BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3263
         (625 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q96372|CC48_CAPAN|CC48_CAPAN Cell division cycle protein 48 homolog.>gb:...   327   1e-88   Capsicum annuum
sp|P54609|C48A_ARATH|C48A_ARATH Cell division control protein 48 homolog A ...   317   1e-85   Arabidopsis thaliana [mouse-ear cress]
sp|P54774|CC48_SOYBN|CC48_SOYBN Cell division cycle protein 48 homolog (Val...   317   1e-85   Glycine max [soybeans]
pir|T48355|T48355 transitional endoplasmic reticulum ATPase - Ar...   315   3e-85   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LZF6|C48E_ARATH|C48E_ARATH Cell division control protein 48 homolog E ...   315   3e-85   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SCN8|C48D_ARATH|C48D_ARATH Putative cell division control protein 48 h...   311   6e-84   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022789 Oryza sativa (japonica cultivar-group) chrom...   303   2e-81   
gb:DDU83085_1377439 Dictyostelium discoideum cell division cycle...   275   6e-73   
gb:AY576993_2538237 Danio rerio clone RK103A4E09 valosin-contain...   268   7e-71   
gb:AB093594_2464541 Danio rerio CDC48 mRNA, partial cds.              268   7e-71   
gb:AJ719285_2501472 Gallus gallus mRNA for hypothetical protein,...   267   9e-71   
sp|P23787|TERA_XENLA|TERA_XENLA Transitional endoplasmic reticulum ATPase (...   266   2e-70   Xenopus laevis [clawed frog]
gb:BC074716_2558209 Xenopus tropicalis valosin-containing protei...   266   2e-70   
gb:BC046949_2549816 Xenopus laevis valosin containing protein, m...   265   4e-70   
gb:CQ871266_1454667 Sequence 35 from Patent WO2004078112.             265   4e-70   
gb:CQ871264_1454666 Sequence 33 from Patent WO2004078112.             265   4e-70   
gb:AK028264_1160892 Mus musculus 13 days embryo head cDNA, RIKEN...   265   4e-70   
sp|P46462|TERA_RAT|TERA_RAT Transitional endoplasmic reticulum ATPase (TE...   265   4e-70   Rattus norvegicus [brown rat]
sp|Q01853|TERA_MOUSE|TERA_MOUSE Transitional endoplasmic reticulum ATPase (...   265   4e-70   Mus musculus [mouse]
sp|P55072|TERA_HUMAN|TERA_HUMAN Transitional endoplasmic reticulum ATPase (...   265   4e-70   Homo sapiens [man]
gb:AK030751_1162162 Mus musculus 8 days embryo whole body cDNA, ...   264   8e-70   
pir|A26360|VPPG transitional endoplasmic reticulum ATPase - pig       263   1e-69   
sp|P03974|TERA_PIG|TERA_PIG Transitional endoplasmic reticulum ATPase (TE...   263   1e-69   Sus scrofa [pigs]
gb:AY190939_1308792 Drosophila erecta clone DERF01_42_I03 (D1420...   248   8e-65   
gb:AF047037_1236368 Drosophila melanogaster transitional endopla...   244   8e-64   
gb:AE013599_1130969 Drosophila melanogaster chromosome 2R, compl...   244   8e-64   
gb:CR380956_1652393 Candida glabrata strain CBS138 chromosome J ...   241   9e-63   
sp|P25694|CC48_YEAST|CC48_YEAST Cell division control protein 48.>pir|S6766...   239   2e-62   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382132_1665450 Yarrowia lipolytica chromosome F of strain C...   237   1e-61   
gb:CR382126_1658601 Kluyveromyces lactis strain NRRL Y-1140 chro...   233   1e-60   
gb:CR382139_1672673 Debaryomyces hansenii chromosome G of strain...   231   7e-60   
gb:AF202034_1250622 Drosophila melanogaster endoplasmic reticulu...   229   2e-59   
gb:AY080962_1568575 Aspergillus fumigatus Mvp1p (25d9-1), Nha1p ...   229   4e-59   
gb:AE016819_1748993 Ashbya gossypii (= Eremothecium gossypii) AT...   228   8e-59   
gb:SPAC1565_1716556 S.pombe chromosome I cosmid c1565.                224   1e-57   
sp|Q9P3A7|CC48_SCHPO|CC48_SCHPO Cell division cycle protein 48 homolog.          224   1e-57   Schizosaccharomyces pombe
gb:AE017350_1759207 Cryptococcus neoformans var. neoformans JEC2...   223   2e-57   
sp|P54811|TER1_CAEEL|TER1_CAEEL Transitional endoplasmic reticulum ATPase h...   222   3e-57   Caenorhabditis elegans [roundworm]
sp|P54812|TER2_CAEEL|TER2_CAEEL Transitional endoplasmic reticulum ATPase h...   213   3e-54   Caenorhabditis elegans [roundworm]
gb:CR382400_1375018 Plasmodium falciparum chromosome 6, complete...   212   5e-54   
gb:AF044488_1236083 Trypanosoma brucei valosin-containing protei...   201   6e-51   
gb:AF313485S1_1896369 Homo sapiens tissue-type kidney valosin-co...   195   6e-49   
pir|H90135|H90135 cell division cycle protein 48 homolog [import...   192   4e-48   Guillardia theta
gb:AP005158_1848406 Oryza sativa (japonica cultivar-group) genom...   189   4e-47   
gb:AF199367_1250057 Entamoeba histolytica cdc48-like protein gen...   185   5e-46   
gb:AK083821_1174079 Mus musculus 12 days embryo spinal ganglion ...   174   8e-43   
gb:AF083704_1766935 Arabidopsis thaliana clone sps248 unknown mRNA.   170   2e-41   
gb:CNS06C8G_1372721 chromosome I of strain GB-M1 of Encephalitoz...    89   8e-17   
sp|P46468|CDAT_PLAF7|CDAT_PLAF7 Putative cell division cycle ATPase.>gb:PFM...    71   1e-11   Plasmodium falciparum
gb:PFACDCATP_1393665 Plasmodium falciparum hypothetical cell div...    53   4e-06   
gb:AE011061_268826 Methanosarcina acetivorans str. C2A, section ...    50   3e-05   
gb:BX957219_843429 Methanococcus maripaludis S2 complete genome;...    49   5e-05   
gb:AE013270_290777 Methanosarcina mazei strain Goe1, section 52 ...    49   5e-05   
gb:AE009780_255584 Pyrobaculum aerophilum strain IM2 section 35 ...    49   7e-05   
gb:AE009915_257349 Pyrobaculum aerophilum strain IM2 section 170...    49   9e-05   
pir|A69086|A69086 cell division control protein Cdc48 - Methanob...    48   2e-04   Methanothermobacter thermautotrophicus str. Delta H
gb:AE013356_291586 Methanosarcina mazei strain Goe1, section 138...    45   8e-04   
gb:AE011179_269850 Methanosarcina acetivorans str. C2A, section ...    45   8e-04   
pir|B72479|B72479 probable transitional endoplasmic reticulum AT...    44   0.003   Aeropyrum pernix
gb:AE017199_403295 Nanoarchaeum equitans Kin4-M, complete genome.      43   0.004   
sp|Q07590|SAV_SULAC|SAV_SULAC SAV protein.>pir|S43859|S43859 ATPase - Sulf...    42   0.008   Sulfolobus acidocaldarius
sp|Q58556|YB56_METJA|YB56_METJA Cell division cycle protein 48 homolog MJ11...    41   0.014   Methanocaldococcus jannaschii
gb:AE010343_262118 Methanopyrus kandleri AV19 section 42 of 157 ...    41   0.019   
gb:AY596297_632911 Haloarcula marismortui ATCC 43049 chromosome ...    39   0.070   
gb:BC007562_1970813 Homo sapiens valosin-containing protein, mRN...    38   0.12    
sp|Q9HPF0|CDCH_HALN1|CDCH_HALN1 CdcH protein.>pir|C84319|C84319 cell divisi...    37   0.20    Halobacterium sp.
sp|P46464|CDCH_HALSA|CDCH_HALSA CdcH protein.>pir|S47018|S47018 cdcH protei...    37   0.27    Halobacterium salinarum
gb:BA000023_690939 Sulfolobus tokodaii str. 7 DNA, complete genome.    37   0.35    
pir|S25345|S25345 probable membrane protein YCR089w - yeast (Sac...    36   0.46    Saccharomyces cerevisiae [brewer's yeast]
gb:BA000011_665417 Thermoplasma volcanium GSS1 DNA, complete gen...    36   0.60    
gb:AY596297_632243 Haloarcula marismortui ATCC 43049 chromosome ...    36   0.60    
sp|P25653|FIG2_YEAST|FIG2_YEAST Factor induced gene 2 precursor (Cell wall ...    36   0.60    Saccharomyces cerevisiae [brewer's yeast]
gb:AE014185_937649 Plasmodium falciparum 3D7 chromosome 10 compl...    35   0.78    
gb:AP006841_572173 Bacteroides fragilis YCH46 DNA, complete genome.    35   0.78    
gb:AE005154_64024 Halobacterium sp. NRC-1 plasmid pNRC200 sectio...    34   1.7     
gb:AJ627420_527875 Uncultured crenarchaeote genomic fragment 6a13.     34   2.3     
sp|O05209|VAT_THEAC|VAT_THEAC VCP-like ATPase.>pir|T37458|T37458 VCP-like ...    33   3.9     Thermoplasma acidophilum
gb:HSA238221_2000696 Homo sapiens RPC62 gene for RNA polymerase ...    33   5.0     
gb:BC004424_1969262 Homo sapiens polymerase (RNA) III (DNA direc...    33   5.0     
gb:DOR489284_1381265 Drepanosiphum oregonensis partial lw-Rh gen...    33   5.0     
gb:CP000013_869950 Borrelia garinii PBi, complete genome.              33   5.0     
pir|D71680|D71680 ribonuclease E (rne) RP256 - Rickettsia prowaz...    33   5.0     Rickettsia prowazekii
sp|Q9BUI4|RPC3_HUMAN|RPC3_HUMAN DNA-directed RNA polymerase III 62 kDa poly...    33   5.0     Homo sapiens [man]
gb:AE010640_265250 Fusobacterium nucleatum subsp. nucleatum ATCC...    32   6.6     
gb:AF445798_1271685 Taenia asiatica mitochondrion, complete genome.    32   8.6     
gb:AF314223_1261654 Hymenolepis diminuta mitochondrion, complete...    32   8.6     
gb:BX569691_775849 Synechococcus sp. WH8102 complete genome; seg...    32   8.6     


>sp|Q96372|CC48_CAPAN Cell division cycle protein 48
           homolog.>gb:CACAFP_1644846 C.annuum mRNA for CDC48p-like
           protein.
          Length = 805

 Score =  327 bits (837), Expect = 1e-88
 Identities = 162/188 (86%), Positives = 171/188 (90%)
 Frame = +3

Query: 60  MSHQAEXXXXXXXXXXXXXAILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGD 239
           M+ QAE             AILERKKA NRLVVDEA+NDDNSVVALHPATMEKLQLFRGD
Sbjct: 1   MTDQAESSDSKNAKKDFSTAILERKKAANRLVVDEAVNDDNSVVALHPATMEKLQLFRGD 60

Query: 240 TILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVH 419
           TILIKGKKRKDTVVIALADETC+E KIRMNKVVRSNLRVRL DVVSVHQCPDVKYGKRVH
Sbjct: 61  TILIKGKKRKDTVVIALADETCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH 120

Query: 420 ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCV 599
           ILPIDDTIEG+TGDLF+++LKPYFLEAYRPLRKGD+FL+RGGMRSVEFKVIETDPGEYCV
Sbjct: 121 ILPIDDTIEGLTGDLFDAFLKPYFLEAYRPLRKGDNFLVRGGMRSVEFKVIETDPGEYCV 180

Query: 600 VAPDTEIF 623
           VAPDTEIF
Sbjct: 181 VAPDTEIF 188



>sp|P54609|C48A_ARATH Cell division control protein 48 homolog A
           (AtCDC48a).>pir|S60112|S60112 transitional endoplasmic
           reticulum ATPase - Arabidopsis
           thaliana>gb:ATAC015985_1543576 Arabidopsis thaliana
           chromosome III BAC F8A24 genomic sequence, complete
           sequence.>gb:ATU37587_1556939 Arabidopsis thaliana cell
           division cycle protein (CDC48) mRNA, complete
           cds.>gb:AY065076_1566230 Arabidopsis thaliana putative
           transitional endoplasmic reticulum ATPase (F8A24.11)
           mRNA, complete cds.>gb:AY094434_1575734 Arabidopsis
           thaliana AT3g09840/F8A24_11 mRNA, complete cds.
          Length = 809

 Score =  317 bits (812), Expect = 1e-85
 Identities = 154/169 (91%), Positives = 164/169 (97%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AILERKK+PNRLVVDEAINDDNSVV+LHPATMEKLQLFRGDTILIKGKKRKDTV IALAD
Sbjct: 19  AILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALAD 78

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           ETCEE KIRMNKVVRSNLRVRL DV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct: 79  ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY 138

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+RKGD FL+RGGMRSVEFKVIETDP EYCVVAPDTEIF
Sbjct: 139 LKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIF 187



>sp|P54774|CC48_SOYBN Cell division cycle protein 48 homolog
           (Valosin containing protein homolog)
           (VCP).>pir|T06409|T06409 valosin-containing protein -
           soybean>gb:GMU20213_1680623 Glycine max
           valosin-containing protein mRNA, complete cds.
          Length = 807

 Score =  317 bits (811), Expect = 1e-85
 Identities = 155/188 (82%), Positives = 166/188 (88%)
 Frame = +3

Query: 60  MSHQAEXXXXXXXXXXXXXAILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGD 239
           MS Q E             AILERKK+PNRLVVDEA+NDDNSVV +HP TMEKLQLFRGD
Sbjct: 1   MSQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGD 60

Query: 240 TILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVH 419
           TILIKGKKRKDT+ IALADE CEE KIRMNKVVRSNLRVRL DVVSVHQCPDVKYGKRVH
Sbjct: 61  TILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH 120

Query: 420 ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCV 599
           ILPIDDTIEGVTG+LF+++LKPYFLEAYRP+RKGD FL+RGGMRSVEFKV+ETDPGEYCV
Sbjct: 121 ILPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVVETDPGEYCV 180

Query: 600 VAPDTEIF 623
           VAPDTEIF
Sbjct: 181 VAPDTEIF 188



>pir|T48355|T48355 transitional endoplasmic reticulum ATPase -
           Arabidopsis thaliana>gb:ATF12E4_1548347 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F12E4 (ESSA
           project).
          Length = 843

 Score =  315 bits (808), Expect = 3e-85
 Identities = 153/169 (90%), Positives = 163/169 (96%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AILERKK+PNRLVVDEAINDDNSVV+LHP TMEKLQLFRGDTILIKGKKRKDTV IALAD
Sbjct: 52  AILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIALAD 111

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           ETCEE KIRMNKVVRSNLRVRL DV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct: 112 ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY 171

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+RKGD FL+RGGMRSVEFKVIETDP EYCVVAPDTEIF
Sbjct: 172 LKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIF 220



>sp|Q9LZF6|C48E_ARATH Cell division control protein 48 homolog E
           (AtCDC48e) (Transitional endoplasmic reticulum ATPase
           E).>gb:BT006485_1639372 Arabidopsis thaliana At5g03340
           gene, complete cds.>gb:AK117125_1815172 Arabidopsis
           thaliana At5g03340 mRNA for putative transitional
           endoplasmic reticulum ATPase, complete cds, clone:
           RAFL16-66-D01.>gb:AK118571_1816540 Arabidopsis thaliana
           At5g03340 mRNA for putative transitional endoplasmic
           reticulum ATPase, complete cds, clone: RAFL19-80-L03.
          Length = 810

 Score =  315 bits (808), Expect = 3e-85
 Identities = 153/169 (90%), Positives = 163/169 (96%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AILERKK+PNRLVVDEAINDDNSVV+LHP TMEKLQLFRGDTILIKGKKRKDTV IALAD
Sbjct: 19  AILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIALAD 78

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           ETCEE KIRMNKVVRSNLRVRL DV+SVHQCPDVKYGKRVHILP+DDT+EGVTG+LF++Y
Sbjct: 79  ETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLFDAY 138

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+RKGD FL+RGGMRSVEFKVIETDP EYCVVAPDTEIF
Sbjct: 139 LKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIF 187



>sp|Q9SCN8|C48D_ARATH Putative cell division control protein 48
           homolog D (AtCDC48d) (Transitional endoplasmic reticulum
           ATPase D).>pir|T46169|T46169 CDC48-like protein -
           Arabidopsis thaliana>gb:ATT4D2_1556024 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T4D2.
          Length = 815

 Score =  311 bits (797), Expect = 6e-84
 Identities = 152/188 (80%), Positives = 167/188 (88%)
 Frame = +3

Query: 60  MSHQAEXXXXXXXXXXXXXAILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGD 239
           M++QAE             AILE+KKA NRLVVDEAINDDNSVV+LHP TMEKLQLFRGD
Sbjct: 1   MANQAESSDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD 60

Query: 240 TILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVH 419
           TILIKGKKRKDTV IALADETC+E KIRMNKVVRSNLRVRL DV+SVHQCPDVKYG RVH
Sbjct: 61  TILIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH 120

Query: 420 ILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCV 599
           ILP+DDTIEGV+G++F++YLKPYFLEAYRP+RKGD FL+RGGMRS+EFKVIETDP EYCV
Sbjct: 121 ILPLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSIEFKVIETDPAEYCV 180

Query: 600 VAPDTEIF 623
           VAPDTEIF
Sbjct: 181 VAPDTEIF 188



>gb:AE016959_1022789 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752608
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 817

 Score =  303 bits (775), Expect = 2e-81
 Identities = 145/169 (85%), Positives = 159/169 (94%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AILERKK+PNRLVVDEA NDDNSVVALHP TME+LQLFRGDT+L+KGKKRKDT+ I LAD
Sbjct: 22  AILERKKSPNRLVVDEATNDDNSVVALHPDTMERLQLFRGDTVLLKGKKRKDTICIVLAD 81

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           ETCEE KIRMNKVVR NLRVRL DVVSVHQC DVKYGKRVHILPIDDT+EG+TG+LF+++
Sbjct: 82  ETCEEPKIRMNKVVRKNLRVRLGDVVSVHQCQDVKYGKRVHILPIDDTVEGITGNLFDAF 141

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+RKGD FL+RGGMRSVEFKVIETDP EYC+VAPDTEIF
Sbjct: 142 LKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPTEYCIVAPDTEIF 190



>gb:DDU83085_1377439 Dictyostelium discoideum cell division cycle
           protein 48 (cdcD) mRNA, complete cds.
          Length = 793

 Score =  275 bits (702), Expect = 6e-73
 Identities = 129/167 (77%), Positives = 153/167 (91%)
 Frame = +3

Query: 120 ILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADE 299
           ILERKKAPNRL V+EAINDDNSVV L+P TM++LQ FRGDT+LIKGKKR+DTV I L+D 
Sbjct: 15  ILERKKAPNRLFVEEAINDDNSVVTLNPETMDQLQFFRGDTLLIKGKKRRDTVCIVLSDP 74

Query: 300 TCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYL 479
           T + +KIRMNKVVR+NLRVRL D++SVHQC DVKYGKR+H+LPIDDTIEG++G+LF+ YL
Sbjct: 75  TIDPSKIRMNKVVRNNLRVRLGDMISVHQCSDVKYGKRIHVLPIDDTIEGLSGNLFDLYL 134

Query: 480 KPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           KPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDPGEYC+VAP+T I
Sbjct: 135 KPYFLEAYRPVRKGDLFLVRGGMRAVEFKVVETDPGEYCIVAPETFI 181



>gb:AY576993_2538237 Danio rerio clone RK103A4E09 valosin-containing
           protein mRNA, complete cds.>gb:BC050488_2550372 Danio
           rerio valosin containing protein, mRNA (cDNA clone
           MGC:56043 IMAGE:3820156), complete
           cds.>gb:BC067384_2554716 Danio rerio valosin containing
           protein, mRNA (cDNA clone MGC:77072 IMAGE:6960180),
           complete cds.
          Length = 806

 Score =  268 bits (684), Expect = 7e-71
 Identities = 121/168 (72%), Positives = 151/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDE+IN+DNSVV+L  A M++LQLFRGDT+L+KGKKR++TV I L+D
Sbjct: 15  AILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + K+RMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:AB093594_2464541 Danio rerio CDC48 mRNA, partial cds.
          Length = 806

 Score =  268 bits (684), Expect = 7e-71
 Identities = 121/168 (72%), Positives = 151/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDE+IN+DNSVV+L  A M++LQLFRGDT+L+KGKKR++TV I L+D
Sbjct: 15  AILKQKNRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRRETVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + K+RMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKVRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:AJ719285_2501472 Gallus gallus mRNA for hypothetical protein,
           clone 1c3.
          Length = 806

 Score =  267 bits (683), Expect = 9e-71
 Identities = 122/168 (72%), Positives = 150/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L  A M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase (TER
           ATPase) (15S Mg(2+)- ATPase p97
           subunit).>pir|S19738|S19738 transitional endoplasmic
           reticulum ATPase (EC 3.6.1.-) 97K chain - African clawed
           frog>gb:XLP9715S_2583040 X.laevis mRNA for p97 subunit
           of 15S Mg(2+)-ATPase.
          Length = 805

 Score =  266 bits (681), Expect = 2e-70
 Identities = 122/168 (72%), Positives = 150/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDE+IN+DNSVV+L  A M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKRVH+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRVHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:BC074716_2558209 Xenopus tropicalis valosin-containing protein,
           mRNA (cDNA clone MGC:69484 IMAGE:5336248), complete cds.
          Length = 805

 Score =  266 bits (680), Expect = 2e-70
 Identities = 121/168 (72%), Positives = 150/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDE+IN+DNSVV+L  A M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKSRPNRLIVDESINEDNSVVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:BC046949_2549816 Xenopus laevis valosin containing protein, mRNA
           (cDNA clone MGC:52611 IMAGE:5571505), complete cds.
          Length = 805

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 150/168 (89%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDE+IN+DNS+V+L  A M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKSRPNRLIVDESINEDNSMVSLSQAKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKRVH+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRVHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:CQ871266_1454667 Sequence 35 from Patent WO2004078112.
          Length = 806

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:CQ871264_1454666 Sequence 33 from Patent WO2004078112.
          Length = 493

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:AK028264_1160892 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110001E05
           product:valosin containing protein, full insert
           sequence.
          Length = 806

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase (TER
           ATPase) (15S Mg(2+)- ATPase p97 subunit)
           (Valosin-containing protein) (VCP).>pir|A55190|A55190
           transitional endoplasmic reticulum ATPase (EC 3.6.1.-)
           [validated] - rat>gb:BC060518_2104010 Rattus norvegicus
           valosin-containing protein, mRNA (cDNA clone MGC:72335
           IMAGE:5597843), complete cds.>gb:RNU11760_2136855 Rattus
           norvegicus transitional endoplasmic reticulum ATPase
           mRNA, complete cds.
          Length = 806

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase (TER
           ATPase) (15S Mg(2+)- ATPase p97 subunit)
           (Valosin-containing protein) (VCP).>pir|S25197|S25197
           transitional endoplasmic reticulum ATPase -
           mouse>gb:MMVALPRO_2124265 M.musculus mRNA for
           valosin-containing protein.
          Length = 806

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase (TER
           ATPase) (15S Mg(2+)- ATPase p97 subunit)
           (Valosin-containing protein) (VCP).>pir|T02243|T02243
           probable transitional endoplasmic reticulum ATPase -
           human>gb:CQ871268_1454668 Sequence 37 from Patent
           WO2004078112.>gb:CQ871270_1454669 Sequence 39 from
           Patent WO2004078112.>gb:AC004472_1874587 Homo sapiens
           chromosome 9, P1 clone 11659, complete
           sequence.>gb:AF100752_1883045 Homo sapiens transitional
           endoplasmic reticulum ATPase mRNA, complete
           cds.>gb:AL353795_1923125 Human DNA sequence from clone
           RP11-182N22 on chromosome 9 Contains a novel gene, the
           VCP gene for valosin-containing protein, the FANCG gene
           for Fanconi anemia, complementation group G (FAG,
           XRCC9), the gene for phosphatidylinositol glycan class O
           (PIGO), a novel gene, the STOML2 gene for stomatin
           (EPB72)-like 2 (SLP-2), a novel gene (KIAA1539)
           (FLJ11560), a zinc finger protein pseudogene, the 5' end
           of the UNC13 gene for unc-13-like (C. elegans) (hmunc13)
           and nine CpG islands, complete
           sequence.>gb:BC043053_2098790 Mus musculus valosin
           containing protein, mRNA (cDNA clone MGC:57954
           IMAGE:6418662), complete cds.>gb:BC049114_2099929 Mus
           musculus valosin containing protein, mRNA (cDNA clone
           MGC:61308 IMAGE:6810751), complete
           cds.>gb:BC086039_2564632 Xenopus laevis hypothetical
           LOC495584, mRNA (cDNA clone MGC:98172 IMAGE:7201128),
           complete cds.
          Length = 806

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/168 (72%), Positives = 149/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:AK030751_1162162 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730519N02
           product:valosin containing protein, full insert
           sequence.
          Length = 806

 Score =  264 bits (675), Expect = 8e-70
 Identities = 121/168 (72%), Positives = 148/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLYD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>pir|A26360|VPPG transitional endoplasmic reticulum ATPase - pig
          Length = 806

 Score =  263 bits (673), Expect = 1e-69
 Identities = 120/168 (71%), Positives = 148/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRV L DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVHLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase (TER
           ATPase) (15S Mg(2+)- ATPase p97 subunit)
           (Valosin-containing protein) (VCP).>gb:PIGVALA_1443364
           Pig valosin-containing protein (VCP) mRNA, complete cds.
          Length = 806

 Score =  263 bits (673), Expect = 1e-69
 Identities = 120/168 (71%), Positives = 148/168 (88%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++K  PNRL+VDEAIN+DNSVV+L    M++LQLFRGDT+L+KGKKR++ V I L+D
Sbjct: 15  AILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSD 74

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NLRV L DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE Y
Sbjct: 75  DTCSDEKIRMNRVVRNNLRVHLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVY 134

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 135 LKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 182



>gb:AY190939_1308792 Drosophila erecta clone DERF01_42_I03 (D1420)
           genomic sequence.
          Length = 801

 Score =  248 bits (632), Expect = 8e-65
 Identities = 117/169 (69%), Positives = 143/169 (84%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+RK  PNRL+V+EA NDDNSVV+L  A M++LQLFRGDT+++KGK+RK+TV I L+D
Sbjct: 12  AILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSD 71

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NL V L+DVVSV  CPDVKYGKRV ILPIDDT EG+TG+LFE Y
Sbjct: 72  DTCSDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDDTTEGITGNLFEIY 131

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+  GD+F++R  MR VEFKV+ TDP  YC+VAP+T IF
Sbjct: 132 LKPYFLEAYRPIHMGDNFIVRAAMRPVEFKVVLTDPEPYCIVAPETVIF 180



>gb:AF047037_1236368 Drosophila melanogaster transitional
           endoplasmic reticulum ATPase TER94 mRNA, complete cds.
          Length = 801

 Score =  244 bits (623), Expect = 8e-64
 Identities = 115/169 (68%), Positives = 143/169 (84%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+RK  PNRL+V+EA NDDNSVV+L  A M++LQLFRGDT+++KGK+RK+TV I L+D
Sbjct: 12  AILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSD 71

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NL V L+DVVSV  CPDVKYGKRV ILPID++ EGVTG+LFE Y
Sbjct: 72  DTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIY 131

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+  GD+F++R  MR +EFKV+ TDP  YC+VAP+T IF
Sbjct: 132 LKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIF 180



>gb:AE013599_1130969 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003831_1226722 Drosophila melanogaster
           chromosome 2R, section 19 of 74 of the complete
           sequence.>gb:AF132553_1243639 Drosophila melanogaster
           BcDNA.GM02885 (BcDNA.GM02885) mRNA, complete cds.
          Length = 801

 Score =  244 bits (623), Expect = 8e-64
 Identities = 115/169 (68%), Positives = 143/169 (84%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+RK  PNRL+V+EA NDDNSVV+L  A M++LQLFRGDT+++KGK+RK+TV I L+D
Sbjct: 12  AILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSD 71

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NL V L+DVVSV  CPDVKYGKRV ILPID++ EGVTG+LFE Y
Sbjct: 72  DTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIY 131

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYFLEAYRP+  GD+F++R  MR +EFKV+ TDP  YC+VAP+T IF
Sbjct: 132 LKPYFLEAYRPIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIF 180



>gb:CR380956_1652393 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 830

 Score =  241 bits (614), Expect = 9e-63
 Identities = 110/168 (65%), Positives = 142/168 (84%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL RKK  N L+VD+A NDDNSV+A++  TM+KL+LFRGD++L+KGKKRKDTV+I L D
Sbjct: 25  AILRRKKKDNTLIVDDATNDDNSVIAINSNTMDKLELFRGDSVLVKGKKRKDTVLIVLID 84

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  E+   R+N+VVR+NLRVRL D+VS+H CPD+KY  R+ +LPI DTIEG+TG+LF+ Y
Sbjct: 85  DELEDGACRINRVVRNNLRVRLGDLVSIHPCPDIKYASRISVLPIADTIEGITGNLFDVY 144

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGDHF++RGGMR+VEFKV++ +P EY VVA DT I
Sbjct: 145 LKPYFVEAYRPVRKGDHFVVRGGMRAVEFKVVDVEPEEYAVVAQDTII 192



>sp|P25694|CC48_YEAST Cell division control protein
           48.>pir|S67669|S67669 transitional endoplasmic reticulum
           ATPase [validated] - yeast (Saccharomyces
           cerevisiae)>gb:SCCDC48_1706653 S. cerevisiae CDC48 gene
           for cell cycle protein CDC48p.>gb:SCYDL126C_1711694
           S.cerevisiae chromosome IV reading frame ORF YDL126c.
          Length = 835

 Score =  239 bits (611), Expect = 2e-62
 Identities = 109/168 (64%), Positives = 142/168 (84%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL RKK  N L+VD+AINDDNSV+A++  TM+KL+LFRGDT+L+KGKKRKDTV+I L D
Sbjct: 25  AILRRKKKDNMLLVDDAINDDNSVIAINSNTMDKLELFRGDTVLVKGKKRKDTVLIVLID 84

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  E+   R+N+VVR+NLR+RL D+V++H CPD+KY  R+ +LPI DTIEG+TG+LF+ +
Sbjct: 85  DELEDGACRINRVVRNNLRIRLGDLVTIHPCPDIKYATRISVLPIADTIEGITGNLFDVF 144

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGDHF++RGGMR VEFKV++ +P EY VVA DT I
Sbjct: 145 LKPYFVEAYRPVRKGDHFVVRGGMRQVEFKVVDVEPEEYAVVAQDTII 192



>gb:CR382132_1665450 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 814

 Score =  237 bits (604), Expect = 1e-61
 Identities = 112/168 (66%), Positives = 135/168 (80%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL +KK  N LVVD+A NDDNS++ + PATM+ LQLFRGDT+L+KGKKRKDTV+I LAD
Sbjct: 28  AILRKKKKDNALVVDDATNDDNSIICMSPATMDLLQLFRGDTVLVKGKKRKDTVLIVLAD 87

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           E  E+   R+N+ VR NLRVRL DVVSVH CPD+KY  R+  LPI DTIEG+TG LF+ +
Sbjct: 88  EELEDGVCRINRCVRGNLRVRLGDVVSVHPCPDIKYATRISCLPISDTIEGLTGSLFDVF 147

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGD F +RGGMR VEFKV++ DP EY +VA DT I
Sbjct: 148 LKPYFVEAYRPVRKGDLFTVRGGMRQVEFKVVDVDPPEYAIVAQDTVI 195



>gb:CR382126_1658601 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 830

 Score =  233 bits (595), Expect = 1e-60
 Identities = 105/168 (62%), Positives = 140/168 (83%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL RKK  N L+VD+A+NDDNS++A++  TM+ LQLFRGDT+L+KGKKRKDTV+I + D
Sbjct: 25  AILRRKKKQNMLLVDDAVNDDNSIIAINSNTMDLLQLFRGDTVLVKGKKRKDTVLIVMID 84

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  E+   R+N+V+R+NLR+RL D+V++H C D+KY  R+ +LPI DTIEG+TG+LF+ Y
Sbjct: 85  DELEDGVCRVNRVIRNNLRIRLGDLVTIHPCTDIKYASRISVLPIADTIEGLTGNLFDVY 144

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGDHF++RGGMR VEFKV++ +P EY VVA DT I
Sbjct: 145 LKPYFVEAYRPVRKGDHFIVRGGMRQVEFKVVDVEPEEYGVVAQDTVI 192



>gb:CR382139_1672673 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 831

 Score =  231 bits (589), Expect = 7e-60
 Identities = 108/168 (64%), Positives = 134/168 (79%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL RKK  N L+VD+A NDDNSV+ +   TME LQLFRGDT+L+KGKKRKDTV+I LAD
Sbjct: 24  AILRRKKKDNALIVDDAENDDNSVITMSSNTMELLQLFRGDTVLVKGKKRKDTVLIVLAD 83

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  ++   R+N+ VR+NLRVRL D+VS+H CPD+KY  R+ +LPI DT+EG+TG LF+ Y
Sbjct: 84  DDMDDGVARINRCVRNNLRVRLGDIVSIHPCPDIKYANRISVLPIADTVEGITGSLFDVY 143

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGD F +RGGMR VEFKV+E DP E  +VA DT I
Sbjct: 144 LKPYFVEAYRPVRKGDLFTVRGGMRQVEFKVVEVDPEEIAIVAQDTII 191



>gb:AF202034_1250622 Drosophila melanogaster endoplasmic reticulum
           membrane fusion protein (TER94) mRNA, complete cds.
          Length = 799

 Score =  229 bits (585), Expect = 2e-59
 Identities = 109/169 (64%), Positives = 137/169 (81%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+RK  PNRL+V+EA NDDNSVV+L  A M++LQLFRGDT+++KGK+RK+TV I L+D
Sbjct: 12  AILKRKDRPNRLIVEEAQNDDNSVVSLSQAKMDELQLFRGDTVILKGKRRKETVCIVLSD 71

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +TC + KIRMN+VVR+NL V L+DVVSV  CPDVKYGKRV ILPID++ EGVTG+LFE Y
Sbjct: 72  DTCPDEKIRMNRVVRNNLCVHLSDVVSVQSCPDVKYGKRVRILPIDESTEGVTGNLFEIY 131

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           LKPYF      +  GD+F++R  MR +EFKV+ TDP  YC+VAP+T IF
Sbjct: 132 LKPYFPRGLSAIHMGDNFIVRAAMRPIEFKVVLTDPEPYCIVAPETVIF 180



>gb:AY080962_1568575 Aspergillus fumigatus Mvp1p (25d9-1), Nha1p
           (25d9-2), 25D9-9 (25d9-9), 25D9-10 (25d9-10), Ste50p
           (25d9-3), Cdc48p (25d9-4), 25D9-5p (25d9-5), 25D9-11
           (25d9-11), 25D9-6 (25d9-6), Nip7p (25d9-7), Noc3p
           (25d9-8), and 25D9-12 (25d9-12) genes, complete cds.
          Length = 819

 Score =  229 bits (583), Expect = 4e-59
 Identities = 106/168 (63%), Positives = 136/168 (80%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL++KK PN L+V +A+NDDNSV+AL   TME LQLFRGDT+L+KGKKRKDTV+I LAD
Sbjct: 33  AILKKKKKPNSLIVTDAVNDDNSVIALSNNTMETLQLFRGDTVLVKGKKRKDTVLIVLAD 92

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  ++   R+N+VVR NLRV+  D+++VH CPD+KY KR+ +LPI DT+EG+TG LF+ Y
Sbjct: 93  DDLDDGSARINRVVRHNLRVKHGDIITVHPCPDIKYAKRIAVLPIADTVEGLTGSLFDVY 152

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           L PYF EAYRP+++GD F +RGGMR VEFKV+E DP EY +VA DT I
Sbjct: 153 LAPYFREAYRPVKQGDLFTVRGGMRQVEFKVVEVDPPEYGIVAQDTII 200



>gb:AE016819_1748993 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 832

 Score =  228 bits (580), Expect = 8e-59
 Identities = 105/168 (62%), Positives = 137/168 (81%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+RKK  N L+VD+A+ DDNSV+ ++  TM+ LQLFRGDT+L+KGK RKDTV+I L D
Sbjct: 26  AILKRKKKDNYLLVDDAVKDDNSVIVVNSNTMDLLQLFRGDTVLVKGKMRKDTVLIVLLD 85

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +   +   R+N+VVR+NLRVRL D+VS+H CPD+KY +R+ +LPI DTIEG+TG+LF+ Y
Sbjct: 86  DELADGVCRINRVVRNNLRVRLGDLVSIHPCPDIKYAERISVLPIADTIEGLTGNLFDVY 145

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGDHF++RG MR VEFKV+  +P +Y VVA DT I
Sbjct: 146 LKPYFVEAYRPVRKGDHFIVRGSMRQVEFKVVNVEPEDYAVVAQDTII 193



>gb:SPAC1565_1716556 S.pombe chromosome I cosmid c1565.
          Length = 418

 Score =  224 bits (570), Expect = 1e-57
 Identities = 102/168 (60%), Positives = 136/168 (80%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL +K+ PN LVVD+A NDDNSV+ L   TME LQLFRGDT+++KGK+RKDTV+I L D
Sbjct: 35  AILRKKRKPNSLVVDDATNDDNSVITLSSNTMETLQLFRGDTVVVKGKRRKDTVLIVLTD 94

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           E  E+   R+N+VVR+NLRVRL D+V+++ CPD+KY +R+ +LP+ DT+EG+TG LF+ Y
Sbjct: 95  EEMEDGVARINRVVRNNLRVRLGDIVTINPCPDIKYAERISVLPLADTVEGLTGSLFDVY 154

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGD F++RG MR VEFKV++  P E+ +V+ DT I
Sbjct: 155 LKPYFVEAYRPIRKGDLFVVRGSMRQVEFKVVDVAPDEFGIVSQDTII 202



>sp|Q9P3A7|CC48_SCHPO Cell division cycle protein 48 homolog.
          Length = 815

 Score =  224 bits (570), Expect = 1e-57
 Identities = 102/168 (60%), Positives = 136/168 (80%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL +K+ PN LVVD+A NDDNSV+ L   TME LQLFRGDT+++KGK+RKDTV+I L D
Sbjct: 35  AILRKKRKPNSLVVDDATNDDNSVITLSSNTMETLQLFRGDTVVVKGKRRKDTVLIVLTD 94

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           E  E+   R+N+VVR+NLRVRL D+V+++ CPD+KY +R+ +LP+ DT+EG+TG LF+ Y
Sbjct: 95  EEMEDGVARINRVVRNNLRVRLGDIVTINPCPDIKYAERISVLPLADTVEGLTGSLFDVY 154

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYF+EAYRP+RKGD F++RG MR VEFKV++  P E+ +V+ DT I
Sbjct: 155 LKPYFVEAYRPIRKGDLFVVRGSMRQVEFKVVDVAPDEFGIVSQDTII 202



>gb:AE017350_1759207 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 810

 Score =  223 bits (569), Expect = 2e-57
 Identities = 102/168 (60%), Positives = 135/168 (80%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL +K++PNRLVVDE+ +DDNSV  LHP TME L LFRGDTI+++GK+R+DTV+I L+ 
Sbjct: 17  AILRQKRSPNRLVVDESPSDDNSVAILHPNTMEALGLFRGDTIIVRGKRRRDTVLICLSQ 76

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           +  EE K+ MNKV R N  ++L D+V V    D+KYGKR+H+LP  D+IEG++G+LF+ Y
Sbjct: 77  DDIEEGKVAMNKVARGNCAIKLGDLVHVSAANDIKYGKRIHVLPFADSIEGLSGNLFDVY 136

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           L+PYFLEAYRP+RKGD F +RGGMR+V+FKV+E DP  YC+VA +T I
Sbjct: 137 LRPYFLEAYRPVRKGDVFQVRGGMRTVDFKVVEVDPSPYCIVASETVI 184



>sp|P54811|TER1_CAEEL Transitional endoplasmic reticulum ATPase
           homolog 1 (p97/CDC48 homolog 1).>pir|T18970|T18970
           hypothetical protein C06A1.1 - Caenorhabditis
           elegans>gb:CEC06A1_1360076 Caenorhabditis elegans cosmid
           C06A1, complete sequence.
          Length = 809

 Score =  222 bits (566), Expect = 3e-57
 Identities = 101/168 (60%), Positives = 137/168 (81%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+ K  PNRL+VD++  DDNSV+A+  A M++L LFRGD +++KGKKRK++V I ++D
Sbjct: 21  AILKDKVKPNRLIVDQSEQDDNSVIAVSQAKMDELGLFRGDAVILKGKKRKESVAIIVSD 80

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           E+C   K+RMN+VVR+NLR+RL DVVS+   P++ YG R+H+LPIDDTIEG+TG+LF+ +
Sbjct: 81  ESCPNEKVRMNRVVRNNLRIRLGDVVSITPAPNLSYGTRIHVLPIDDTIEGLTGNLFDVF 140

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           LKPYFLEAYRPL KGD F ++  MR+VEFKV+ET+P   C+V+PDT I
Sbjct: 141 LKPYFLEAYRPLHKGDIFTVQAAMRTVEFKVVETEPAPACIVSPDTMI 188



>sp|P54812|TER2_CAEEL Transitional endoplasmic reticulum ATPase
           homolog 2 (p97/CDC48 homolog 2).>pir|T19879|T19879
           hypothetical protein C41C4.8 - Caenorhabditis
           elegans>gb:CEC41C4_1361169 Caenorhabditis elegans cosmid
           C41C4, complete sequence.>gb:CEF10B5_1362175
           Caenorhabditis elegans cosmid F10B5, complete sequence.
          Length = 810

 Score =  213 bits (541), Expect = 3e-54
 Identities = 101/168 (60%), Positives = 134/168 (79%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD 296
           AIL+ KK PNRL++D++ NDDNS+V L  A M++L LFRGD++++KGKKR++TV I L  
Sbjct: 21  AILKDKKRPNRLIIDQSDNDDNSMVMLSQAKMDELGLFRGDSVILKGKKRRETVSIVLNA 80

Query: 297 ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESY 476
           + C   KI+MNKVVR+NLR RL DVVS+     ++YGKRVH+LPIDDTIEG+TG+LF+ +
Sbjct: 81  DNCPNDKIKMNKVVRNNLRSRLGDVVSISSA-QLEYGKRVHVLPIDDTIEGLTGNLFDVF 139

Query: 477 LKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           L+PYF +AYRP+ KGD F ++  MR+VEFKV+ETDP   C+VAPDT I
Sbjct: 140 LRPYFTDAYRPVHKGDIFTVQAAMRTVEFKVVETDPAPACIVAPDTVI 187



>gb:CR382400_1375018 Plasmodium falciparum chromosome 6, complete
           sequence; segment 3/5.
          Length = 806

 Score =  212 bits (539), Expect = 5e-54
 Identities = 102/166 (61%), Positives = 129/166 (77%), Gaps = 1/166 (0%)
 Frame = +3

Query: 129 RKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCE 308
           +KK  +RL+V+EA NDDNSVVAL+   ME+L  FRGDTI+IKGKKR  T+ I L D   +
Sbjct: 22  KKKNLSRLIVEEATNDDNSVVALNTKRMEELNFFRGDTIIIKGKKRHSTICIILNDNDLD 81

Query: 309 EAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGD-LFESYLKP 485
           E KIR+NKV R NLRV L DVV V  CP++ YGK++ +LPIDDTIEG+  D LFE +LKP
Sbjct: 82  EGKIRINKVARKNLRVCLGDVVYVKSCPEIPYGKKIQVLPIDDTIEGLAKDTLFEIFLKP 141

Query: 486 YFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           YF E+YRP++KGD FL+RGG  SVEFKV+E DP ++C+V+PDT I+
Sbjct: 142 YFNESYRPVKKGDLFLVRGGFMSVEFKVVEVDPDDFCIVSPDTVIY 187



>gb:AF044488_1236083 Trypanosoma brucei valosin-containing protein
           homolog (VCP) gene, complete cds.
          Length = 780

 Score =  201 bits (512), Expect = 6e-51
 Identities = 89/159 (55%), Positives = 122/159 (76%)
 Frame = +3

Query: 144 NRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           NRL+ D+   DDNSVV L+   M++L +FRGDT+ +KGKK + T+ IA++DE C E  I 
Sbjct: 14  NRLIADDLAEDDNSVVVLNAKRMDELSIFRGDTVKLKGKKNRSTICIAMSDENCPEGSIM 73

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           +NKV R N+R+ L D+++V    +V YG  VH+LPIDDT++ +TGDLFE++LKPYFLEAY
Sbjct: 74  VNKVTRRNIRILLGDLITVSSHSNVPYGNHVHVLPIDDTVKNLTGDLFETFLKPYFLEAY 133

Query: 504 RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           RP++ GD F+ RG MRSVEFKV+E DPG+ C+VAP+T +
Sbjct: 134 RPVKTGDLFICRGAMRSVEFKVVEVDPGDCCIVAPETVV 172



>gb:AF313485S1_1896369 Homo sapiens tissue-type kidney
           valosin-containing protein mRNA, partial cds.
          Length = 307

 Score =  195 bits (495), Expect = 6e-49
 Identities = 86/118 (72%), Positives = 105/118 (88%)
 Frame = +3

Query: 267 KDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIE 446
           ++ V I L+D+TC + KIRMN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+E
Sbjct: 3   REAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVE 62

Query: 447 GVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           G+TG+LFE YLKPYFLEAYRP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 63  GITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 120



>pir|H90135|H90135 cell division cycle protein 48 homolog [imported]
           - Guillardia theta nucleomorph>gb:AF083031_1766849
           Guillardia theta nucleomorph chromosome 3, complete
           sequence.
          Length = 752

 Score =  192 bits (488), Expect = 4e-48
 Identities = 92/163 (56%), Positives = 124/163 (76%), Gaps = 3/163 (1%)
 Frame = +3

Query: 144 NRLVVDEAIN---DDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEA 314
           NRL+VDE IN   DDNSVV L+   ++ L+LFRGDTILIK KK+KDTV I ++D+ CE  
Sbjct: 2   NRLIVDE-INQNADDNSVVYLNSNKIDNLKLFRGDTILIKTKKKKDTVCIIMSDDNCELE 60

Query: 315 KIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFL 494
           KIR+NK VR NL + + D+V++H   D+K+GKR+H+LP  D+I G  G++FE +LKPYFL
Sbjct: 61  KIRINKTVRENLNIGIGDIVTIHHFTDLKFGKRIHVLPFKDSILGYNGNIFEDFLKPYFL 120

Query: 495 EAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEIF 623
           +AYRP++KGD F I+ G  + +F+VIE DP +YC+V PDT IF
Sbjct: 121 DAYRPIKKGDVFNIKSGNNTFDFRVIEIDPVDYCIVGPDTIIF 163



>gb:AP005158_1848406 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0007M04.
          Length = 848

 Score =  189 bits (479), Expect = 4e-47
 Identities = 92/175 (52%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = +3

Query: 117 AILE--RKKAPNRLVVDEA---INDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVV 281
           AILE  +KK+PNRL+ D+A   +  DNS V L  ATME+L +FRGD + ++G++R++ V 
Sbjct: 20  AILECAKKKSPNRLMADDAEGGVAVDNSTVTLSEATMEELGIFRGDLVTLRGRRRREAVC 79

Query: 282 IALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGD 461
            A  DE+C + ++R+++ VRSNL VRL D+V+V  CP ++  KRV + P DD++EG++GD
Sbjct: 80  YAQKDESCPDGRLRLSRGVRSNLHVRLGDLVTVKPCPTIRNAKRVQLRPFDDSVEGISGD 139

Query: 462 LFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIETDP-GEYCVVAPDTEIF 623
           LFE YLKPYF++A RP++KGD FL+RG M +VEFKV++T+P  E  +VA DTEIF
Sbjct: 140 LFEPYLKPYFMDALRPVKKGDRFLVRGHMHAVEFKVMDTEPNNEPVIVAGDTEIF 194



>gb:AF199367_1250057 Entamoeba histolytica cdc48-like protein gene,
           complete cds.
          Length = 772

 Score =  185 bits (470), Expect = 5e-46
 Identities = 85/159 (53%), Positives = 119/159 (74%)
 Frame = +3

Query: 144 NRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           +RL+V+E+  DD S+V ++P  ME+L  F GD+ILIKGK+RK TV I +A+E   E  IR
Sbjct: 24  HRLIVEESKEDDMSIVYMNPQRMEELNFFEGDSILIKGKRRKSTVCIVMAEEGLTENMIR 83

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           ++++ R NLRV+L DVV V    +V Y  ++H+LPIDDT+EG+TGDLFE+Y++PYF + +
Sbjct: 84  LHRMTRYNLRVKLGDVVGVETPQNVPYAIKIHVLPIDDTVEGITGDLFETYIRPYFSDVF 143

Query: 504 RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           RP++K DHFL  GGMR+VEFKV++ DP  Y +V  DT I
Sbjct: 144 RPIKKDDHFLCHGGMRTVEFKVVDIDPSPYALVVNDTII 182



>gb:AK083821_1174079 Mus musculus 12 days embryo spinal ganglion
           cDNA, RIKEN full-length enriched library,
           clone:D130015G23 product:valosin containing protein,
           full insert sequence.
          Length = 723

 Score =  174 bits (442), Expect = 8e-43
 Identities = 77/99 (77%), Positives = 91/99 (91%)
 Frame = +3

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           MN+VVR+NLRVRL DV+S+  CPDVKYGKR+H+LPIDDT+EG+TG+LFE YLKPYFLEAY
Sbjct: 1   MNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAY 60

Query: 504 RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           RP+RKGD FL+RGGMR+VEFKV+ETDP  YC+VAPDT I
Sbjct: 61  RPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVI 99



>gb:AF083704_1766935 Arabidopsis thaliana clone sps248 unknown mRNA.
          Length = 110

 Score =  170 bits (431), Expect = 2e-41
 Identities = 85/91 (93%), Positives = 88/91 (96%)
 Frame = +3

Query: 120 ILERKKAPNRLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADE 299
           ILERKK+PNRLVVDEAINDDNSVV+LHPATMEKLQLFRGDTILIKGKKRKDTV IALADE
Sbjct: 20  ILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKKRKDTVCIALADE 79

Query: 300 TCEEAKIRMNKVVRSNLRVRLADVVSVHQCP 392
           TCEE KIRMNKVVRSNLRVRL DV+SVHQCP
Sbjct: 80  TCEEPKIRMNKVVRSNLRVRLGDVISVHQCP 110



>gb:CNS06C8G_1372721 chromosome I of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 780

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 49/153 (32%), Positives = 86/153 (56%), Gaps = 2/153 (1%)
 Frame = +3

Query: 117 AILERKKAPNRLVVDEAINDDNSV-VALHPATMEKLQLFRGDTILIKGKKRKDTVVIALA 293
           AILE K     +V D+  +   +  V LHP T+ +L+LF  D + I GKK+ + +   +A
Sbjct: 13  AILESKTKNTLIVCDKDCSKLRTYQVGLHPTTLNELELFESDYVRILGKKKAELIFSTVA 72

Query: 294 DETCEEAKIRMNKVVRSNLRVRLADVVSVHQC-PDVKYGKRVHILPIDDTIEGVTGDLFE 470
            E+     I + +  R NLR+R+ D V +++   D+    +++ LPI DT+E + G++F+
Sbjct: 73  LESVPPRHIAIVRDGRFNLRIRITDTVKLYRVDKDIPVVSKLNFLPIKDTVENIRGNIFD 132

Query: 471 SYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKV 569
            +++P+    + PL  G  + +  G+  VEFKV
Sbjct: 133 EFVRPFLDFNFMPLTTGSIYGVTSGLGRVEFKV 165



>sp|P46468|CDAT_PLAF7 Putative cell division cycle
           ATPase.>gb:PFMAL7P1_1191826 Plasmodium falciparum 3D7
           chromosome 7, *** SEQUENCING IN PROGRESS ***, 12 ordered
           pieces.
          Length = 1229

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/141 (28%), Positives = 79/141 (56%), Gaps = 1/141 (0%)
 Frame = +3

Query: 156 VDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKV 335
           +DE  N DN  + +    M++L +  G T+L+KGKK+++ + IA  D + ++  + ++  
Sbjct: 347 IDE--NLDNFDIYMSKEKMDELNINDGATVLLKGKKKREMLGIARLDRSLKKHYVVISFA 404

Query: 336 VRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVT-GDLFESYLKPYFLEAYRPL 512
           ++ NLR+   D++ +H   + K  + V + P  DTI  ++  +L ++ + PY   +Y+PL
Sbjct: 405 MKKNLRLMHNDIIKIHPFMNAKRIRNVVLSPFSDTIPNLSREELEKAVIHPYLKNSYKPL 464

Query: 513 RKGDHFLIRGGMRSVEFKVIE 575
           R   +  I      +EFKV++
Sbjct: 465 RVNSNIYIYYKNNKIEFKVLK 485



>gb:PFACDCATP_1393665 Plasmodium falciparum hypothetical cell
           division cycle ATPase gene, partial ORF.
          Length = 709

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 28/107 (26%), Positives = 59/107 (55%), Gaps = 1/107 (0%)
 Frame = +3

Query: 258 KKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDD 437
           KK+++ + IA  D + ++  + ++  ++ NLR+   D++ +H   + K  + V + P  D
Sbjct: 1   KKKREMLGIARLDRSLKKHYVVISFAMKKNLRLMHNDIIKIHPFMNAKRIRNVVLSPFSD 60

Query: 438 TIEGVT-GDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKVIE 575
           TI  ++  +L ++ + PY   +Y+PLR   +  I      +EFKV++
Sbjct: 61  TIPNLSREELEKAVIHPYLKNSYKPLRVNSNIYIYYKNNKIEFKVLK 107



>gb:AE011061_268826 Methanosarcina acetivorans str. C2A, section 406
           of 534 of the complete genome.>gb:AE010299_909385
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 786

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 45/174 (25%), Positives = 77/174 (44%), Gaps = 16/174 (9%)
 Frame = +3

Query: 147 RLVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V++A   D    ++ L PA + KLQL  GD + I+GKK+    V     +  E+  +
Sbjct: 5   QLKVEKAYPIDLGRGIIRLDPAALLKLQLSPGDIVEIRGKKKTTAKVWRADRQDWEQGIV 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVT---GDLFESYLKPYF 491
           R++  +R N  V + + V++ +    +  K +  LP   T  G     G+     +K + 
Sbjct: 65  RIDNFIRQNAGVSIGEKVTIKKVEAPEAKKLILALPESMTQGGPELQFGEHANEIIKRHI 124

Query: 492 LEAYRPLRKGDHFLIRGGM-----------RSVEFKVIETDPGEYCVVAPDTEI 620
           L+  RP+ KGD   I   M           + +    +ETDP    V+  +  I
Sbjct: 125 LK--RPVFKGDIIPIINSMSQPMTESLTTSQVIPLVAVETDPANTIVLITEATI 176



>gb:BX957219_843429 Methanococcus maripaludis S2 complete genome;
           segment 1/5.
          Length = 788

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 46/145 (31%), Positives = 70/145 (48%), Gaps = 2/145 (1%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           L+V EA   D    +V + P TMEKL L  GD I I GK++    V     E   +  IR
Sbjct: 4   LMVAEAYQGDVGKGIVRIDPLTMEKLSLKAGDAIEIAGKEKTYATVWRGYLEDQGKGIIR 63

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           M+ ++R N +  + D V +    +VK  K++ + P+   +   TG  FESY+    +E  
Sbjct: 64  MDGILRQNTKAGIGDKVKI-TVVEVKEAKKITLAPM-QAVRFSTG--FESYVGSRLVE-- 117

Query: 504 RPLRKGDHFLIRGGMRSVEFKVIET 578
           + + KG   +I  G+    F  I T
Sbjct: 118 QVVDKGSKVVI--GVLGTAFPFIVT 140



>gb:AE013270_290777 Methanosarcina mazei strain Goe1, section 52 of
           379 of the complete genome.>gb:AE008384_964886
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 792

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 44/172 (25%), Positives = 76/172 (44%), Gaps = 16/172 (9%)
 Frame = +3

Query: 147 RLVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V++A   D    ++ L P  + KLQL  GD + I+GKK+    V     +  E+  +
Sbjct: 5   QLKVEKAYPIDLGRGIIRLDPTALLKLQLSPGDIVEIRGKKKTTAKVWRADRQDWEQGIV 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVT---GDLFESYLKPYF 491
           R++  +R N  V + + V++ +    +  K +  LP   T  G     G+     +K + 
Sbjct: 65  RIDNFIRQNAGVSIGEKVTIKKVEAPEAKKLILALPESMTQGGPELQFGEHANEIIKRHI 124

Query: 492 LEAYRPLRKGDHFLIRGGM-----------RSVEFKVIETDPGEYCVVAPDT 614
           L+  RP+ KGD   I   M           + +    +ETDP    V+  +T
Sbjct: 125 LK--RPVFKGDIIPIINSMSQPMTESLTTSQVIPLVAVETDPANTIVLITET 174



>gb:AE009780_255584 Pyrobaculum aerophilum strain IM2 section 35 of
           201 of the complete genome.>gb:AE009441_898210
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 731

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 44/159 (27%), Positives = 72/159 (45%), Gaps = 1/159 (0%)
 Frame = +3

Query: 147 RLVVDEAINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRM 326
           R+   +A + +  VV + P  ME+  +  GD + I G++R    V     E   +  IRM
Sbjct: 8   RVQESKARDANRPVVRIDPEVMERAGIVVGDVVEIVGRRRTAAKVWNGLPEDRGKGVIRM 67

Query: 327 NKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAYR 506
           N ++R N  V L + V V +  + K    V + P+  TI       F  Y+K    E   
Sbjct: 68  NSILRKNADVSLNETVKVRRV-EPKPAAFVKLAPVSMTI--AVDANFLQYIKQRLREYV- 123

Query: 507 PLRKGDHFLIRGGMRSVEFKVIETDPGE-YCVVAPDTEI 620
            L +GD   I    + + F+V++T P     ++  DT+I
Sbjct: 124 -LVEGDMLQIHVLSQPLTFQVVQTKPSNTVLIITEDTQI 161



>gb:AE009915_257349 Pyrobaculum aerophilum strain IM2 section 170 of
           201 of the complete genome.>gb:AE009441_899975
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 738

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 48/159 (30%), Positives = 74/159 (46%), Gaps = 2/159 (1%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           L V EA + D   S+V L    M+KL +  GD + I G+K     V     E  ++  IR
Sbjct: 7   LKVAEARSRDVGRSIVRLPVRIMKKLGIEPGDYVEIIGRKSAYAQVWPAYPEDEDKEVIR 66

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           M+ ++R N  V + D V V +   +K  +RV + P     E V  D    YLK   L   
Sbjct: 67  MDGIIRQNAGVGIGDTVKVRKAV-LKPAQRVVLTP----TEPVRVD--SEYLKKQILLG- 118

Query: 504 RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           +P+ +G    +     ++ F V++  PG    V+ DTE+
Sbjct: 119 KPVARGQAIDVPFYGGAIRFVVVQVQPGPAAYVSIDTEV 157



>pir|A69086|A69086 cell division control protein Cdc48 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000923_29308 Methanobacterium
           thermoautotrophicum from bases 1503413 to 1515108
           (section 129 of 148) of the complete
           genome.>gb:AE000666_926390 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 732

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 48/182 (26%), Positives = 80/182 (43%), Gaps = 24/182 (13%)
 Frame = +3

Query: 147 RLVVDEAINDDN---SVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAK 317
           +L V EA+   +    +  + PA MEKL L  GD I I+GKK     V++ +        
Sbjct: 10  KLKVAEALAQQDVGRGIARVDPACMEKLGLSDGDIIEIEGKKLTAATVVS-SQSDIGLGI 68

Query: 318 IRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLE 497
           IR++  +R N    + + V+V +  DVK  ++V + P+D  +  + GD+  ++L      
Sbjct: 69  IRIDGYLRKNAGASIGEEVTVRRA-DVKDAQKVVLAPVDQEVI-IRGDIRSAFLN----- 121

Query: 498 AYRPLRKGDHFL------IRGG---------------MRSVEFKVIETDPGEYCVVAPDT 614
             R L KGD  +      I GG               +  ++  V+ T P     V P T
Sbjct: 122 --RVLVKGDIIVSGIRQHISGGGLFDEFFRDFMDISPLGEIKLAVVSTSPAGVVRVTPST 179

Query: 615 EI 620
           ++
Sbjct: 180 QV 181



>gb:AE013356_291586 Methanosarcina mazei strain Goe1, section 138 of
           379 of the complete genome.>gb:AE008384_965695
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 751

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 4/161 (2%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           L V EA + D    +  +    M+++ L  GD I I G+ +   +V     E  +E +IR
Sbjct: 7   LRVAEAYHKDVGRGIARIDTRLMQEMGLVSGDIIEISGRSKTYAIVWPNV-ERGQENRIR 65

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           ++  +RSN +V + D V++ +    K+ +RV + P    +  V G         Y L   
Sbjct: 66  IDGNLRSNAKVGIDDRVTIQKV-QAKHAQRVTLAP-SQPVRLVGG-------AHYILRII 116

Query: 504 --RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
             RPL KG    +      + F V  T P    VV  DTEI
Sbjct: 117 EGRPLNKGQQIRVETVNNPLTFVVASTRPAGPVVVTKDTEI 157



>gb:AE011179_269850 Methanosarcina acetivorans str. C2A, section 524
           of 534 of the complete genome.>gb:AE010299_910409
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 753

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 46/161 (28%), Positives = 71/161 (44%), Gaps = 4/161 (2%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           L V EA + D    +  +    M+++ L  GD I I G+ +   +V     E  +E +IR
Sbjct: 7   LRVAEAYHKDVGRGIARIDTRLMQEMGLVSGDIIEISGRSKTYAIVWPNV-ERGQENRIR 65

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAY 503
           ++  +RSN +V + D V++ +    K+ +RV + P    +  V G         Y L   
Sbjct: 66  IDGNLRSNAKVGIDDRVTIQKV-QAKHAQRVTLAP-SQPVRLVGG-------AHYILRII 116

Query: 504 --RPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
             RPL KG    +      + F V  T P    VV  DTEI
Sbjct: 117 EGRPLNKGQQIRVETVNNPLTFVVASTRPAGPVVVTKDTEI 157



>pir|B72479|B72479 probable transitional endoplasmic reticulum
           ATPase APE2474 - Aeropyrum pernix (strain
           K1)>gb:BA000002_653234 Aeropyrum pernix K1 DNA, complete
           genome.
          Length = 699

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 34/135 (25%), Positives = 68/135 (50%)
 Frame = +3

Query: 210 MEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQC 389
           M++L +  GD + I+GKK+   +V+    E      IRM+ ++R N  V + + V V + 
Sbjct: 1   MKELGVEPGDVVEIEGKKKTVAIVMPAYPEDMGLDIIRMDGILRRNADVNIGEKVIVRK- 59

Query: 390 PDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGGMRSVEFKV 569
             V+   +V + P+  T+    G  F+ Y+K        P+ +GD  ++    ++V+ +V
Sbjct: 60  TSVRTATKVKLAPVSYTMTVDEG--FKRYVKKKLQGV--PITEGDVVVVPVIGQAVQLQV 115

Query: 570 IETDPGEYCVVAPDT 614
           ++  P    +V+ +T
Sbjct: 116 VDARPKGAVIVSEET 130



>gb:AE017199_403295 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 826

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 39/158 (24%), Positives = 73/158 (46%), Gaps = 12/158 (7%)
 Frame = +3

Query: 147 RLVVDEAINDDNSV--VALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V EA  +D  +  V +    +++L L  GD I I+G ++   +   L  E      I
Sbjct: 10  KLKVAEAYQEDVYLGKVRVDYDVLDRLGLSPGDIIEIEGTRKTYAIADVLYPEDQGLGII 69

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEA 500
           RM+ V+R N  V + + V V + P  +  K+V + P+    + +  + +   L   F+  
Sbjct: 70  RMDGVIRKNAGVGVGEYVIVRKPPKPQIAKKVVLAPVKKEEQIIIDEYYLRNLLNGFV-- 127

Query: 501 YRPLRKGDHFLIRGG----------MRSVEFKVIETDP 584
              + KGD+ ++R            ++ + FKV+ T+P
Sbjct: 128 ---VTKGDYVVVRFDNLGFFIDFLPLKEMWFKVVSTNP 162



>sp|Q07590|SAV_SULAC SAV protein.>pir|S43859|S43859 ATPase -
           Sulfolobus acidocaldarius>gb:SSOREVGYRA_190720
           Sulfolobus acidocaldarius ATPase gene, complete cds.
          Length = 780

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 35/145 (24%), Positives = 64/145 (44%)
 Frame = +3

Query: 186 VVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRLA 365
           V  +   +M KL +  GD I I G+     +   +      + +IR++  +R +++V + 
Sbjct: 54  VARISETSMRKLNVEAGDYIEIIGQDGNSALAQVMPAYDISDDEIRIDGYIRKSIKVGIG 113

Query: 366 DVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFLIRGG 545
           D V+V +  +V    +V + P          + F  Y+K   ++  +PL KG+   I   
Sbjct: 114 DDVTVRKT-NVSPASKVVLAPTQPIR---FDNSFVEYVKDTLMD--KPLAKGETLPIPIY 167

Query: 546 MRSVEFKVIETDPGEYCVVAPDTEI 620
             ++E  V+ T P  Y  V   T I
Sbjct: 168 TGTLELTVVNTQPSNYVYVTGSTNI 192



>sp|Q58556|YB56_METJA Cell division cycle protein 48 homolog
           MJ1156.>pir|C64444|C64444 cell division control protein
           CDC48 homolog - Methanococcus
           jannaschii>gb:U67557_207264 Methanocaldococcus
           jannaschii DSM 2661 section 99 of 150 of the complete
           genome.>gb:L77117_1100022 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 903

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 3/148 (2%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALAD-ETCEEAKI 320
           L V EA   D    +  + P TME+L L  GD I I+G K K   ++     E   +  I
Sbjct: 5   LKVAEAYQGDVGRGIARIDPYTMEELGLKPGDVIEIEGPKGKAYAIVYRGFLEDAGKGII 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFESYLKPYFLEA 500
           R++  +R N  V + D V V +  ++K  K+V + P   T     G  FE ++K   L  
Sbjct: 65  RIDGYLRQNAGVAIGDRVKVKRV-EIKEAKKVVLAP---TQPIRFGPGFEDFVKRKILG- 119

Query: 501 YRPLRKGDHFLIRGGMRSVEFKVIETDP 584
            + L KG    I     ++ F V+ T P
Sbjct: 120 -QVLSKGSKVTIGVLGTALTFVVVSTTP 146



>gb:AE010343_262118 Methanopyrus kandleri AV19 section 42 of 157 of
           the complete genome.>gb:AE009439_902899 Methanopyrus
           kandleri AV19, complete genome.
          Length = 1249

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 2/112 (1%)
 Frame = +3

Query: 141 PNRLVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEA 314
           P +L V++A  +D     V +  A+ +++ +  GD + I G K     V+    E   + 
Sbjct: 5   PIKLRVEKAYPEDVGKRAVRMDKASRDRIGVSEGDLVKITGSKTTVARVLPAKKEDVGKG 64

Query: 315 KIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDLFE 470
            +RM+K  R N    + + V V +  + K  KRV ++P +  +  V   L E
Sbjct: 65  IVRMDKYERQNAGASVGEPVEVDRAEE-KVAKRVELMPTERVVVPVQAGLKE 115



>gb:AY596297_632911 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 741

 Score = 38.9 bits (89), Expect = 0.070
 Identities = 37/165 (22%), Positives = 71/165 (43%), Gaps = 7/165 (4%)
 Frame = +3

Query: 147 RLVVDEAINDDNS--VVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V +A  +D+   +  L P T+  L+L  GD I I+G       V     +      +
Sbjct: 5   QLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGSDTTAAKVWRADRQDWNTDTV 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIE---GVTGDLFESYLKPYF 491
           R++   R N  V + + V++ +    K  K V   P + +++      G +    LK   
Sbjct: 65  RIDGFTRQNADVGIGERVTIRKAEAEKADKLVLAPPEEASVQFGSDAAGMVKRQILKRPV 124

Query: 492 LEA--YRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           +E      +   +H  +R   +++    +ET+P   C++  DTE+
Sbjct: 125 VERDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLITEDTEV 169



>gb:BC007562_1970813 Homo sapiens valosin-containing protein, mRNA
           (cDNA clone IMAGE:2988964), partial cds.
          Length = 644

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 15/20 (75%), Positives = 17/20 (85%)
 Frame = +3

Query: 561 FKVIETDPGEYCVVAPDTEI 620
           FKV+ETDP  YC+VAPDT I
Sbjct: 1   FKVVETDPSPYCIVAPDTVI 20



>sp|Q9HPF0|CDCH_HALN1 CdcH protein.>pir|C84319|C84319 cell division
           cycle protein [imported] - Halobacterium sp.
           NRC-1>gb:AE005075_63079 Halobacterium sp. NRC-1 section
           106 of 170 of the complete genome.>gb:AE004437_887998
           Halobacterium sp. NRC-1 complete genome.
          Length = 742

 Score = 37.4 bits (85), Expect = 0.20
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 7/165 (4%)
 Frame = +3

Query: 147 RLVVDEAINDDNS--VVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V +A  +D+   +  L P T+  L+L  GD I I+G +     V     +      I
Sbjct: 5   QLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIEIEGAETTAAKVWRADRQDWNTDTI 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIE---GVTGDLFESYLK-PY 488
           R++   R N  V + + V + +    K    V   P + +++      G +    LK P 
Sbjct: 65  RIDGFTRQNAEVGIGERVKIRKADAEKADTLVLAPPEEASVQFGSDAAGMVKRQILKRPV 124

Query: 489 FLEAYRPLRKG-DHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
                 P+    +H  +R   +++    +ET+P   C+V  DT++
Sbjct: 125 VARDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLVTEDTDV 169



>sp|P46464|CDCH_HALSA CdcH protein.>pir|S47018|S47018 cdcH protein -
           Halobacterium salinarum>gb:HSCDCH_138747 H.salinarium
           (R1M1) cdcH gene.
          Length = 742

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 7/165 (4%)
 Frame = +3

Query: 147 RLVVDEAINDDNS--VVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKI 320
           +L V +A  +D+   +  L P T+  L+L  GD I I+G +     V     +      I
Sbjct: 5   QLEVAKAYPNDSGRGIARLDPDTLLHLKLSPGDIIDIEGAETTAAKVWRADRQDWNTDTI 64

Query: 321 RMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIE---GVTGDLFESYLK-PY 488
           R++   R N  V + + V + +    K    V   P + +++      G +    LK P 
Sbjct: 65  RIDGFTRQNAEVGIGERVKIRKADAEKADTLVLAPPEEASVQFGSDAAGMVKRQILKRPV 124

Query: 489 FLEAYRPLRKG-DHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
                 P+    +H  +R   +++    +ET+P   C+V  DT++
Sbjct: 125 VARDIVPVMSSTNHPFMRSPGQAIPLIAVETEPEGVCLVTEDTDV 169



>gb:BA000023_690939 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 747

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 40/164 (24%), Positives = 66/164 (40%), Gaps = 7/164 (4%)
 Frame = +3

Query: 150 LVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIR 323
           L V EA   D    +  L   TM KL +  GD I I G      +  A+      + +I+
Sbjct: 7   LRVSEARQRDVGKKIARLSDYTMRKLGIETGDYIEIIGPNGS-ALAQAMPSYDISDDEIK 65

Query: 324 MNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDTIEGVTGDL-----FESYLKPY 488
           ++  +R ++ V + D V V         K+ ++ P        T  +     F  Y+K  
Sbjct: 66  IDGYIRKSIGVGIGDDVKV---------KKANVTPATKITLAPTQPIRFDRSFVEYVKDQ 116

Query: 489 FLEAYRPLRKGDHFLIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
            +   +PL KG+   +     +++F VI T P  Y  V   T +
Sbjct: 117 LMN--KPLAKGETIPVPIYTGTLDFIVINTQPSNYVYVTESTNL 158



>pir|S25345|S25345 probable membrane protein YCR089w - yeast
            (Saccharomyces cerevisiae)
          Length = 1609

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = -1

Query: 451  TPSIVSSIGSMCTRFPYLTSGH*CTDTTSASRTLKFDRTTLFILIFASSHVSSARAITTV 272
            TP++++S+    T FPYLTS    T ++S + T K           +S   SS  +  +V
Sbjct: 980  TPTVITSVQMRSTPFPYLTSS---TSSSSLASTKK-----------SSLEASSEMSTFSV 1025

Query: 271  SFLFLPLIRIVSPRKSWSFSMVAGWRATTELSSLIASST 155
            S   LPL    S ++  S + V+ W  T   +++++SS+
Sbjct: 1026 STQSLPLAFTCSEKR--STTSVSQWSNTVLTNTIMSSSS 1062



>gb:BA000011_665417 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 745

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 38/154 (24%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
 Frame = +3

Query: 183 SVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRL 362
           S V L  ++   L    GD + I+  ++    V     E   +  +R++ V+R+N    +
Sbjct: 22  SRVRLDESSRRLLDAEIGDVVEIEKARKTVGRVYRARPEDENKGIVRIDSVMRNNCGASI 81

Query: 363 ADVVSVHQCPDVKYGKRVHILPI---DDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFL 533
            D V V +    +  K+V + PI   D  ++   G+  E Y++   +   RP+ + D+  
Sbjct: 82  GDKVRVRKV-RTEIAKKVTLAPIIRKDQRLK--FGEGIEEYVQRALIR--RPMLEQDNIS 136

Query: 534 IRG----GMRSVEFKVIETDPGEYCV-VAPDTEI 620
           + G    G   + FKV++T PG+  V +  +T+I
Sbjct: 137 VPGLTLAGQTGLLFKVVKTMPGKVPVEIGEETKI 170



>gb:AY596297_632243 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 757

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 36/150 (24%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
 Frame = +3

Query: 186 VVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAK--IRMNKVVRSNLRVR 359
           + A+  A M++L+L  GD I+++GK+    V         +E    +R++  +R    V 
Sbjct: 17  LAAIDRAAMDELELENGDYIVLEGKQDSRAVARVWPGYPEDEGNGIVRIDGQLRQEANVG 76

Query: 360 LADVVSVHQCPDVKYGKRVHI-LPIDDTIEGVTGDLFESYLKPYFLEAYR--PLRKGDHF 530
           + D V++ +  DV     V + LP +  + G  G +  + L    +   +  P+  G   
Sbjct: 77  IDDPVNIEKA-DVNPATSVTVALPQNLRVRGNVGPMIRNNLSGQAVTQGQTVPVSFGLGP 135

Query: 531 LIRGGMRSVEFKVIETDPGEYCVVAPDTEI 620
           L     + +  K+ ET+P    VV   T+I
Sbjct: 136 LSSMSGQKIPLKIAETEPSGTVVVTDSTDI 165



>sp|P25653|FIG2_YEAST Factor induced gene 2 precursor (Cell wall
            adhesin FIG2).>gb:SCCHRIII_1706928 S.cerevisiae
            chromosome III complete DNA sequence.
          Length = 1609

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 29/99 (29%), Positives = 50/99 (50%)
 Frame = -1

Query: 451  TPSIVSSIGSMCTRFPYLTSGH*CTDTTSASRTLKFDRTTLFILIFASSHVSSARAITTV 272
            TP++++S+    T FPYLTS    T ++S + T K           +S   SS  +  +V
Sbjct: 980  TPTVITSVQMRSTPFPYLTSS---TSSSSLASTKK-----------SSLEASSEMSTFSV 1025

Query: 271  SFLFLPLIRIVSPRKSWSFSMVAGWRATTELSSLIASST 155
            S   LPL    S ++  S + V+ W  T   +++++SS+
Sbjct: 1026 STQSLPLAFTSSEKR--STTSVSQWSNTVLTNTIMSSSS 1062



>gb:AE014185_937649 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014830_1228383 Plasmodium falciparum 3D7
           chromosome 10 section 2 of 7 of the complete sequence.
          Length = 646

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = +3

Query: 408 KRVHILPIDDTIEGVTG-DLFESYLKPYFLEAYRPLRK-GDHFLIRGGMRSVEFKVIETD 581
           K VHI+P+ DT+      DLF  Y+KPY    Y  +    D F  +G    V+FK++  D
Sbjct: 401 KNVHIVPMYDTLPTTYNYDLFMDYVKPYIERHYLNVYSIHDTFFYKG----VQFKIMGID 456

Query: 582 P 584
           P
Sbjct: 457 P 457



>gb:AP006841_572173 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 360

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 1/144 (0%)
 Frame = +3

Query: 177 DNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRV 356
           D  ++AL PA+++++  F G    +  K R   ++  LAD    +    M KVV    + 
Sbjct: 136 DYKLIALAPASVQEMADFVGLAFELAFKYRNPAII--LADGVIGQM---MEKVVLPPAKA 190

Query: 357 RLADVVSVHQCPDVKYGKRVHILP-IDDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFL 533
           R  D   + QCP    GK     P I  ++E    ++ ++ L+  F   YR + + +   
Sbjct: 191 RRTDAEVIAQCPWASTGKTKDRKPNIITSLELRPEEMEKNNLR--FQAKYRVIEENE--- 245

Query: 534 IRGGMRSVEFKVIETDPGEYCVVA 605
                  V F+ I+ +  EY +VA
Sbjct: 246 -------VRFEEIDCEDAEYLIVA 262



>gb:AE005154_64024 Halobacterium sp. NRC-1 plasmid pNRC200 section
           15 of 32 of the complete genome.>gb:AE004438_888943
           Halobacterium sp. NRC-1 plasmid pNRC200 complete genome.
          Length = 737

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 7/165 (4%)
 Frame = +3

Query: 147 RLVVDEAINDD--NSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAK- 317
           RL V +  N D  + +  +    ++++ +  GD + I+G+    TV       T +  + 
Sbjct: 2   RLTVKQLKNRDPGSGMAVIDRDALQEIGVSSGDFVAIEGRNGGRTVARVWPSNTSDAGRG 61

Query: 318 -IRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHI-LPIDDTIEGVTGDLFESYLKPYF 491
            IR++  +R    V + D V V +  +V+   RV + LP +  I G  G     +L    
Sbjct: 62  IIRIDGQLRQAANVSIDDRVEVEKT-EVEPADRVTVSLPQNLQIRGDLGSHLREHLVDQA 120

Query: 492 LEAYRPLRKGDHFLIRGGM--RSVEFKVIETDPGEYCVVAPDTEI 620
           + A + +     F +  G   R +  +V++T P    VV   TEI
Sbjct: 121 VRAGQTVAFPIGFGMFSGRSGRRIPLRVVDTQPSGTVVVQNTTEI 165



>gb:AJ627420_527875 Uncultured crenarchaeote genomic fragment 6a13.
          Length = 107

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = +3

Query: 207 TMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAK--IRMNKVVRSNLRVRLADVVSV 380
           +M+ L    GD I I+GK+R  TV   L     +E K  +R++ +VR+N  V + D V V
Sbjct: 29  SMDSLSASTGDVIEIRGKRR--TVAKCLPLYPSDEGKGIVRVDGLVRNNAGVAIGDTVIV 86

Query: 381 HQCPDVKYGKRVHILPID 434
            +   V   ++V + P++
Sbjct: 87  RKIKAVP-AEKVIVAPLE 103



>sp|O05209|VAT_THEAC VCP-like ATPase.>pir|T37458|T37458 VCP-like
           ATPase - Thermoplasma acidophilum>gb:TACID3_196599
           Thermoplasma acidophilum complete genome; segment
           3/5.>gb:TAU78072_197372 Thermoplasma acidophilum
           VCP-like ATPase (vat) gene, complete cds.
          Length = 745

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 37/154 (24%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = +3

Query: 183 SVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETCEEAKIRMNKVVRSNLRVRL 362
           S V L  ++   L    GD + I+  ++    V     E   +  +R++ V+R+N    +
Sbjct: 22  SRVRLDESSRRLLDAEIGDVVEIEKVRKTVGRVYRARPEDENKGIVRIDSVMRNNCGASI 81

Query: 363 ADVVSVHQCPDVKYGKRVHILPI---DDTIEGVTGDLFESYLKPYFLEAYRPLRKGDHFL 533
            D V V +    +  K+V + PI   D  ++   G+  E Y++   +   RP+ + D+  
Sbjct: 82  GDKVKVRKV-RTEIAKKVTLAPIIRKDQRLK--FGEGIEEYVQRALIR--RPMLEQDNIS 136

Query: 534 IRG----GMRSVEFKVIETDPGEYCV-VAPDTEI 620
           + G    G   + FKV++T P +  V +  +T+I
Sbjct: 137 VPGLTLAGQTGLLFKVVKTLPSKVPVEIGEETKI 170



>gb:HSA238221_2000696 Homo sapiens RPC62 gene for RNA polymerase III
           subunit, exon 1 and joined CDS.
          Length = 534

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 237 DTILIKGKKRKDTVVIALAD---ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDV 398
           + +L+ GK     VV  +AD   ET E+ K  M+    SN  VRLAD   V +CP V
Sbjct: 108 EELLLNGKLTMSAVVKKVADRLTETMEDGKT-MDYAEVSNTFVRLADTHFVQRCPSV 163



>gb:BC004424_1969262 Homo sapiens polymerase (RNA) III (DNA
           directed) polypeptide C (62kD), mRNA (cDNA clone
           MGC:3538 IMAGE:2820818), complete cds.
          Length = 411

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 237 DTILIKGKKRKDTVVIALAD---ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDV 398
           + +L+ GK     VV  +AD   ET E+ K  M+    SN  VRLAD   V +CP V
Sbjct: 108 EELLLNGKLTMSAVVKKVADRLTETMEDGKT-MDYAEVSNTFVRLADTHFVQRCPSV 163



>gb:DOR489284_1381265 Drepanosiphum oregonensis partial lw-Rh gene
           for long-wavelength opsin, exons 1-5.
          Length = 258

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 9/92 (9%)
 Frame = -3

Query: 614 SVWSNNTIFPWICLNDLEFHTSHTPSNKEVVSFPQRTICLQ-----KVRFQV*FKEITSD 450
           +V +   I+ + C  +L      TPSN  VV+      CL       + +   F+     
Sbjct: 11  TVGNGMVIYIFTCTKNLR-----TPSNLLVVNLAFSDFCLMFTMCPAMVWNCIFETWMFG 65

Query: 449 PFNCIIYRKYVHTFPILNIWTLMY----RYNI 366
           PF C +Y  +   F + +IWT+++    RYN+
Sbjct: 66  PFACELYAMFGSLFGVTSIWTMVFIALDRYNV 97



>gb:CP000013_869950 Borrelia garinii PBi, complete genome.
          Length = 481

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 8/103 (7%)
 Frame = -3

Query: 398 NIWTLMYRYNISKSDPQI*PDNF---IHPNLCLFTCLISKSNNHCIFPFFALNQNRVSTE 228
           NIWT +    +SK D  +   N      P L +F     KSNN     F   N+N  +  
Sbjct: 292 NIWTDVIHSYLSKGDSNVDSSNIGLISEPFLGIFYNY--KSNNEIKSEFIVNNENAWANA 349

Query: 227 ELELLHGSRV-----ESNDGVIIIDRLIHDKPIRRLLPLQNRR 114
            +  ++ +       +SN   II+  L  ++PI  + PL+++R
Sbjct: 350 NISSVYMANFIKGFFDSNFNQIIMSFLSENRPIVSICPLKSKR 392



>pir|D71680|D71680 ribonuclease E (rne) RP256 - Rickettsia
           prowazekii>gb:RPXX02_167052 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 2/4.
          Length = 683

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 7/118 (5%)
 Frame = +3

Query: 282 IALADETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDVKYGKRVHILPIDDT--IEGVT 455
           IALA+ T E+ + + + +  S +     D+ ++    + K+    ++   DD   I+  T
Sbjct: 97  IALANITIEDDQEKPSIIYDSLIDNEEIDLKTIEDLVESKFQSEFNLESADDIEIIQSCT 156

Query: 456 GDLFESYLKPYFLEAYRPLRKGDHFLIR-----GGMRSVEFKVIETDPGEYCVVAPDT 614
            +L  S  KPY ++    +RK    L++      G +   F    +  G+YCV+ P+T
Sbjct: 157 TELNISQYKPYKVQDV--IRKNQVLLVQVTKEERGNKCAAFTTYISLAGKYCVLMPNT 212



>sp|Q9BUI4|RPC3_HUMAN DNA-directed RNA polymerase III 62 kDa
           polypeptide (EC 2.7.7.6) (RNA polymerase C subunit 3)
           (RPC3) (RNA polymerase III C62
           subunit).>gb:AY091463_1936203 Homo sapiens RNA
           polymerase III subunit RPC62 mRNA, complete
           cds.>gb:BC002586_1968234 Homo sapiens polymerase (RNA)
           III (DNA directed) polypeptide C (62kD), mRNA (cDNA
           clone MGC:1325 IMAGE:3140741), complete cds.
          Length = 534

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 3/57 (5%)
 Frame = +3

Query: 237 DTILIKGKKRKDTVVIALAD---ETCEEAKIRMNKVVRSNLRVRLADVVSVHQCPDV 398
           + +L+ GK     VV  +AD   ET E+ K  M+    SN  VRLAD   V +CP V
Sbjct: 108 EELLLNGKLTMSAVVKKVADRLTETMEDGKT-MDYAEVSNTFVRLADTHFVQRCPSV 163



>gb:AE010640_265250 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 182 of 197 of the complete
           genome.>gb:AE009951_912418 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 400

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)
 Frame = +3

Query: 129 RKKAPNRLVVDE-AINDDNSVVALHPATMEKLQLFRGDTILIKGKKRKDTVVIALADETC 305
           +K +P   +  E + NDD + V +     +KL L  G+T +I+G K    VV +   ++ 
Sbjct: 117 KKNSPFWYIEGEWSTNDDENNVMIGKEISKKLNLQVGETFIIEGPKAGAKVVASKQSDSA 176

Query: 306 EEAK 317
           EE+K
Sbjct: 177 EESK 180



>gb:AF445798_1271685 Taenia asiatica mitochondrion, complete genome.
          Length = 522

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = -1

Query: 349 KFDRTTLFILIFASSHVSSARAITTVSFLFLPLIRIVS-PRKSWSFSMVAGWRATTELSS 173
           +F    LF+LI  S  ++S      + F  +   +  S P  SW   ++   RA T +SS
Sbjct: 139 RFGDVCLFLLIGLSCFINSNYMFCMIIFFLIIFTKSASFPFISW---LLEAMRAPTPVSS 195

Query: 172 LIASSTTSRFGAFFRSR 122
           L+ SST    G +F  R
Sbjct: 196 LVHSSTLVAAGIWFSMR 212



>gb:AF314223_1261654 Hymenolepis diminuta mitochondrion, complete
           genome.
          Length = 524

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = -1

Query: 349 KFDRTTLFILIFASSH-VSSARAITTVSFLFLPLIRIVSPRKSWSFSMVAGWRATTELSS 173
           +F    LFILI  S + V+   A   V FL +       P  SW   ++   RA T +SS
Sbjct: 139 RFGDVCLFILICVSCYSVNGPLAAGLVFFLIIFTKSASFPFISW---LLEAMRAPTPVSS 195

Query: 172 LIASSTTSRFGAFFRSR 122
           L+ SST    G +F  R
Sbjct: 196 LVHSSTLVAAGVWFSMR 212



>gb:BX569691_775849 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 235

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = -3

Query: 365 SKSDPQI*PDNFIHPNLCLFT--CLISKSNNHCIFPFFALNQNRVSTEELELLHGSRVES 192
           ++ DP + P+ + H NLCL+   C +++  N        L+       EL L H  RV S
Sbjct: 129 AQQDPSVLPEIYSHANLCLYVNECRVTRDGND-----LNLSPKEYKILELFLQHPKRVWS 183

Query: 191 NDGVI 177
            D ++
Sbjct: 184 RDQLL 188


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 667,519,853
Number of Sequences: 1806583
Number of extensions: 13876223
Number of successful extensions: 36445
Number of sequences better than 10.0: 87
Number of HSP's better than 10.0 without gapping: 35176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36428
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 32290244624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)