAANRT--QDI 286

Query: 1031 LSHLLKSLASQGALSG---------DKSISGILNESSNLLNNGPAFRDSDMISALISNGS 1183
            ++ +      QG+  G         DK     +    N +NNG +   S    A+  N S
Sbjct: 287  VNLITVIARLQGSNVGKLPSIPPIPDKDNLVQIISKINSINNGNSASKSPPSEAVDLNAS 346

Query: 1184 QAPSRPKEQPCTFCFQ 1231
             +  +   Q  T  F+
Sbjct: 347  HSQQQDSVQRTTNGFE 362



>gb:AP004324_1840165 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1215_E11.
          Length = 475

 Score =  129 bits (325), Expect = 1e-28
 Identities = 58/101 (57%), Positives = 73/101 (72%)
 Frame = +2

Query: 611 TLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQ 790
           T   T+ KK+K+S  ++  + CQVE C  DLS A++YHR+HKVCE HSKA K +V  + +
Sbjct: 159 TCPSTVVKKMKVSQQSTQSSYCQVEGCKVDLSSAREYHRKHKVCEAHSKAPKVIVSGLER 218

Query: 791 RFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETV 913
           RFCQQCSRFH L EFD  K+SCRRRL+ HN RRRK Q E +
Sbjct: 219 RFCQQCSRFHGLAEFDQKKKSCRRRLSDHNARRRKPQQEAI 259



>gb:AY779340_1628294 Gossypium hirsutum SBP transcription factor
           mRNA, complete cds.
          Length = 169

 Score =  128 bits (322), Expect = 3e-28
 Identities = 61/101 (60%), Positives = 73/101 (72%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CG DLS AK YHRRHKVCE+H+KA   +V  + QRFCQQCSRFH L EFD+ KRS
Sbjct: 42  CQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRS 101

Query: 854 CRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLK 976
           CRRRLAGHN+RRRK+  E   +S+    S   G ++ + LK
Sbjct: 102 CRRRLAGHNERRRKSSAE---SSSAAESSNRRGMMISAQLK 139



>gb:AY084312_1569404 Arabidopsis thaliana clone 10375 mRNA, complete
           sequence.
          Length = 131

 Score =  128 bits (322), Expect = 3e-28
 Identities = 56/81 (69%), Positives = 66/81 (81%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           TS+  VCQVE C AD+SKAK YH+RHKVC+ H+KA    +  + QRFCQQCSRFHAL EF
Sbjct: 48  TSSSGVCQVESCTADISKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEF 107

Query: 836 DDGKRSCRRRLAGHNKRRRKT 898
           D+ KRSCRRRLAGHN+RRRK+
Sbjct: 108 DEAKRSCRRRLAGHNERRRKS 128



>pir|T52597|T52597 squamosa promoter binding protein 3 [imported] -
           Arabidopsis thaliana>gb:ATH011627_1551935 Arabidopsis
           thaliana (ecotype Columbia) spl3 gene, exons
           1-2.>gb:ATH011633_1551941 Arabidopsis thaliana (ecotype
           Landsberg erecta) mRNA for squamosa promoter binding
           protein-like 3.>gb:ATSPL3_1554167 A.thaliana mRNA for
           squamosa-promoter binding protein like
           3.>gb:BT005443_1638383 Arabidopsis thaliana clone U50647
           putative squamosa-promoter binding protein (At2g33810)
           mRNA, complete cds.>gb:U78721_1726457 Arabidopsis
           thaliana chromosome 2 clone T1B8 map TEn5, complete
           sequence.>gb:AK118179_1816171 Arabidopsis thaliana
           At2g33810 mRNA for putative squamosa-promoter binding
           protein, complete cds, clone: RAFL19-50-A02.
          Length = 131

 Score =  128 bits (322), Expect = 3e-28
 Identities = 56/81 (69%), Positives = 66/81 (81%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           TS+  VCQVE C AD+SKAK YH+RHKVC+ H+KA    +  + QRFCQQCSRFHAL EF
Sbjct: 48  TSSSGVCQVESCTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEF 107

Query: 836 DDGKRSCRRRLAGHNKRRRKT 898
           D+ KRSCRRRLAGHN+RRRK+
Sbjct: 108 DEAKRSCRRRLAGHNERRRKS 128



>pir|H84749|H84749 probable squamosa-promoter binding protein
           [imported] - Arabidopsis thaliana>gb:ATH242959_1552081
           Arabidopsis thaliana mRNA for Squamosa promoter binding
           protein-like 3 (SPL3 gene).
          Length = 129

 Score =  128 bits (322), Expect = 3e-28
 Identities = 56/81 (69%), Positives = 66/81 (81%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           TS+  VCQVE C AD+SKAK YH+RHKVC+ H+KA    +  + QRFCQQCSRFHAL EF
Sbjct: 46  TSSSGVCQVESCTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEF 105

Query: 836 DDGKRSCRRRLAGHNKRRRKT 898
           D+ KRSCRRRLAGHN+RRRK+
Sbjct: 106 DEAKRSCRRRLAGHNERRRKS 126



>gb:AF370612_1792395 Arabidopsis thaliana similar to
           squamosa-promoter binding protein 1 isolog gi|1707009
           (F4N2.13) mRNA, complete cds.
          Length = 394

 Score =  127 bits (318), Expect = 8e-28
 Identities = 57/88 (64%), Positives = 66/88 (75%)
 Frame = +2

Query: 632 KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           KK + S   S   +CQV  C  DLS +KDYH+RH+VCE HSK +  +V  + QRFCQQCS
Sbjct: 99  KKSRASNLCSQNPLCQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCS 158

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFDDGKRSCRRRLAGHN+RRRK
Sbjct: 159 RFHFLSEFDDGKRSCRRRLAGHNERRRK 186



>gb:AC008262_1536605 Genomic sequence for Arabidopsis thaliana BAC
           F4N2 from chromosome I, complete sequence.
          Length = 378

 Score =  127 bits (318), Expect = 8e-28
 Identities = 57/88 (64%), Positives = 66/88 (75%)
 Frame = +2

Query: 632 KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           KK + S   S   +CQV  C  DLS +KDYH+RH+VCE HSK +  +V  + QRFCQQCS
Sbjct: 99  KKSRASNLCSQNPLCQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCS 158

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFDDGKRSCRRRLAGHN+RRRK
Sbjct: 159 RFHFLSEFDDGKRSCRRRLAGHNERRRK 186



>pir|T52592|T52592 squamosa-promoter binding protein 6 [imported] -
           Arabidopsis thaliana>gb:AE005173_894528 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018364_1538345 Arabidopsis thaliana
           chromosome 1 BAC F23O10 genomic sequence, complete
           sequence.>gb:ATH011643_1551951 Arabidopsis thaliana
           (ecotype Columbia) mRNA for squamosa promoter binding
           protein-like 6.>gb:ATH011644_1551952 Arabidopsis
           thaliana (ecotype Columbia) spl6 gene, exons
           1-3.>gb:BT006436_1639323 Arabidopsis thaliana At1g69170
           gene, complete cds.
          Length = 405

 Score =  127 bits (318), Expect = 8e-28
 Identities = 57/88 (64%), Positives = 66/88 (75%)
 Frame = +2

Query: 632 KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           KK + S   S   +CQV  C  DLS +KDYH+RH+VCE HSK +  +V  + QRFCQQCS
Sbjct: 110 KKSRASNLCSQNPLCQVYGCSKDLSSSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCS 169

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFDDGKRSCRRRLAGHN+RRRK
Sbjct: 170 RFHFLSEFDDGKRSCRRRLAGHNERRRK 197



>gb:AP005294_1850023 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1679_B08.>gb:AP005647_1855426 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0026E05.
          Length = 387

 Score =  126 bits (317), Expect = 1e-27
 Identities = 57/101 (56%), Positives = 70/101 (69%)
 Frame = +2

Query: 626 IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
           + KK+K++   +    CQVE C  DLS AK YHR+H+VCE HSK  K +V  + +RFCQQ
Sbjct: 161 LAKKVKVAQQNTQNPHCQVEGCNVDLSSAKPYHRKHRVCEPHSKTLKVIVAGLERRFCQQ 220

Query: 806 CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNT 928
           CSRFH L EFD  KRSCRRRL  HN RRRK QPE +  S++
Sbjct: 221 CSRFHGLAEFDQKKRSCRRRLHDHNARRRKPQPEAISLSSS 261



>gb:AMA011623_1819136 Antirrhinum majus mRNA for squamosa promoter
           binding protein-homologue 5, partial.
          Length = 323

 Score =  125 bits (315), Expect = 2e-27
 Identities = 65/117 (55%), Positives = 77/117 (65%), Gaps = 8/117 (6%)
 Frame = +2

Query: 635 KIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSR 814
           K K    T     CQVE C  DLS AK Y+ RHKVC MHSK+ K +V  I QRFCQQCSR
Sbjct: 25  KAKKGKSTGGVVRCQVEGCEVDLSDAKAYYLRHKVCSMHSKSPKVIVAGIEQRFCQQCSR 84

Query: 815 FHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVIN------SNTMNDSQ--ASGYLL 961
           FH L EFD GKRSCRRRLAGHN+RRRK  P ++++      S T+ D+Q    G+L+
Sbjct: 85  FHQLPEFDQGKRSCRRRLAGHNERRRKPSPGSMMSPYYGSLSPTLFDNQNRTGGFLM 141



>pir|T52297|T52297 squamosa promoter binding protein-homolog 5
           [imported] - garden snapdragon (fragment)
          Length = 323

 Score =  125 bits (315), Expect = 2e-27
 Identities = 65/117 (55%), Positives = 77/117 (65%), Gaps = 8/117 (6%)
 Frame = +2

Query: 635 KIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSR 814
           K K    T     CQVE C  DLS AK Y+ RHKVC MHSK+ K +V  I QRFCQQCSR
Sbjct: 25  KAKKGKSTGGVVRCQVEGCEVDLSDAKAYYLRHKVCSMHSKSPKVIVAGIEQRFCQQCSR 84

Query: 815 FHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVIN------SNTMNDSQ--ASGYLL 961
           FH L EFD GKRSCRRRLAGHN+RRRK  P ++++      S T+ D+Q    G+L+
Sbjct: 85  FHQLPEFDQGKRSCRRRLAGHNERRRKPSPGSMMSPYYGSLSPTLFDNQNRTGGFLM 141



>gb:AP005186_1849052 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0430F03.
          Length = 216

 Score =  125 bits (313), Expect = 3e-27
 Identities = 58/93 (62%), Positives = 67/93 (72%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CG DLS+A  Y+RRHKVC+ HSK    LV  + QRFCQQCSRFH L EFDD KRS
Sbjct: 110 CQVERCGVDLSEAGRYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELTEFDDAKRS 169

Query: 854 CRRRLAGHNKRRRKTQPETVINSNTMNDSQASG 952
           CRRRLAGHN+RRRK+  +T    N  +  Q +G
Sbjct: 170 CRRRLAGHNERRRKSAADTAHGENCRHADQDAG 202



>sp|Q38741|SBP1_ANTMA Squamosa-promoter binding protein
           1.>pir|S62360|S62360 squamosa-promoter binding protein 1
           - garden snapdragon>gb:AMSPB1_1819261 A.majus mRNA for
           squamosa-promoter binding protein 1.
          Length = 131

 Score =  124 bits (312), Expect = 4e-27
 Identities = 59/103 (57%), Positives = 71/103 (68%), Gaps = 6/103 (5%)
 Frame = +2

Query: 620 GTIGKKIKLSGPTSNRAV------CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGN 781
           G   KK +   P+  RA       CQVE+C A+++ AK YHRRHKVCE H+KA   L   
Sbjct: 28  GEDSKKTRALTPSGKRASGSTQRSCQVENCAAEMTNAKPYHRRHKVCEFHAKAPVVLHSG 87

Query: 782 IMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPET 910
           + QRFCQQCSRFH L EFD+ KRSCRRRLAGHN+RRRK+  +T
Sbjct: 88  LQQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSHDT 130



>pir|T52299|T52299 squamosa promoter binding protein-homolog 3
           [imported] - garden snapdragon>gb:AMA011621_1819134
           Antirrhinum majus mRNA for squamosa promoter binding
           protein-homologue 3.
          Length = 305

 Score =  124 bits (310), Expect = 7e-27
 Identities = 61/108 (56%), Positives = 71/108 (65%), Gaps = 1/108 (0%)
 Frame = +2

Query: 632 KKIKLSGPTS-NRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQC 808
           ++ +L  P S N   CQ E C ADLS  K YHRRHKVCE HSKA   +   + QRFCQQC
Sbjct: 133 RRSRLLEPGSINAPRCQAEGCNADLSHCKHYHRRHKVCEFHSKAANVVAAGLTQRFCQQC 192

Query: 809 SRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASG 952
           SRFH L EFD+GKRSCRRRLA HN+RRRK+  +     N+   SQ  G
Sbjct: 193 SRFHVLSEFDNGKRSCRRRLADHNRRRRKSSQQANSQENS-GKSQLQG 239



>gb:AMA011622_1819135 Antirrhinum majus mRNA for squamosa promoter
           binding protein-homologue 4, partial.
          Length = 257

 Score =  123 bits (308), Expect = 1e-26
 Identities = 57/82 (69%), Positives = 63/82 (76%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE C  DLS AK Y+ RHKVC MHSK+ K +V  I QRFCQQCSRFH L EFD GKRS
Sbjct: 49  CQVEGCKIDLSDAKAYYSRHKVCGMHSKSPKVIVAGIEQRFCQQCSRFHQLPEFDQGKRS 108

Query: 854 CRRRLAGHNKRRRKTQPETVIN 919
           CRRRLAGHN+RRRK  P + I+
Sbjct: 109 CRRRLAGHNERRRKPPPVSTIS 130



>pir|T52298|T52298 squamosa promoter binding protein-homolog 4
           [imported] - garden snapdragon (fragment)
          Length = 257

 Score =  123 bits (308), Expect = 1e-26
 Identities = 57/82 (69%), Positives = 63/82 (76%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE C  DLS AK Y+ RHKVC MHSK+ K +V  I QRFCQQCSRFH L EFD GKRS
Sbjct: 49  CQVEGCKIDLSDAKAYYSRHKVCGMHSKSPKVIVAGIEQRFCQQCSRFHQLPEFDQGKRS 108

Query: 854 CRRRLAGHNKRRRKTQPETVIN 919
           CRRRLAGHN+RRRK  P + I+
Sbjct: 109 CRRRLAGHNERRRKPPPVSTIS 130



>gb:ATH011632_1551940 Arabidopsis thaliana (ecotype Landsberg
           erecta) mRNA for squamosa promoter binding protein-like
           4, partial.
          Length = 167

 Score =  122 bits (306), Expect = 2e-26
 Identities = 53/80 (66%), Positives = 66/80 (82%)
 Frame = +2

Query: 671 VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKR 850
           +CQV+ C AD+ +AK YHRRHKVCE+H+KA+   +  + QRFCQQCSRFH LQEFD+ KR
Sbjct: 46  LCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKR 105

Query: 851 SCRRRLAGHNKRRRKTQPET 910
           SCRRRLAGHN+RRRK+  E+
Sbjct: 106 SCRRRLAGHNERRRKSSGES 125



>pir|T52599|T52599 squamosa promoter binding protein 4 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 167

 Score =  122 bits (306), Expect = 2e-26
 Identities = 53/80 (66%), Positives = 66/80 (82%)
 Frame = +2

Query: 671 VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKR 850
           +CQV+ C AD+ +AK YHRRHKVCE+H+KA+   +  + QRFCQQCSRFH LQEFD+ KR
Sbjct: 46  LCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKR 105

Query: 851 SCRRRLAGHNKRRRKTQPET 910
           SCRRRLAGHN+RRRK+  E+
Sbjct: 106 SCRRRLAGHNERRRKSSGES 125



>pir|T52600|T52600 squamosa promoter binding protein 4 [imported] -
           Arabidopsis thaliana>gb:AE005173_893215 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC008007_1536396 Genomic sequence for
           Arabidopsis thaliana BAC F12M16 from chromosome I,
           complete sequence.>gb:ATH011630_1551938 Arabidopsis
           thaliana (ecotype Columbia) spl4 gene, exons
           1-2.>gb:ATH011631_1551939 Arabidopsis thaliana (ecotype
           Columbia) mRNA for squamosa promoter binding
           protein-like 4.>gb:AY084902_1569984 Arabidopsis thaliana
           clone 12071 mRNA, complete sequence.>gb:BT002856_1636447
           Arabidopsis thaliana clone RAFL15-05-B10 (R20352)
           putative transcription factor (At1g53160) mRNA, complete
           cds.>gb:BT004391_1637463 Arabidopsis thaliana clone
           U20352 putative transcription factor (At1g53160) mRNA,
           complete cds.
          Length = 174

 Score =  122 bits (306), Expect = 2e-26
 Identities = 53/80 (66%), Positives = 66/80 (82%)
 Frame = +2

Query: 671 VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKR 850
           +CQV+ C AD+ +AK YHRRHKVCE+H+KA+   +  + QRFCQQCSRFH LQEFD+ KR
Sbjct: 53  LCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKR 112

Query: 851 SCRRRLAGHNKRRRKTQPET 910
           SCRRRLAGHN+RRRK+  E+
Sbjct: 113 SCRRRLAGHNERRRKSSGES 132



>gb:AP005816_1858353 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:B1168A08.>gb:AP006049_1860471 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0016N23.
          Length = 417

 Score =  121 bits (304), Expect = 3e-26
 Identities = 55/76 (72%), Positives = 62/76 (81%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CGADLS  K+Y+ RHKVC MHSKA + +V  + QRFCQQCSRFH L EFD GKRS
Sbjct: 104 CQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQGKRS 163

Query: 854 CRRRLAGHNKRRRKTQ 901
           CRRRLAGHN+RRR+ Q
Sbjct: 164 CRRRLAGHNERRRRPQ 179



>gb:AK118174_1816166 Arabidopsis thaliana At1g02065 mRNA for
           putative squamosa promoter binding protein 8 (SPL8),
           complete cds, clone: RAFL19-49-D21.
          Length = 333

 Score =  121 bits (304), Expect = 3e-26
 Identities = 54/85 (63%), Positives = 61/85 (71%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVCE HSKA+  +   + QRFCQQCSRFH L EFD+GKRS
Sbjct: 188 CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS 247

Query: 854 CRRRLAGHNKRRRKTQPETVINSNT 928
           CR+RLA HN+RRRK         +T
Sbjct: 248 CRKRLADHNRRRRKCHQSASATQDT 272



>gb:AY074853_1567705 Arabidopsis thaliana At1g27370/F17L21_16 mRNA,
            complete cds.
          Length = 396

 Score =  121 bits (304), Expect = 3e-26
 Identities = 70/177 (39%), Positives = 91/177 (51%), Gaps = 25/177 (14%)
 Frame = +2

Query: 632  KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
            KK K  G +     CQ++ C  DLS +KDYHR+H+VCE HSK  K +V  + +RFCQQCS
Sbjct: 162  KKTKSCGQSMQVPRCQIDGCELDLSSSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCS 221

Query: 812  RFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA-- 985
            RFHA+ EFD+ KRSCR+RL+ HN RRRK Q    +NS  + D +    +L + L +    
Sbjct: 222  RFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFPLNSERVFDRRQHTSMLWNGLSLNTRS 281

Query: 986  ---------------------NMHSNRGNSTEDQDLLSHLLKSLASQ--GALSGDKS 1087
                                  +   RGN +EDQ      L   A Q  G  S  KS
Sbjct: 282  EEKYTWGTTYETKPTQMESGFTLSFQRGNGSEDQLFTGSTLSFSAFQTSGGFSAGKS 338



>gb:AE005172_891614 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC004557_1531849 Genomic sequence
            for Arabidopsis thaliana BAC F17L21 from chromosome I,
            complete sequence.
          Length = 392

 Score =  121 bits (304), Expect = 3e-26
 Identities = 70/177 (39%), Positives = 91/177 (51%), Gaps = 25/177 (14%)
 Frame = +2

Query: 632  KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
            KK K  G +     CQ++ C  DLS +KDYHR+H+VCE HSK  K +V  + +RFCQQCS
Sbjct: 158  KKTKSCGQSMQVPRCQIDGCELDLSSSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCS 217

Query: 812  RFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA-- 985
            RFHA+ EFD+ KRSCR+RL+ HN RRRK Q    +NS  + D +    +L + L +    
Sbjct: 218  RFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFPLNSERVFDRRQHTSMLWNGLSLNTRS 277

Query: 986  ---------------------NMHSNRGNSTEDQDLLSHLLKSLASQ--GALSGDKS 1087
                                  +   RGN +EDQ      L   A Q  G  S  KS
Sbjct: 278  EEKYTWGTTYETKPTQMESGFTLSFQRGNGSEDQLFTGSTLSFSAFQTSGGFSAGKS 334



>pir|T52596|T52596 squamosa promoter binding protein homolog 10
            [imported] - Arabidopsis thaliana>gb:ATH011636_1551944
            Arabidopsis thaliana (ecotype Columbia) spl10 gene, exons
            1-4.>gb:ATH011637_1551945 Arabidopsis thaliana (ecotype
            Columbia) mRNA for squamosa promoter binding protein-like
            10.>gb:AY142028_1582865 Arabidopsis thaliana
            At1g27370/F17L21_16 mRNA, complete cds.
          Length = 396

 Score =  121 bits (304), Expect = 3e-26
 Identities = 70/177 (39%), Positives = 91/177 (51%), Gaps = 25/177 (14%)
 Frame = +2

Query: 632  KKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
            KK K  G +     CQ++ C  DLS +KDYHR+H+VCE HSK  K +V  + +RFCQQCS
Sbjct: 162  KKTKSCGQSMQVPRCQIDGCELDLSSSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCS 221

Query: 812  RFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA-- 985
            RFHA+ EFD+ KRSCR+RL+ HN RRRK Q    +NS  + D +    +L + L +    
Sbjct: 222  RFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFPLNSERVFDRRQHTSMLWNGLSLNTRS 281

Query: 986  ---------------------NMHSNRGNSTEDQDLLSHLLKSLASQ--GALSGDKS 1087
                                  +   RGN +EDQ      L   A Q  G  S  KS
Sbjct: 282  EEKYTWGTTYETKPTQMESGFTLSFQRGNGSEDQLFTGSTLSFSAFQTSGGFSAGKS 338



>pir|T52594|T52594 squamosa promoter binding protein 8 [imported] -
           Arabidopsis thaliana>gb:ATH011641_1551949 Arabidopsis
           thaliana (ecotype Columbia) spl8 gene, exons
           1-3.>gb:ATH011642_1551950 Arabidopsis thaliana (ecotype
           Columbia) mRNA for squamosa promoter binding
           protein-like 8.
          Length = 333

 Score =  121 bits (304), Expect = 3e-26
 Identities = 54/85 (63%), Positives = 61/85 (71%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVCE HSKA+  +   + QRFCQQCSRFH L EFD+GKRS
Sbjct: 188 CQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRS 247

Query: 854 CRRRLAGHNKRRRKTQPETVINSNT 928
           CR+RLA HN+RRRK         +T
Sbjct: 248 CRKRLADHNRRRRKCHQSASATQDT 272



>gb:AY084609_1569697 Arabidopsis thaliana clone 113229 mRNA,
           complete sequence.
          Length = 336

 Score =  121 bits (303), Expect = 4e-26
 Identities = 50/86 (58%), Positives = 65/86 (75%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           T+   +C V+ C +D S  ++YH+RHKVC++HSK     +    QRFCQQCSRFHAL+EF
Sbjct: 72  TNQMPICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEF 131

Query: 836 DDGKRSCRRRLAGHNKRRRKTQPETV 913
           D+GKRSCR+RL GHN+RRRK QPE +
Sbjct: 132 DEGKRSCRKRLDGHNRRRRKPQPEHI 157



>gb:AB023037_1515381 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MFB16.>gb:AB025619_1516415 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MBA10.>gb:AK117475_1815508 Arabidopsis thaliana
           At5g50670 mRNA for unknown protein, complete cds, clone:
           RAFL17-08-M12.
          Length = 359

 Score =  121 bits (303), Expect = 4e-26
 Identities = 50/86 (58%), Positives = 65/86 (75%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           T+   +C V+ C +D S  ++YH+RHKVC++HSK     +    QRFCQQCSRFHAL+EF
Sbjct: 95  TNQMPICLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEF 154

Query: 836 DDGKRSCRRRLAGHNKRRRKTQPETV 913
           D+GKRSCR+RL GHN+RRRK QPE +
Sbjct: 155 DEGKRSCRKRLDGHNRRRRKPQPEHI 180



>gb:AJ628864_1812643 Arabidopsis thaliana mRNA for putative
           squamosa-promoter binding protein (At2g42200 gene).
          Length = 378

 Score =  120 bits (302), Expect = 6e-26
 Identities = 63/112 (56%), Positives = 70/112 (62%), Gaps = 13/112 (11%)
 Frame = +2

Query: 617 DGTIGKKIKLSGPTSNRAV-------------CQVEDCGADLSKAKDYHRRHKVCEMHSK 757
           DG  G     SG  SNR V             CQVE CG DL+ AK Y+ RH+VC +HSK
Sbjct: 42  DGGGGSGSSSSGGRSNRRVRGGGSGQSGQIPRCQVEGCGMDLTNAKGYYSRHRVCGVHSK 101

Query: 758 ATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETV 913
             K  V  I QRFCQQCSRFH L EFD  KRSCRRRLAGHN+RRRK QP ++
Sbjct: 102 TPKVTVAGIEQRFCQQCSRFHQLPEFDLEKRSCRRRLAGHNERRRKPQPASL 153



>gb:AY046007_1561500 Arabidopsis thaliana putative squamosa-promoter
           binding protein (At2g42200) mRNA, complete cds.
          Length = 374

 Score =  120 bits (302), Expect = 6e-26
 Identities = 63/112 (56%), Positives = 70/112 (62%), Gaps = 13/112 (11%)
 Frame = +2

Query: 617 DGTIGKKIKLSGPTSNRAV-------------CQVEDCGADLSKAKDYHRRHKVCEMHSK 757
           DG  G     SG  SNR V             CQVE CG DL+ AK Y+ RH+VC +HSK
Sbjct: 42  DGGGGSGSSSSGGRSNRRVRGGGSGQSGQIPRCQVEGCGMDLTNAKGYYSRHRVCGVHSK 101

Query: 758 ATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETV 913
             K  V  I QRFCQQCSRFH L EFD  KRSCRRRLAGHN+RRRK QP ++
Sbjct: 102 TPKVTVAGIEQRFCQQCSRFHQLPEFDLEKRSCRRRLAGHNERRRKPQPASL 153



>pir|T52598|T52598 squamosa-promoter binding protein 11 [imported] -
            Arabidopsis thaliana>gb:ATH011634_1551942 Arabidopsis
            thaliana (ecotype Columbia) spl11 gene, exons
            1-4.>gb:ATH011635_1551943 Arabidopsis thaliana (ecotype
            Columbia) mRNA for squamosa promoter binding protein-like
            11.>gb:AY070106_1566745 Arabidopsis thaliana putative
            squamosa-promoter binding protein 2 (At1g27360) mRNA,
            complete cds.>gb:AY088185_1573207 Arabidopsis thaliana
            clone 42666 mRNA, complete sequence.>gb:AY091286_1574492
            Arabidopsis thaliana putative squamosa-promoter binding
            protein 2 (At1g27360) mRNA, complete cds.
          Length = 393

 Score =  120 bits (302), Expect = 6e-26
 Identities = 79/233 (33%), Positives = 110/233 (47%), Gaps = 37/233 (15%)
 Frame = +2

Query: 626  IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
            +  K KL G +     CQ++ C  DLS AK YHR+HKVCE HSK  K  V  + +RFCQQ
Sbjct: 159  VAGKSKLCGQSMPVPRCQIDGCELDLSSAKGYHRKHKVCEKHSKCPKVSVSGLERRFCQQ 218

Query: 806  CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
            CSRFHA+ EFD+ KRSCR+RL+ HN RRRK Q    +N   + D +    +L + + + A
Sbjct: 219  CSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFSMNPERVYDRRQHTNMLWNGVSLNA 278

Query: 986  ------------------------NMHSNRGNSTEDQDLL--SHLLKSLASQGALSGDKS 1087
                                     +   RGN +EDQ +   S +  +  + G     KS
Sbjct: 279  RSEEMYEWGNNTYDTKPRQTEKSFTLSFQRGNGSEDQLVASSSRMFSTSQTSGGFPAGKS 338

Query: 1088 -----------ISGILNESSNLLNNGPAFRDSDMISALISNGSQAPSRPKEQP 1213
                        SG+L+ES          +D     +L+S  S   ++P  QP
Sbjct: 339  KFQLHGEDVGEYSGVLHES----------QDIHRALSLLSTSSDPLAQPHVQP 381



>pir|B86399|B86399 protein F17L21.14 [imported] - Arabidopsis
            thaliana>gb:AE005172_891613 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC004557_1531848 Genomic sequence for
            Arabidopsis thaliana BAC F17L21 from chromosome I,
            complete sequence.
          Length = 389

 Score =  120 bits (302), Expect = 6e-26
 Identities = 79/233 (33%), Positives = 110/233 (47%), Gaps = 37/233 (15%)
 Frame = +2

Query: 626  IGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQ 805
            +  K KL G +     CQ++ C  DLS AK YHR+HKVCE HSK  K  V  + +RFCQQ
Sbjct: 155  VAGKSKLCGQSMPVPRCQIDGCELDLSSAKGYHRKHKVCEKHSKCPKVSVSGLERRFCQQ 214

Query: 806  CSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILA 985
            CSRFHA+ EFD+ KRSCR+RL+ HN RRRK Q    +N   + D +    +L + + + A
Sbjct: 215  CSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQGVFSMNPERVYDRRQHTNMLWNGVSLNA 274

Query: 986  ------------------------NMHSNRGNSTEDQDLL--SHLLKSLASQGALSGDKS 1087
                                     +   RGN +EDQ +   S +  +  + G     KS
Sbjct: 275  RSEEMYEWGNNTYDTKPRQTEKSFTLSFQRGNGSEDQLVASSSRMFSTSQTSGGFPAGKS 334

Query: 1088 -----------ISGILNESSNLLNNGPAFRDSDMISALISNGSQAPSRPKEQP 1213
                        SG+L+ES          +D     +L+S  S   ++P  QP
Sbjct: 335  KFQLHGEDVGEYSGVLHES----------QDIHRALSLLSTSSDPLAQPHVQP 377



>pir|T52593|T52593 squamosa promoter binding protein homolog 9
           [imported] - Arabidopsis thaliana>gb:ATH011639_1551947
           Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for
           squamosa promoter binding protein-like 9.
          Length = 373

 Score =  120 bits (302), Expect = 6e-26
 Identities = 63/112 (56%), Positives = 70/112 (62%), Gaps = 13/112 (11%)
 Frame = +2

Query: 617 DGTIGKKIKLSGPTSNRAV-------------CQVEDCGADLSKAKDYHRRHKVCEMHSK 757
           DG  G     SG  SNR V             CQVE CG DL+ AK Y+ RH+VC +HSK
Sbjct: 42  DGGGGSGSSSSGGRSNRRVRGGGSGQSGQIPRCQVEGCGMDLTNAKGYYSRHRVCGVHSK 101

Query: 758 ATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETV 913
             K  V  I QRFCQQCSRFH L EFD  KRSCRRRLAGHN+RRRK QP ++
Sbjct: 102 TPKVTVAGIEQRFCQQCSRFHQLPEFDLEKRSCRRRLAGHNERRRKPQPASL 153



>pir|T00929|T00929 squamosa-promoter binding protein 9 [imported] -
           Arabidopsis thaliana>gb:AC002561_1530893 Arabidopsis
           thaliana chromosome 2 BAC T24P15 genomic sequence,
           complete sequence.>gb:ATH011638_1551946 Arabidopsis
           thaliana (ecotype Columbia) mRNA for squamosa promoter
           binding protein-like 9.>gb:ATH011640_1551948 Arabidopsis
           thaliana (ecotype Columbia) spl9 gene, exons
           1-3.>gb:AY150378_1584943 Arabidopsis thaliana putative
           squamosa-promoter binding protein (At2g42200) mRNA,
           complete cds.
          Length = 375

 Score =  120 bits (302), Expect = 6e-26
 Identities = 63/112 (56%), Positives = 70/112 (62%), Gaps = 13/112 (11%)
 Frame = +2

Query: 617 DGTIGKKIKLSGPTSNRAV-------------CQVEDCGADLSKAKDYHRRHKVCEMHSK 757
           DG  G     SG  SNR V             CQVE CG DL+ AK Y+ RH+VC +HSK
Sbjct: 42  DGGGGSGSSSSGGRSNRRVRGGGSGQSGQIPRCQVEGCGMDLTNAKGYYSRHRVCGVHSK 101

Query: 758 ATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPETV 913
             K  V  I QRFCQQCSRFH L EFD  KRSCRRRLAGHN+RRRK QP ++
Sbjct: 102 TPKVTVAGIEQRFCQQCSRFHQLPEFDLEKRSCRRRLAGHNERRRKPQPASL 153



>gb:AP005529_1853552 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 455

 Score =  120 bits (301), Expect = 7e-26
 Identities = 53/94 (56%), Positives = 67/94 (71%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           C V+ C  DLSK +DYHRRHKVCE HSK    +V     RFCQQCSRFH LQEFD+ KRS
Sbjct: 118 CAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQQCSRFHLLQEFDEAKRS 177

Query: 854 CRRRLAGHNKRRRKTQPETVINSNTMNDSQASGY 955
           CR+RL GHN+RRRK QP+ + +++ +   Q + +
Sbjct: 178 CRKRLDGHNRRRRKPQPDPMNSASYLASQQGARF 211



>gb:ATH242960_1552082 Arabidopsis thaliana mRNA for Squamosa
           promoter binding protein-like 5, (SPL5 gene).
          Length = 138

 Score =  120 bits (301), Expect = 7e-26
 Identities = 53/88 (60%), Positives = 71/88 (80%), Gaps = 3/88 (3%)
 Frame = +2

Query: 641 KLSGPTSNRA---VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           ++ GP+++R    +CQV+ C  +L++AK Y+RRH+VCE+H+KA+ A V  + QRFCQQCS
Sbjct: 49  RVRGPSTDRVPSRLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCS 108

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFD+ KRSCRRRLAGHN+RRRK
Sbjct: 109 RFHELPEFDEAKRSCRRRLAGHNERRRK 136



>pir|T52567|T52567 squamosa promoter binding protein-like 5
           [imported] - Arabidopsis thaliana (fragment)
          Length = 138

 Score =  120 bits (301), Expect = 7e-26
 Identities = 53/88 (60%), Positives = 71/88 (80%), Gaps = 3/88 (3%)
 Frame = +2

Query: 641 KLSGPTSNRA---VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           ++ GP+++R    +CQV+ C  +L++AK Y+RRH+VCE+H+KA+ A V  + QRFCQQCS
Sbjct: 49  RVRGPSTDRVPSRLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCS 108

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFD+ KRSCRRRLAGHN+RRRK
Sbjct: 109 RFHELPEFDEAKRSCRRRLAGHNERRRK 136



>pir|T52607|T52607 squamosa promoter binding protein 5 [imported] -
           Arabidopsis thaliana>gb:ATH011609_1551927 Arabidopsis
           thaliana (ecotype Columbia) spl5 gene, exons
           1-2.>gb:ATH011610_1551928 Arabidopsis thaliana (ecotype
           Landsberg erecta) mRNA for squamosa promoter binding
           protein-like 5.>gb:BT003714_1636913 Arabidopsis thaliana
           At3g15270 mRNA, complete cds.>gb:AK118611_1816579
           Arabidopsis thaliana At3g15270 mRNA for squamosa
           promoter binding protein-like 5, putative, complete cds,
           clone: RAFL19-86-N19.>gb:AP000413_1820070 Arabidopsis
           thaliana genomic DNA, chromosome 3, TAC clone: K7L4.
          Length = 181

 Score =  120 bits (301), Expect = 7e-26
 Identities = 53/88 (60%), Positives = 71/88 (80%), Gaps = 3/88 (3%)
 Frame = +2

Query: 641 KLSGPTSNRA---VCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           ++ GP+++R    +CQV+ C  +L++AK Y+RRH+VCE+H+KA+ A V  + QRFCQQCS
Sbjct: 49  RVRGPSTDRVPSRLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCS 108

Query: 812 RFHALQEFDDGKRSCRRRLAGHNKRRRK 895
           RFH L EFD+ KRSCRRRLAGHN+RRRK
Sbjct: 109 RFHELPEFDEAKRSCRRRLAGHNERRRK 136



>gb:OSJN00090_1694724 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0071I13, complete sequence.
          Length = 416

 Score =  119 bits (299), Expect = 1e-25
 Identities = 57/93 (61%), Positives = 67/93 (72%), Gaps = 1/93 (1%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALV-GNIMQRFCQQCSRFHALQEFDDGKR 850
           CQ E C ADLS AK YHRRHKVCE HSKA   +  G + QRFCQQCSRFH L EFDD K+
Sbjct: 185 CQAEGCKADLSSAKRYHRRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKK 244

Query: 851 SCRRRLAGHNKRRRKTQPETVINSNTMNDSQAS 949
           SCR+RLA HN+RRRK++P    +S     +QA+
Sbjct: 245 SCRKRLADHNRRRRKSKPSDGEHSGEKRRAQAN 277



>pir|T52604|T52604 squamosa promoter binding protein 2 [imported] -
           Arabidopsis thaliana>gb:ATH011625_1551933 Arabidopsis
           thaliana (ecotype Landsberg erecta) mRNA for squamosa
           promoter binding protein-like 2.
          Length = 425

 Score =  118 bits (296), Expect = 3e-25
 Identities = 51/77 (66%), Positives = 59/77 (76%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE C  DLS AKDYHR+H++CE HSK  K +V  + +RFCQQCSRFH L EFD+ KRS
Sbjct: 172 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRS 231

Query: 854 CRRRLAGHNKRRRKTQP 904
           CRRRL+ HN RRRK  P
Sbjct: 232 CRRRLSDHNARRRKPNP 248



>pir|T52603|T52603 squamosa promoter binding protein 2 [imported] -
           Arabidopsis thaliana>gb:AB017070_1513482 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MNL12.>gb:ATH011624_1551932 Arabidopsis thaliana
           (ecotype Columbia) spl2 gene, exons
           1-5.>gb:ATH011626_1551934 Arabidopsis thaliana (ecotype
           Columbia) mRNA for squamosa promoter binding
           protein-like 2.
          Length = 419

 Score =  118 bits (296), Expect = 3e-25
 Identities = 51/77 (66%), Positives = 59/77 (76%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE C  DLS AKDYHR+H++CE HSK  K +V  + +RFCQQCSRFH L EFD+ KRS
Sbjct: 169 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRS 228

Query: 854 CRRRLAGHNKRRRKTQP 904
           CRRRL+ HN RRRK  P
Sbjct: 229 CRRRLSDHNARRRKPNP 245



>sp|O04003|LG1_MAIZE LIGULELESS1 protein.>pir|T04328|T04328
           liguleless1 protein - maize>gb:ZMU89496_1732246 Zea mays
           liguleless1 protein (liguleless1) mRNA, complete
           cds.>gb:AF451895_1800832 Zea mays LIGULELESS1 (lg1)
           gene, complete cds.
          Length = 399

 Score =  117 bits (294), Expect = 5e-25
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALV-GNIMQRFCQQCSRFHALQEFDDGKR 850
           CQ E C ADLS AK YHRRHKVCE HSKA   +  G + QRFCQQCSRFH L EFDD K+
Sbjct: 185 CQAEGCKADLSSAKRYHRRHKVCEHHSKAPVVVTAGGLHQRFCQQCSRFHLLDEFDDAKK 244

Query: 851 SCRRRLAGHNKRRRKTQP 904
           SCR+RLA HN+RRRK++P
Sbjct: 245 SCRKRLADHNRRRRKSKP 262



>pir|T46014|T46014 squamosa promoter-binding protein homolog -
           Arabidopsis thaliana>gb:ATT10K17_1554259 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T10K17.>gb:AY086384_1571433 Arabidopsis thaliana clone
           247919 mRNA, complete sequence.
          Length = 354

 Score =  117 bits (292), Expect = 8e-25
 Identities = 55/87 (63%), Positives = 64/87 (73%)
 Frame = +2

Query: 656 TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEF 835
           +S  A CQVE C  DLS  K Y+ RHKVC +HSK++K +V  + QRFCQQCSRFH L EF
Sbjct: 53  SSTTARCQVEGCRMDLSNVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQCSRFHQLSEF 112

Query: 836 DDGKRSCRRRLAGHNKRRRKTQPETVI 916
           D  KRSCRRRLA HN+RRRK QP T +
Sbjct: 113 DLEKRSCRRRLACHNERRRKPQPTTAL 139



>sp|Q38740|SBP2_ANTMA Squamosa-promoter binding protein
           2.>pir|S62361|S62361 squamosa-promoter binding protein 2
           - garden snapdragon>gb:AMSBP2_1819260 A.majus mRNA for
           squamosa-promoter binding protein 2.
          Length = 171

 Score =  116 bits (291), Expect = 1e-24
 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = +2

Query: 620 GTIGKKIKLSGP-TSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRF 796
           G  G+K   SG     +  C VE+CGADL   K Y++RH+VCE+H+KA    V  +MQRF
Sbjct: 66  GKSGEKHTASGGGVVAQPCCLVENCGADLRNCKKYYQRHRVCEVHAKAPVVSVEGLMQRF 125

Query: 797 CQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRKTQPET 910
           CQQCSRFH L EFD  KRSCRRRLAGHN+RRRK+  E+
Sbjct: 126 CQQCSRFHDLSEFDQTKRSCRRRLAGHNERRRKSSLES 163



>gb:ZMA011616_1731428 Zea mays mRNA for SBP-domain protein 3.
          Length = 435

 Score =  116 bits (290), Expect = 1e-24
 Identities = 56/85 (65%), Positives = 62/85 (72%)
 Frame = +2

Query: 668 AVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGK 847
           A CQ E C ADLS AK YHRRHKVCE H+KA+    G   QRFCQQCSRFH L EFD+ K
Sbjct: 193 ARCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVATGGKQQRFCQQCSRFHVLSEFDEVK 252

Query: 848 RSCRRRLAGHNKRRRKTQPETVINS 922
           RSCR+RLA HN+RRRK  P T  +S
Sbjct: 253 RSCRKRLAEHNRRRRK--PPTTASS 275



>gb:OSJN00060_1694105 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0010H02, complete
           sequence.>gb:OSJN00201_1696628 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0034G17, complete
           sequence.
          Length = 360

 Score =  115 bits (288), Expect = 2e-24
 Identities = 50/75 (66%), Positives = 59/75 (78%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE C   L   K+YHRRHKVCE+H+KA + +V    QRFCQQCSRFH L EFDD K+S
Sbjct: 108 CQVEGCDITLQGVKEYHRRHKVCEVHAKAPRVVVHGTEQRFCQQCSRFHVLAEFDDAKKS 167

Query: 854 CRRRLAGHNKRRRKT 898
           CRRRLAGHN+RRR++
Sbjct: 168 CRRRLAGHNERRRRS 182



>gb:BPE558183_1634075 Betula pendula mRNA for squamosa promoter
           binding like-protein (spl1 gene).>gb:BPE558184_1634076
           Betula pendula spl1 gene for squamosa promoter binding
           like-protein and putative promoter region.
          Length = 134

 Score =  115 bits (288), Expect = 2e-24
 Identities = 52/83 (62%), Positives = 62/83 (74%)
 Frame = +2

Query: 659 SNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFD 838
           S    CQVE+C ADL+ AK YHRRHKVCE H+KA    V    +RFCQQCSRFH L EFD
Sbjct: 45  STPPTCQVENCNADLTDAKHYHRRHKVCESHAKAPIVYVAGGQKRFCQQCSRFHDLSEFD 104

Query: 839 DGKRSCRRRLAGHNKRRRKTQPE 907
           + K+SCR+RLAGHN+RRRK+  +
Sbjct: 105 EYKKSCRKRLAGHNERRRKSSSD 127



>gb:AP004838_1845761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0504A05.
          Length = 458

 Score =  113 bits (283), Expect = 9e-24
 Identities = 50/74 (67%), Positives = 55/74 (74%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVC+ H+KA   L     QRFCQQCSRFH L EFD+ KRS
Sbjct: 197 CQAEGCKADLSAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRS 256

Query: 854 CRRRLAGHNKRRRK 895
           CR+RL  HN+RRRK
Sbjct: 257 CRKRLTEHNRRRRK 270



>gb:ZMA011617_1731429 Zea mays mRNA for SBP-domain protein 4.
          Length = 424

 Score =  113 bits (283), Expect = 9e-24
 Identities = 54/83 (65%), Positives = 60/83 (72%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVCE H+KA+        QRFCQQCSRFH L EFD+ KRS
Sbjct: 179 CQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAANGKQQRFCQQCSRFHVLSEFDEVKRS 238

Query: 854 CRRRLAGHNKRRRKTQPETVINS 922
           CR+RLA HN+RRRK  P T  +S
Sbjct: 239 CRKRLAEHNRRRRK--PATTASS 259



>gb:ZMA011614_1731426 Zea mays mRNA for SBP-domain protein 1.
          Length = 440

 Score =  112 bits (281), Expect = 2e-23
 Identities = 50/74 (67%), Positives = 55/74 (74%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVCE H+KA+        QRFCQQCSRFH L EFD+ KRS
Sbjct: 211 CQAEGCKADLSAAKHYHRRHKVCEYHAKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRS 270

Query: 854 CRRRLAGHNKRRRK 895
           CR+RL  HN+RRRK
Sbjct: 271 CRKRLTEHNRRRRK 284



>gb:ZMA011615_1731427 Zea mays mRNA for SBP-domain protein 2.
          Length = 445

 Score =  112 bits (279), Expect = 3e-23
 Identities = 49/74 (66%), Positives = 55/74 (74%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQ E C ADLS AK YHRRHKVCE H+KA+        QRFCQQCSRFH L EFD+ KRS
Sbjct: 215 CQAEGCKADLSAAKHYHRRHKVCEFHTKASAVAAAGKQQRFCQQCSRFHVLAEFDEAKRS 274

Query: 854 CRRRLAGHNKRRRK 895
           CR+RL  HN+RRR+
Sbjct: 275 CRKRLTEHNRRRRR 288



>gb:AP005772_1857598 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0073A21.
          Length = 234

 Score =  111 bits (278), Expect = 3e-23
 Identities = 50/78 (64%), Positives = 57/78 (73%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CG +L   KDYHR+H+VCE HSK  + +V    +RFCQQCSRFHAL EFD  KRS
Sbjct: 68  CQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRS 127

Query: 854 CRRRLAGHNKRRRKTQPE 907
           CRRRL  HN RRRK Q +
Sbjct: 128 CRRRLYDHNARRRKPQTD 145



>gb:AP005772_1857597 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0073A21.
          Length = 251

 Score =  111 bits (278), Expect = 3e-23
 Identities = 50/78 (64%), Positives = 57/78 (73%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CG +L   KDYHR+H+VCE HSK  + +V    +RFCQQCSRFHAL EFD  KRS
Sbjct: 68  CQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRS 127

Query: 854 CRRRLAGHNKRRRKTQPE 907
           CRRRL  HN RRRK Q +
Sbjct: 128 CRRRLYDHNARRRKPQTD 145



>gb:ZMA011619_1731431 Zea mays mRNA for SBP-domain protein 6,
           partial.
          Length = 367

 Score =  108 bits (269), Expect = 4e-22
 Identities = 49/71 (69%), Positives = 52/71 (73%)
 Frame = +2

Query: 692 GADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLA 871
           G DLS  K Y+ RHKVC MHSK  +  V  I QRFCQQCSRFH L EFD GKRSCRRRL 
Sbjct: 1   GVDLSAVKQYYCRHKVCNMHSKEPRVFVAGIEQRFCQQCSRFHQLHEFDQGKRSCRRRLI 60

Query: 872 GHNKRRRKTQP 904
           GHN+RRRK  P
Sbjct: 61  GHNERRRKPPP 71



>gb:ZMA011618_1731430 Zea mays mRNA for SBP-domain protein 5,
           partial.
          Length = 329

 Score =  106 bits (264), Expect = 1e-21
 Identities = 49/80 (61%), Positives = 59/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query: 668 AVCQVEDCGADLSKAKD-YHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDG 844
           A CQV+ C  DL+  K  Y+ RHKVC+MHSK  + LV  + QRFCQQCSRFH L EFD  
Sbjct: 8   ARCQVDGCNVDLTDVKPAYYCRHKVCKMHSKEPRVLVNGLEQRFCQQCSRFHQLPEFDQL 67

Query: 845 KRSCRRRLAGHNKRRRKTQP 904
           K+SCR+RLAGHN+RRR+  P
Sbjct: 68  KKSCRKRLAGHNERRRRPPP 87



>gb:AP005760_1857399 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:B1047G05.
          Length = 439

 Score =  104 bits (260), Expect = 4e-21
 Identities = 61/158 (38%), Positives = 79/158 (50%), Gaps = 13/158 (8%)
 Frame = +2

Query: 674  CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS-------------R 814
            CQ E C ADLS AK YHRRHKVCE H+KA+        QRFCQQCS             R
Sbjct: 181  CQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRIVTLWVYVHVLDR 240

Query: 815  FHALQEFDDGKRSCRRRLAGHNKRRRKTQPETVINSNTMNDSQASGYLLMSLLKILANMH 994
            FH L EFD+ KRSCR+RLA HN+RRRK             D+ A+         + A   
Sbjct: 241  FHVLTEFDEAKRSCRKRLAEHNRRRRKPAAAATTAVAAAKDAAAA--------PVAAGKK 292

Query: 995  SNRGNSTEDQDLLSHLLKSLASQGALSGDKSISGILNE 1108
             + G +T       +++   A++  +S + S+   L E
Sbjct: 293  PSGGAATSYTGDNKNVVSMSAAKSPISSNTSVISCLPE 330



>gb:AP004744_1844237 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0065C04.
          Length = 343

 Score =  104 bits (260), Expect = 4e-21
 Identities = 46/78 (58%), Positives = 57/78 (73%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQVE CG +L   K+Y+R+H+VCE H+K  + +V    +RFCQQCSRFHA  EFD  KRS
Sbjct: 67  CQVEGCGLELGGYKEYYRKHRVCEPHTKCLRVVVAGQDRRFCQQCSRFHAPSEFDQEKRS 126

Query: 854 CRRRLAGHNKRRRKTQPE 907
           CRRRL+ HN RRRK Q +
Sbjct: 127 CRRRLSDHNARRRKPQTD 144



>gb:ATH011611_1551929 Arabidopsis thaliana (ecotype Landsberg
           erecta) mRNA for squamosa promoter binding protein-like
           7, partial.
          Length = 377

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 47/103 (45%), Positives = 69/103 (66%)
 Frame = +2

Query: 587 PSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATK 766
           P  D++L+  D  + KK ++ G  S  A CQV DC AD+S+ K YH+RH+VC   + A+ 
Sbjct: 112 PELDQKLE--DAELPKKKRVRGG-SGVARCQVPDCEADISELKGYHKRHRVCLRCANASF 168

Query: 767 ALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRK 895
            ++    +R+CQQC +FH L +FD+GKRSCRR+L  HN RR++
Sbjct: 169 VVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKR 211



>pir|T52606|T52606 squamosa promoter binding protein 7 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 377

 Score = 97.4 bits (241), Expect = 7e-19
 Identities = 47/103 (45%), Positives = 69/103 (66%)
 Frame = +2

Query: 587 PSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATK 766
           P  D++L+  D  + KK ++ G  S  A CQV DC AD+S+ K YH+RH+VC   + A+ 
Sbjct: 112 PELDQKLE--DAELPKKKRVRGG-SGVARCQVPDCEADISELKGYHKRHRVCLRCANASF 168

Query: 767 ALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRK 895
            ++    +R+CQQC +FH L +FD+GKRSCRR+L  HN RR++
Sbjct: 169 VVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKR 211



>gb:AY078050_1568019 Arabidopsis thaliana AT5g18830/F17K4_80 mRNA,
           complete cds.
          Length = 789

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 47/103 (45%), Positives = 69/103 (66%)
 Frame = +2

Query: 587 PSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATK 766
           P  D++L+  D  + KK ++ G  S  A CQV DC AD+S+ K YH+RH+VC   + A+ 
Sbjct: 100 PELDQKLE--DAELPKKKRVRGG-SGVARCQVPDCEADISELKGYHKRHRVCLRCATASF 156

Query: 767 ALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRK 895
            ++    +R+CQQC +FH L +FD+GKRSCRR+L  HN RR++
Sbjct: 157 VVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKR 199



>gb:AY063815_1565765 Arabidopsis thaliana putative squamosa promoter
           binding protein 7 (At5g18830) mRNA, complete cds.
          Length = 775

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 47/103 (45%), Positives = 69/103 (66%)
 Frame = +2

Query: 587 PSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATK 766
           P  D++L+  D  + KK ++ G  S  A CQV DC AD+S+ K YH+RH+VC   + A+ 
Sbjct: 112 PELDQKLE--DAELPKKKRVRGG-SGVARCQVPDCEADISELKGYHKRHRVCLRCATASF 168

Query: 767 ALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRK 895
            ++    +R+CQQC +FH L +FD+GKRSCRR+L  HN RR++
Sbjct: 169 VVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKR 211



>pir|T52605|T52605 squamosa promoter binding protein 7 [imported] -
           Arabidopsis thaliana>gb:ATH011612_1551930 Arabidopsis
           thaliana (ecotype Columbia) mRNA for squamosa promoter
           binding protein-like 7.>gb:ATH011613_1551931 Arabidopsis
           thaliana (ecotype Columbia) spl7 gene, exons
           1-10.>gb:AF367355_1791806 Arabidopsis thaliana
           AT5g18830/F17K4_80 mRNA, complete cds.
          Length = 801

 Score = 97.1 bits (240), Expect = 9e-19
 Identities = 47/103 (45%), Positives = 69/103 (66%)
 Frame = +2

Query: 587 PSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATK 766
           P  D++L+  D  + KK ++ G  S  A CQV DC AD+S+ K YH+RH+VC   + A+ 
Sbjct: 112 PELDQKLE--DAELPKKKRVRGG-SGVARCQVPDCEADISELKGYHKRHRVCLRCATASF 168

Query: 767 ALVGNIMQRFCQQCSRFHALQEFDDGKRSCRRRLAGHNKRRRK 895
            ++    +R+CQQC +FH L +FD+GKRSCRR+L  HN RR++
Sbjct: 169 VVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKR 211



>gb:AY484394_1608307 Chlamydomonas reinhardtii copper responsive
           regulator 1 gene, complete cds.
          Length = 1182

 Score = 94.0 bits (232), Expect = 7e-18
 Identities = 39/82 (47%), Positives = 55/82 (67%)
 Frame = +2

Query: 650 GPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQ 829
           G  +   VCQV  CG DL+  K+YH+R+++C++H K  + L    +QRFCQQC RFH L 
Sbjct: 381 GDDTGAMVCQVPGCGKDLTNLKEYHQRYRICDVHIKLQQVLKDGRLQRFCQQCGRFHDLT 440

Query: 830 EFDDGKRSCRRRLAGHNKRRRK 895
            FD  ++SCR +L+ HN RRR+
Sbjct: 441 AFDGNRKSCRDQLSKHNARRRR 462



>gb:AC137620_1743671 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0014K18, complete
           sequence.>gb:AC137928_1743830 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0040B10, complete
           sequence.
          Length = 842

 Score = 92.8 bits (229), Expect = 2e-17
 Identities = 40/88 (45%), Positives = 56/88 (63%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFHALQEFDDGKRS 853
           CQV  C AD+ + K YHRRH+VC   + A   ++  + +R+CQQC +FH L +FD+ KRS
Sbjct: 171 CQVPGCEADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRS 230

Query: 854 CRRRLAGHNKRRRKTQPETVINSNTMND 937
           CRR+L  HNKRRR+      I    ++D
Sbjct: 231 CRRKLERHNKRRRRKPDSKGILEKDIDD 258



>gb:AP005772_1857599 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0073A21.
          Length = 114

 Score = 67.8 bits (164), Expect = 6e-10
 Identities = 28/47 (59%), Positives = 34/47 (72%)
 Frame = +2

Query: 674 CQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSR 814
           CQVE CG +L   KDYHR+H+VCE HSK  + +V    +RFCQQCSR
Sbjct: 68  CQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSR 114



>gb:ZMA011620_1731432 Zea mays mRNA for SBP-domain protein 7,
           partial.
          Length = 131

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 33/78 (42%), Positives = 42/78 (53%)
 Frame = +2

Query: 578 RRFPSNDRELQTLDGTIGKKIKLSGPTSNRAVCQVEDCGADLSKAKDYHRRHKVCEMHSK 757
           R  P   R  +   G  G  +  + P      C V+ C ADL+ AK Y+ RHKVCEMHSK
Sbjct: 59  RAAPGGGRRGRAAAGGAGPSLPPAPPR-----CLVDGCNADLTDAKTYYCRHKVCEMHSK 113

Query: 758 ATKALVGNIMQRFCQQCS 811
             + +V  +  RFCQQCS
Sbjct: 114 EPRVVVNGLELRFCQQCS 131



>gb:BA000009_1632225 Beta vulgaris subsp. vulgaris mitochondrial
           genomic DNA, complete sequence.
          Length = 102

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 26/50 (52%), Positives = 33/50 (66%)
 Frame = +2

Query: 662 NRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCS 811
           N   C V+ C +DL++ ++YHRRHKVCE HSK    LVG    +FCQ CS
Sbjct: 25  NPVFCSVDGCASDLNQCREYHRRHKVCERHSKTPVVLVGGKKPQFCQHCS 74



>gb:CR382138_1671769 Debaryomyces hansenii chromosome F of strain
            CBS767 of Debaryomyces hansenii.
          Length = 605

 Score = 34.7 bits (78), Expect = 5.2
 Identities = 27/109 (24%), Positives = 50/109 (45%), Gaps = 7/109 (6%)
 Frame = +2

Query: 824  LQEFDDGKRSCRRRLAGHNKRRRKTQPETVI-------NSNTMNDSQASGYLLMSLLKIL 982
            L  +++ K   R+   GHN +RRKT+ ET+        +    +  +  G L   +  ++
Sbjct: 203  LDTYEEQKSKKRKVPKGHNVKRRKTKRETISVHDEDQESRQDKSSKEVVGDLREQVNLLI 262

Query: 983  ANMHSNRGNSTEDQDLLSHLLKSLASQGALSGDKSISGILNESSNLLNN 1129
            +N   N  N T+ +   S ++KS  S+        I+ + N+   +LNN
Sbjct: 263  SNTIINNQNFTDKEK--SMMIKSFFSRFIKDYKGIINTVANQQKMVLNN 309



>gb:CP000013_869742 Borrelia garinii PBi, complete genome.
          Length = 2162

 Score = 33.9 bits (76), Expect = 8.9
 Identities = 24/77 (31%), Positives = 42/77 (54%)
 Frame = -2

Query: 1326 FQQKTY*LVFEKMKLAYLQLRHHAHPILSLASWKQKVQGCSLGLEGA*DPFEIKADIISE 1147
            +Q+K+Y  + +K+ LA L+++   + IL++           +GLE   D FEIKA+ I  
Sbjct: 1556 WQEKSYSAIEKKISLAELEIKSFENDILNV----------KIGLESFKDSFEIKAEEIFG 1605

Query: 1146 SLKAGPLFSKFEDSFRI 1096
            +L++     KFE S  +
Sbjct: 1606 NLQSEA--KKFEQSVNL 1620



>gb:BX571660_778667 Wolinella succinogenes, complete genome; segment
            4/7.
          Length = 377

 Score = 33.9 bits (76), Expect = 8.9
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 3/77 (3%)
 Frame = -2

Query: 1323 QQKTY*LVFEKMKLAYLQLRHHAHP---ILSLASWKQKVQGCSLGLEGA*DPFEIKADII 1153
            Q++   L+FE  K     + HH      ++S+ +   K+     G+EG  D   +   I+
Sbjct: 138  QERIRSLLFESKKELIRLIAHHWRQPLNVISITAENIKLNLDERGIEGHEDTHHLADKIV 197

Query: 1152 SESLKAGPLFSKFEDSF 1102
            +ESL+   + S+F D+F
Sbjct: 198  TESLRLSRVISRFSDTF 214



>pir|JU0096|SXBPT4 NAD+-protein ADP-ribosyltransferase (EC 2.4.2.-)
            precursor - phage T4
          Length = 685

 Score = 33.9 bits (76), Expect = 8.9
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 1067 ALSGDKSISGILNESSNLLNNGPAFRDSDMISALISNGSQAPSRPKE 1207
            ++S DK+  G++N S NL+  G     +D ++ ++  GS APS   E
Sbjct: 530  SVSIDKTDEGLVNSSDNLVGIGWVITGADKVNVVLPGGSLAPSNEME 576



>sp|P12726|ALT_BPT4 NAD--protein ADP-ribosyltransferase (EC 2.4.2.-)
            (Alt protein).>gb:AF158101_1490638 Enterobacteria phage
            T4, complete genome.>gb:MYT4ALT_1506794 Bacteriophage T4
            alt gene.
          Length = 682

 Score = 33.9 bits (76), Expect = 8.9
 Identities = 16/47 (34%), Positives = 27/47 (57%)
 Frame = +2

Query: 1067 ALSGDKSISGILNESSNLLNNGPAFRDSDMISALISNGSQAPSRPKE 1207
            ++S DK+  G++N S NL+  G     +D ++ ++  GS APS   E
Sbjct: 530  SVSIDKTDEGLVNSSDNLVGIGWVITGADKVNVVLPGGSLAPSNEME 576


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,611,448,829
Number of Sequences: 1806583
Number of extensions: 35216915
Number of successful extensions: 95701
Number of sequences better than 10.0: 80
Number of HSP's better than 10.0 without gapping: 88855
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 95602
length of database: 581,917,975
effective HSP length: 129
effective length of database: 348,868,768
effective search space used: 126988231552
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)