BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3259
         (1280 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF175964_1774526 Lycopersicon esculentum JAB mRNA, complete cds.   616   e-175   
pir|T09261|T09261 JUN kinase-activation-domain-binding protein h...   612   e-174   Medicago sativa [alfalfa]
pir|H96736|H96736 hypothetical protein F3I17.12 [imported] - Ara...   575   e-163   Arabidopsis thaliana [mouse-ear cress]
pir|T52042|T52042 constitutive photomorphogenic 9 complex chain ...   575   e-163   Arabidopsis thaliana [mouse-ear cress]
pir|C86363|C86363 Jun activation domain binding protein homolog ...   562   e-159   Arabidopsis thaliana [mouse-ear cress]
gb:AY087510_1572541 Arabidopsis thaliana clone 36216 mRNA, compl...   562   e-159   
pir|T02934|T02934 JUN-activation-domain-binding protein homolog ...   561   e-159   Oryza sativa Japonica Group [Japonica rice]
pir|T52180|T52180 constitutive photomorphogenic 9 complex chain ...   557   e-157   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00090_1694714 Oryza sativa genomic DNA, chromosome 4, BAC...   540   e-152   
gb:BC062499_2553379 Xenopus tropicalis COP9 signalosome subunit ...   449   e-125   
gb:AJ719811_2501998 Gallus gallus mRNA for hypothetical protein,...   448   e-124   
gb:BC074434_2557938 Xenopus laevis MGC84682 protein, mRNA (cDNA ...   448   e-124   
gb:BT008168_2151100 Synthetic construct Homo sapiens COP9 consti...   447   e-124   
gb:BC001187_1967367 Homo sapiens COP9 constitutive photomorphoge...   447   e-124   
gb:AK012499_1156995 Mus musculus 11 days embryo whole body cDNA,...   447   e-124   
gb:BC059493_2552470 Danio rerio zgc:73130, mRNA (cDNA clone MGC:...   446   e-124   
pir|S71820|S71820 JUN-activation-domain-binding protein 1 - huma...   445   e-124   Homo sapiens [man]
gb:HSU70734_2025822 Homo sapiens 38 kDa Mov34 homolog mRNA, comp...   436   e-121   
gb:AF132563_1243648 Drosophila melanogaster LD14392 full insert ...   427   e-118   
gb:AE014297_1139896 Drosophila melanogaster chromosome 3R, compl...   426   e-118   
gb:AF129083_1243390 Drosophila melanogaster COP9 signalosome sub...   422   e-117   
pir|T29320|T29320 hypothetical protein B0547.1 - Caenorhabditis ...   376   e-103   Caenorhabditis elegans [roundworm]
gb:AE017350_1759168 Cryptococcus neoformans var. neoformans JEC2...   340   3e-92   
gb:AB070063_1870934 Macaca fascicularis testis cDNA clone:QtsA-1...   318   1e-85   
gb:CR382131_1663658 Yarrowia lipolytica chromosome E of strain C...   300   3e-80   
gb:CR382138_1670821 Debaryomyces hansenii chromosome F of strain...   267   4e-70   
gb:AY232223_1177516 Drosophila yakuba clone yak-ad_CSN5 mRNA seq...   263   4e-69   
gb:AY078082_1935972 Homo sapiens Jun activation domain binding p...   241   2e-62   
sp|O94454|CSN5_SCHPO|CSN5_SCHPO COP9 signalosome complex subunit 5 (CSN com...   240   5e-62   Schizosaccharomyces pombe
gb:BT003909_1637034 Arabidopsis thaliana clone RAFL15-21-A19 (R2...   205   2e-51   
gb:AE016815_1746089 Ashbya gossypii (= Eremothecium gossypii) AT...   195   1e-48   
gb:CR382124_1656704 Kluyveromyces lactis strain NRRL Y-1140 chro...   171   2e-41   
gb:CR380953_1650861 Candida glabrata strain CBS138 chromosome G ...   160   4e-38   
pir|S67775|S67775 hypothetical protein YDL216c - yeast (Saccharo...   149   9e-35   Saccharomyces cerevisiae [brewer's yeast]
gb:DDU96916_1377465 Dictyostelium discoideum sks1 multidrug resi...   137   4e-31   
gb:AC117176_1207993 Dictyostelium discoideum chromosome 2 map 50...   137   4e-31   
gb:CR382125_1657851 Kluyveromyces lactis strain NRRL Y-1140 chro...   129   1e-28   
gb:CR382138_1671838 Debaryomyces hansenii chromosome F of strain...   127   6e-28   
gb:AE014134_1127607 Drosophila melanogaster chromosome 2L, compl...   127   6e-28   
gb:CR380958_1653469 Candida glabrata strain CBS138 chromosome L ...   126   8e-28   
gb:MM26SPROT_2113733 Mus musculus mRNA for 26S proteasome non-AT...   125   1e-27   
gb:AK012013_1156717 Mus musculus 10 days embryo whole body cDNA,...   125   1e-27   
gb:AK011974_1156694 Mus musculus 10 days embryo whole body cDNA,...   125   1e-27   
gb:AB025633_1516591 Arabidopsis thaliana genomic DNA, chromosome...   125   2e-27   
gb:AY086277_1571330 Arabidopsis thaliana clone 23276 mRNA, compl...   125   2e-27   
pir|T33344|T33344 hypothetical protein K07D4.3 - Caenorhabditis ...   125   2e-27   Caenorhabditis elegans [roundworm]
sp|P43588|MPR1_YEAST|MPR1_YEAST Proteasome regulatory subunit RPN11 (MPR1 p...   125   2e-27   Saccharomyces cerevisiae [brewer's yeast]
gb:GCY249916_1385233 Geodia cydonium mRNA for putative multidrug...   124   3e-27   
gb:AC104707_1737756 Oryza sativa (japonica cultivar-group) chrom...   124   4e-27   
gb:AY152546_1585221 Saccharomyces cerevisiae 26S proteasome regu...   124   4e-27   
gb:AB037152_1519109 Oryza sativa (japonica cultivar-group) OsRPN...   124   4e-27   
gb:BC045094_2549046 Xenopus laevis 26S proteasome-associated pad...   124   5e-27   
gb:AE016820_1749959 Ashbya gossypii (= Eremothecium gossypii) AT...   124   5e-27   
gb:AX969775_1485084 Sequence 578 from Patent EP1104808.               124   5e-27   
gb:CNS07EGH_1374233 chromosome XI of strain GB-M1 of Encephalito...   123   9e-27   
sp|P41883|YPT5_CAEEL|YPT5_CAEEL Hypothetical 35.8 kDa protein F37A4.5 in ch...   122   1e-26   Caenorhabditis elegans [roundworm]
gb:AF014465_1231880 Schistosoma mansoni Pad1 homolog (SmPOH) mRN...   122   2e-26   
gb:CR382132_1666042 Yarrowia lipolytica chromosome F of strain C...   121   3e-26   
sp|P41878|RPNB_SCHPO|RPNB_SCHPO 26S proteasome regulatory subunit rpn11.>pi...   121   3e-26   Schizosaccharomyces pombe
gb:SDO249917_1397406 Aphrocallistes vastus mRNA for putative mul...   120   5e-26   
gb:AVA245813_1285862 Aphrocallistes vastus mRNA for potential mu...   120   5e-26   
gb:AE017341_1754051 Cryptococcus neoformans var. neoformans JEC2...   120   6e-26   
gb:AP004324_1840167 Oryza sativa (japonica cultivar-group) genom...   120   8e-26   
pir|T44427|T44427 hypothetical protein - fission yeast (Schizosa...   119   2e-25   Schizosaccharomyces pombe
gb:AF404119_1268497 Trypanosoma brucei proteasome regulatory non...   118   2e-25   
gb:PFMAL13_1191728 Plasmodium falciparum 3D7 chromosome 13, *** ...   118   3e-25   
gb:BX538352_1358973 Cryptosporidium parvum chromosome 6, complet...   117   4e-25   
gb:AJ720599_2502786 Gallus gallus mRNA for hypothetical protein,...   116   1e-24   
pir|E90112|E90112 26S proteasome regulatory subunit [imported] -...   105   2e-21   Guillardia theta
gb:GLA297367_1385348 Giardia lamblia mpr1 gene for non-ATPase su...    92   3e-17   
gb:AF014466_1231881 Schistosoma mansoni trans-spliced variant pr...    90   9e-17   
gb:AP004324_1840168 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
gb:AF195189_1249789 Drosophila melanogaster yippee interacting p...    77   8e-13   
gb:AP006172_1861325 Oryza sativa (japonica cultivar-group) genom...    65   4e-09   
pir|T02766|T02766 adhesin WI-1 - Ajellomyces dermatitidis>gb:BDU...    22   1e-08   Blastomyces dermatitidis
gb:BC082208_2562558 Xenopus laevis MGC99130 protein, mRNA (cDNA ...    54   9e-06   
gb:AY222996_1176461 Schistosoma japonicum clone ZZD1069 mRNA seq...    52   2e-05   
gb:AY093768_1575426 Arabidopsis thaliana At1g80210/F18B13_28 mRN...    50   8e-05   
gb:NCB24G3_1689849 Neurospora crassa DNA linkage group II BAC cl...    50   1e-04   
gb:AF028783_1762367 Hypocrea jecorina proteasome regulatory subu...    49   3e-04   
gb:AY075635_1567776 Arabidopsis thaliana AT3g06820/F3E22_4 mRNA,...    49   3e-04   
gb:AE016814_1745714 Ashbya gossypii (= Eremothecium gossypii) AT...    48   4e-04   
gb:DD1039PPR1_1376824 Dictyostelium discoideum unknown (1039) ge...    48   4e-04   
gb:AK173300_2070234 Mus musculus mRNA for mKIAA1915 protein.           47   6e-04   
gb:AC104713_1737853 Oryza sativa (japonica cultivar-group) chrom...    47   8e-04   
gb:ATAC023912_1543773 Arabidopsis thaliana chromosome III BAC F3...    47   8e-04   
gb:BX942841_2568113 Zebrafish DNA sequence from clone CH211-59D1...    47   0.001   
gb:BX293995_1991748 Human DNA sequence from clone RP11-143H17 on...    46   0.001   
gb:AK011876_1156639 Mus musculus 10 days embryo whole body cDNA,...    46   0.001   
pir|I38167|I38167 hypothetical CpG-island associated protein C6....    46   0.001   Homo sapiens [man]
sp|P46737|C61A_MOUSE|C61A_MOUSE C6.1A protein.>gb:AK030736_1162148 Mus musc...    46   0.001   Mus musculus [mouse]
gb:S68015_2040959 c6.1A [human, mRNA, 1020 nt].                        46   0.002   
gb:AL450024_1927860 Human DNA sequence from clone RP11-162J4 on ...    46   0.002   
gb:AB067502_1870810 Homo sapiens mRNA for KIAA1915 protein, part...    46   0.002   
gb:AX399998_1467311 Sequence 169 from Patent WO0218424.                46   0.002   
gb:CR859371_1183489 Pongo pygmaeus mRNA; cDNA DKFZp459H1729 (fro...    46   0.002   
pir|T41067|T41067 26S proteasome regulatory subunit 12 - fission...    46   0.002   Schizosaccharomyces pombe
sp|P46736|C61A_HUMAN|C61A_HUMAN C6.1A protein.>gb:AY438030_1950665 Homo sap...    46   0.002   Homo sapiens [man]
gb:S72931_2041284 Homo sapiens T-cell receptor alpha chain-c6.1A...    45   0.002   
gb:AF285833_1783147 Arabidopsis thaliana eukaryotic initiation f...    45   0.002   
gb:CR382138_1671529 Debaryomyces hansenii chromosome F of strain...    45   0.002   
sp|Q9C5Z2|IF33_ARATH|IF33_ARATH Eukaryotic translation initiation factor 3 ...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AY558039_1614266 Saccharomyces cerevisiae clone FLH006585.01X...    45   0.003   
pir|S67158|S67158 26S proteasome regulatory particle chain RPN8 ...    45   0.003   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382129_1661323 Yarrowia lipolytica chromosome C of strain C...    45   0.004   
gb:CR380957_1652895 Candida glabrata strain CBS138 chromosome K ...    45   0.004   
gb:BC044358_2548668 Danio rerio proteasome (prosome, macropain) ...    44   0.005   
gb:AP003284_1827238 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
gb:CR382130_1663132 Yarrowia lipolytica chromosome D of strain C...    44   0.005   
gb:CR382123_1655885 Kluyveromyces lactis strain NRRL Y-1140 chro...    43   0.012   
gb:AC098833_1736909 Oryza sativa (japonica cultivar-group) chrom...    42   0.027   
gb:BC061390_2553164 Xenopus tropicalis hypothetical protein MGC7...    42   0.035   
gb:CNS07EGB_1373112 chromosome IV of strain GB-M1 of Encephalito...    42   0.035   
gb:BC088002_2565516 Xenopus tropicalis cDNA clone MGC:107920 IMA...    41   0.046   
gb:BC081139_2562042 Xenopus laevis MGC84052 protein, mRNA (cDNA ...    41   0.046   
gb:BC078476_2561017 Xenopus laevis cDNA clone IMAGE:6872787, par...    41   0.046   
gb:BC077668_2560363 Xenopus tropicalis Psmd7 protein, mRNA (cDNA...    41   0.046   
gb:AJ719835_2502022 Gallus gallus partial mRNA for hypothetical ...    41   0.046   
gb:BC000338_1966628 Homo sapiens proteasome (prosome, macropain)...    41   0.046   
gb:BT012645_1641715 Arabidopsis thaliana At1g10600 mRNA, complet...    41   0.046   
gb:AK031013_1162255 Mus musculus adult male thymus cDNA, RIKEN f...    41   0.046   
pir|S65491|S65491 26S proteasome regulatory chain 12 - human           41   0.046   Homo sapiens [man]
pir|JC4154|JC4154 26S proteasome regulatory chain, p40 - human>g...    41   0.046   Homo sapiens [man]
sp|P26516|PSD7_MOUSE|PSD7_MOUSE 26S proteasome non-ATPase regulatory subuni...    41   0.046   Mus musculus [mouse]
sp|P51665|PSD7_HUMAN|PSD7_HUMAN 26S proteasome non-ATPase regulatory subuni...    41   0.046   Homo sapiens [man]
gb:BC068799_2555299 Xenopus laevis hypothetical protein MGC81376...    41   0.060   
gb:AE017341_1753875 Cryptococcus neoformans var. neoformans JEC2...    39   0.18    
gb:SPAC19B12_1716908 S.pombe chromosome I cosmid c19B12.               39   0.18    
gb:AP005838_1858819 Oryza sativa (japonica cultivar-group) genom...    39   0.23    
pir|D70446|D70446 conserved hypothetical protein aq_1691 - Aquif...    39   0.23    Aquifex aeolicus
gb:HSM806021_2018139 Homo sapiens mRNA; cDNA DKFZp313C082 (from ...    38   0.39    
gb:AE013599_1133765 Drosophila melanogaster chromosome 2R, compl...    38   0.51    
gb:AP003331_1828036 Oryza sativa (japonica cultivar-group) genom...    37   0.67    
gb:BC074422_2557927 Xenopus laevis MGC84444 protein, mRNA (cDNA ...    37   0.87    
gb:AP004224_1838931 Oryza sativa (japonica cultivar-group) genom...    37   0.87    
gb:AX886042_1481495 Sequence 1905 from Patent EP1033401.               37   0.87    
gb:BC056382_2102355 Mus musculus sex comb on midleg-like 2 (Dros...    20   1.4     
gb:BC082885_2562959 Xenopus laevis hypothetical LOC494775, mRNA ...    36   1.9     
gb:AF164597_2477920 Lapemis hardwickii AMSH-like mRNA, complete ...    36   1.9     
gb:AY084581_1569669 Arabidopsis thaliana clone 112350 mRNA, comp...    36   1.9     
gb:AY072212_1567099 Arabidopsis thaliana unknown protein (At1g48...    36   1.9     
gb:AC073555_1541083 Arabidopsis thaliana chromosome 1 BAC F11I4 ...    36   1.9     
gb:CR861012_1185047 Pongo pygmaeus mRNA; cDNA DKFZp459M0218 (fro...    36   1.9     
sp|P26270|PSD7_DROME|PSD7_DROME 26S proteasome non-ATPase regulatory subuni...    36   1.9     Drosophila melanogaster
gb:AL157394_1920888 Human DNA sequence from clone RP11-399O19 on...    35   2.5     
gb:AL157394_1920886 Human DNA sequence from clone RP11-399O19 on...    35   2.5     
gb:AB037794_1866585 Homo sapiens mRNA for KIAA1373 protein, part...    35   2.5     
gb:BT020354_1642749 Arabidopsis thaliana At4g16144 gene, complet...    35   2.5     
pir|JC7982|JC7982 AMSH-like protein (AMSH-LP) - Human>gb:AB01012...    35   2.5     Homo sapiens [man]
gb:AY075309_1296157 Drosophila melanogaster AT31826 full insert ...    35   4.3     
gb:AE014297_1142186 Drosophila melanogaster chromosome 3R, compl...    35   4.3     
gb:AY083159_2075977 Rattus norvegicus AMSH mRNA, complete cds.>g...    34   5.7     
gb:AF175409_1887943 Homo sapiens MOT8 mRNA, complete cds.>gb:AL3...    34   5.7     
gb:AK017600_1159233 Mus musculus 8 days embryo whole body cDNA, ...    34   5.7     
gb:AY458641_619591 Uncultured bacterium 463 clone EBAC080-L32B05...    34   5.7     
gb:AE017311_438819 Desulfovibrio vulgaris subsp. vulgaris str. H...    34   5.7     
sp|O24412|PSD7_ARATH|PSD7_ARATH Probable 26S proteasome non-ATPase regulato...    34   5.7     Arabidopsis thaliana [mouse-ear cress]
gb:BC018343_2092664 Mus musculus RIKEN cDNA 1700095N21 gene, mRN...    34   7.4     
gb:BC017625_2092521 Mus musculus RIKEN cDNA E130307M08 gene, mRN...    34   7.4     
gb:AB066212_2047115 Mus musculus mRNA for ALM beta, complete cds.      34   7.4     
gb:AB010121_2043512 Mus musculus mRNA for AMSH-LP, complete cds....    34   7.4     
gb:AK005113_1152833 Mus musculus adult male cerebellum cDNA, RIK...    34   7.4     
gb:AC007292_1875244 Homo sapiens chromosome 19, cosmid R31167, c...    33   9.7     
gb:AC073395_1541032 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    33   9.7     
gb:BX572100_799155 Prochlorococcus marinus MIT9313 complete geno...    33   9.7     
gb:AE015724_317217 Shewanella oneidensis MR-1 section 273 of 457...    33   9.7     


>gb:AF175964_1774526 Lycopersicon esculentum JAB mRNA, complete cds.
          Length = 367

 Score =  616 bits (1589), Expect = e-175
 Identities = 304/367 (82%), Positives = 326/367 (88%)
 Frame = +2

Query: 77   MDSFTSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPW 256
            ++S+ SSAA+AQ+TWE+ENN+ T D P               IF+YD+ AQTKFQ+EKPW
Sbjct: 4    LNSYASSAAMAQQTWELENNIVTTDAP---SGSAPENSASDAIFHYDDAAQTKFQREKPW 60

Query: 257  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET 436
            T+DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET
Sbjct: 61   TSDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET 120

Query: 437  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF 616
            RVNAQADAYEYMV+YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDV+TQMLNQQ+QEPF
Sbjct: 121  RVNAQADAYEYMVEYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVTTQMLNQQYQEPF 180

Query: 617  LAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD 796
            LAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPD+P+SEYQTIPLNKIEDFGVHCKQYYSLD
Sbjct: 181  LAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDDPISEYQTIPLNKIEDFGVHCKQYYSLD 240

Query: 797  ITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRF 976
            ITYFK           WNKYWVNTLSSSPLL NGDYVAGQISDLAEK+EQAEN LSHSRF
Sbjct: 241  ITYFKSSLDCHLLDLLWNKYWVNTLSSSPLLENGDYVAGQISDLAEKMEQAENHLSHSRF 300

Query: 977  GPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSG 1156
            G L+A  QRKKEEESQLAKIT DSAKITVEQVHGLMSQVIKDILFN+V +S +S+TE S 
Sbjct: 301  GHLVAAPQRKKEEESQLAKITRDSAKITVEQVHGLMSQVIKDILFNSVCKSGKSQTEPSD 360

Query: 1157 PEPMVET 1177
            PEPMVET
Sbjct: 361  PEPMVET 367



>pir|T09261|T09261 JUN kinase-activation-domain-binding protein
            homolog - alfalfa>gb:AF014375_1761346 Medicago sativa
            putative JUN kinase activation domain binding protein
            mRNA, complete cds.
          Length = 357

 Score =  612 bits (1579), Expect = e-174
 Identities = 301/365 (82%), Positives = 322/365 (88%)
 Frame = +2

Query: 83   SFTSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTN 262
            S +SS+AIAQ+TWE+ENN+  M+ P               IF+YDE  Q +FQ++KPW N
Sbjct: 4    SSSSSSAIAQQTWELENNIIPMETP-----------SDDSIFHYDEAGQAEFQRDKPWAN 52

Query: 263  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV 442
            DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTD D+IIVMDAFALPVEGTETRV
Sbjct: 53   DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDADSIIVMDAFALPVEGTETRV 112

Query: 443  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
            NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA
Sbjct: 113  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 172

Query: 623  VVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDIT 802
            VVIDPTRTVSAGKVEIGAFRTYPEGYKP D+P+SEYQTIPLNKIEDFGVHCKQYYSLDIT
Sbjct: 173  VVIDPTRTVSAGKVEIGAFRTYPEGYKPADDPISEYQTIPLNKIEDFGVHCKQYYSLDIT 232

Query: 803  YFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGP 982
            YFK           WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQL+HSRFGP
Sbjct: 233  YFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGP 292

Query: 983  LIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPE 1162
            L+AP  RKKEEES LAKIT DSAKITVEQVHGLMSQVIKDILFN+V Q+N+S TE+S PE
Sbjct: 293  LVAPTPRKKEEESPLAKITRDSAKITVEQVHGLMSQVIKDILFNSVHQANKSHTETSDPE 352

Query: 1163 PMVET 1177
            PM+E+
Sbjct: 353  PMIES 357



>pir|H96736|H96736 hypothetical protein F3I17.12 [imported] -
            Arabidopsis thaliana>gb:AE005173_894698 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC016162_1538104 Arabidopsis thaliana
            chromosome 1 BAC F3I17 genomic sequence, complete
            sequence.>gb:AY124816_1580181 Arabidopsis thaliana
            At1g71230/F3I17_12 mRNA, complete
            cds.>gb:AF395061_1795554 Arabidopsis thaliana CSN complex
            subunit 5A (CSN5A) mRNA, complete
            cds.>gb:AF411778_1797243 Arabidopsis thaliana
            At1g71230/F3I17_12 mRNA, complete cds.
          Length = 358

 Score =  575 bits (1482), Expect = e-163
 Identities = 287/362 (79%), Positives = 313/362 (86%), Gaps = 2/362 (0%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            SS+ IA+KTWE+EN++ T+D P +             IFYYD+T+QT+FQQEKPW NDPH
Sbjct: 4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH 54

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct: 55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ 114

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQQ QEPFLAVVI
Sbjct: 115  DDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVI 174

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRTVSAGKVEIGAFRTY +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD+TYFK
Sbjct: 175  DPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFK 234

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI- 988
                       WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAE+ L  SRFG ++ 
Sbjct: 235  SSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVP 294

Query: 989  APAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEP 1165
            +   +KKE+ESQL KIT DSAKITVEQVHGLMSQVIKD LFN++RQS N+S T+SS P+P
Sbjct: 295  SSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDP 354

Query: 1166 MV 1171
            M+
Sbjct: 355  MI 356



>pir|T52042|T52042 constitutive photomorphogenic 9 complex chain AJH2
            [validated] - Arabidopsis thaliana>gb:AF087412_1767235
            Arabidopsis thaliana AJH2 mRNA, complete cds.
          Length = 358

 Score =  575 bits (1482), Expect = e-163
 Identities = 287/362 (79%), Positives = 313/362 (86%), Gaps = 2/362 (0%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            SS+ IA+KTWE+EN++ T+D P +             IFYYD+T+QT+FQQEKPW NDPH
Sbjct: 4    SSSTIARKTWELENSILTVDSPDSTSDN---------IFYYDDTSQTRFQQEKPWENDPH 54

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFKRVKISALALLKMVVHARSGGTIE+MGLMQGKTDGD IIVMDAFALPVEGTETRVNAQ
Sbjct: 55   YFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQ 114

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             DAYEYMV+YSQTNK AGRLENVVGWYHSHPGYGCWLSGIDVSTQ LNQQ QEPFLAVVI
Sbjct: 115  DDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQTLNQQHQEPFLAVVI 174

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRTVSAGKVEIGAFRTY +GYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD+TYFK
Sbjct: 175  DPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFK 234

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI- 988
                       WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAE+ L  SRFG ++ 
Sbjct: 235  SSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVP 294

Query: 989  APAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS-NRSRTESSGPEP 1165
            +   +KKE+ESQL KIT DSAKITVEQVHGLMSQVIKD LFN++RQS N+S T+SS P+P
Sbjct: 295  SSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDP 354

Query: 1166 MV 1171
            M+
Sbjct: 355  MI 356



>pir|C86363|C86363 Jun activation domain binding protein homolog -
            Arabidopsis thaliana>gb:AE005172_891244 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:ATAF000657_1543817 Arabidopsis thaliana BAC
            F19G10, complete sequence.>gb:AF042334_1763636
            Arabidopsis thaliana JAB1 (JAB1) mRNA, complete
            cds.>gb:AF395062_1795555 Arabidopsis thaliana CSN complex
            subunit 5B (CSN5B) mRNA, complete cds.
          Length = 357

 Score =  562 bits (1449), Expect = e-159
 Identities = 284/362 (78%), Positives = 313/362 (86%), Gaps = 2/362 (0%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            SS+AIA+KTWE+ENN+  + + PT             IF+YD+ +Q K QQEKPW +DP+
Sbjct: 4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN 54

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct: 55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ 114

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQ+QEPFLAVVI
Sbjct: 115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVI 174

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRTVSAGKVEIGAFRTYPEG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFK
Sbjct: 175  DPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 234

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IA
Sbjct: 235  SSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IA 293

Query: 992  PA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEP 1165
            PA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEP
Sbjct: 294  PAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEP 353

Query: 1166 MV 1171
            M+
Sbjct: 354  MI 355



>gb:AY087510_1572541 Arabidopsis thaliana clone 36216 mRNA, complete
            sequence.
          Length = 357

 Score =  562 bits (1448), Expect = e-159
 Identities = 284/362 (78%), Positives = 313/362 (86%), Gaps = 2/362 (0%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            SS+AIA+KTWE+ENN+  + + PT             IF+YD+ +Q K QQEKPW +DP+
Sbjct: 4    SSSAIARKTWELENNI--LRVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN 54

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct: 55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ 114

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQ+QEPFLAVVI
Sbjct: 115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVI 174

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRTVSAGKVEIGAFRTYPEG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFK
Sbjct: 175  DPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 234

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IA
Sbjct: 235  SSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IA 293

Query: 992  PA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEP 1165
            PA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEP
Sbjct: 294  PAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEP 353

Query: 1166 MV 1171
            M+
Sbjct: 354  MI 355



>pir|T02934|T02934 JUN-activation-domain-binding protein homolog -
            rice>gb:AB055495_1521475 Oryza sativa Jab1 mRNA for
            JUN-activation-domain-binding protein homolog, complete
            cds.>gb:AB095022_1525287 Oryza sativa (japonica
            cultivar-group) Jab1 gene for
            JUN-activation-domain-binding protein 1, complete
            cds.>gb:OSJN00016_1693322 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBb0022F16, complete
            sequence.>gb:AF072849_1765908 Oryza sativa subsp. indica
            jab1 protein (jab1) mRNA, complete cds.
          Length = 360

 Score =  561 bits (1447), Expect = e-159
 Identities = 283/366 (77%), Positives = 309/366 (84%), Gaps = 4/366 (1%)
 Frame = +2

Query: 89   TSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDP 268
            TSSAA+A++TWE+ENN+      P              I+ YDE AQ + QQEKPW NDP
Sbjct: 4    TSSAAMARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDP 54

Query: 269  HYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
            H F+R KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNA
Sbjct: 55   HPFRRAKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNA 114

Query: 449  QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
            QADAYEYMV+YS  NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV
Sbjct: 115  QADAYEYMVEYSTINKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 174

Query: 629  IDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYF 808
            IDPTRTVSAGKVEIGAFRTYP+ YKPPDEPVSEYQTIPLNKIEDFGVHCKQYY+LDITYF
Sbjct: 175  IDPTRTVSAGKVEIGAFRTYPKDYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYALDITYF 234

Query: 809  KXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLI 988
            K           WNKYWVNTLSSSPLLGN DYVAGQI DLA+KLEQAE QL+HSR+G ++
Sbjct: 235  KSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDLADKLEQAEGQLAHSRYG-ML 293

Query: 989  APAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRT---ESSG 1156
             P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDILFN+V  SN++ T   +SSG
Sbjct: 294  MPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDILFNSVHPSNKASTSAPDSSG 353

Query: 1157 PEPMVE 1174
            PEPMVE
Sbjct: 354  PEPMVE 359



>pir|T52180|T52180 constitutive photomorphogenic 9 complex chain AJH1
            [validated] - Arabidopsis thaliana>gb:AX250401_1464798
            Sequence 7 from Patent WO0168863.>gb:AF087413_1767236
            Arabidopsis thaliana AJH1 mRNA, complete cds.
          Length = 357

 Score =  557 bits (1436), Expect = e-157
 Identities = 283/362 (78%), Positives = 312/362 (86%), Gaps = 2/362 (0%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            SS+AIA+KTWE+ENN+  + + PT             IF+YD+ +Q K QQEKPW +DP+
Sbjct: 4    SSSAIARKTWELENNI--LPVEPTDSASDS-------IFHYDDASQAKIQQEKPWASDPN 54

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFKRV ISALALLKMVVHARSGGTIE+MGLMQGKT+GD IIVMDAFALPVEGTETRVNAQ
Sbjct: 55   YFKRVHISALALLKMVVHARSGGTIEIMGLMQGKTEGDTIIVMDAFALPVEGTETRVNAQ 114

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            +DAYEYMV+YSQT+K AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQ+QEPFLAVVI
Sbjct: 115  SDAYEYMVEYSQTSKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQYQEPFLAVVI 174

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRTVSAGKVEIGAFRTYPEG+K  D+ VSEYQTIPLNKIEDFGVHCKQYYSLDITYFK
Sbjct: 175  DPTRTVSAGKVEIGAFRTYPEGHKISDDHVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 234

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                        NKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAE+QL++SR+G  IA
Sbjct: 235  SSLDSHLLDLLGNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESQLANSRYGG-IA 293

Query: 992  PA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSGPEP 1165
            PA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+ RQS +S  +SS PEP
Sbjct: 294  PAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNSARQSKKSADDSSDPEP 353

Query: 1166 MV 1171
            M+
Sbjct: 354  MI 355



>gb:OSJN00090_1694714 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0071I13, complete sequence.
          Length = 377

 Score =  540 bits (1390), Expect = e-152
 Identities = 278/386 (72%), Positives = 304/386 (78%), Gaps = 29/386 (7%)
 Frame = +2

Query: 104  IAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYFKR 283
            +A++TWE+ENN+      P              I+ YDE AQ + QQEKPW NDPH F+R
Sbjct: 1    MARQTWELENNIPAAASDPDALDA---------IYRYDEAAQARVQQEKPWANDPHPFRR 51

Query: 284  VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
             KISALALLKMVVHAR+GGTIEVMGLMQGK +GDAI+VMDAFALPVEGTETRVNAQADAY
Sbjct: 52   AKISALALLKMVVHARAGGTIEVMGLMQGKCEGDAIVVMDAFALPVEGTETRVNAQADAY 111

Query: 464  EYMVDYSQTNKQ-------------------------AGRLENVVGWYHSHPGYGCWLSG 568
            EYMV+YS  NKQ                         AGRLENVVGWYHSHPGYGCWLSG
Sbjct: 112  EYMVEYSTINKQIGSHHAIDHNVSEVSVFANTLMTDLAGRLENVVGWYHSHPGYGCWLSG 171

Query: 569  IDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLN 748
            IDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYP+ YKPPDEPVSEYQTIPLN
Sbjct: 172  IDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPKDYKPPDEPVSEYQTIPLN 231

Query: 749  KIEDFGVHCKQYYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDL 928
            KIEDFGVHCKQYY+LDITYFK           WNKYWVNTLSSSPLLGN DYVAGQI DL
Sbjct: 232  KIEDFGVHCKQYYALDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNRDYVAGQIFDL 291

Query: 929  AEKLEQAENQLSHSRFGPLIAPAQRKKE-EESQLAKITCDSAKITVEQVHGLMSQVIKDI 1105
            A+KLEQAE QL+HSR+G ++ P+QRKKE EES LAK+T DS+KIT EQVHGLMSQVIKDI
Sbjct: 292  ADKLEQAEGQLAHSRYG-MLMPSQRKKEQEESPLAKVTRDSSKITAEQVHGLMSQVIKDI 350

Query: 1106 LFNTVRQSNRSRT---ESSGPEPMVE 1174
            LFN+V  SN++ T   +SSGPEPMVE
Sbjct: 351  LFNSVHPSNKASTSAPDSSGPEPMVE 376



>gb:BC062499_2553379 Xenopus tropicalis COP9 signalosome subunit 5,
            mRNA (cDNA clone MGC:76063 IMAGE:5307562), complete cds.
          Length = 334

 Score =  449 bits (1155), Expect = e-125
 Identities = 218/343 (63%), Positives = 256/343 (74%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            + +++AQKTWE+ NN++ +                  I+ YD+  Q +    KPWT D H
Sbjct: 4    AGSSVAQKTWELSNNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  K+SALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKVSALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI 331



>gb:AJ719811_2501998 Gallus gallus mRNA for hypothetical protein,
            clone 6l21.
          Length = 338

 Score =  448 bits (1153), Expect = e-124
 Identities = 221/346 (63%), Positives = 255/346 (73%)
 Frame = +2

Query: 83   SFTSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTN 262
            S +S + +AQKTWE+ NN++                    I+ YD   Q +    KPWT 
Sbjct: 5    SGSSGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDRKQQQEILAAKPWTK 51

Query: 263  DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV 442
            D HYFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRV
Sbjct: 52   DHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRV 111

Query: 443  NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
            NAQA AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+A
Sbjct: 112  NAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVA 171

Query: 623  VVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDIT 802
            VVIDPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++
Sbjct: 172  VVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVS 231

Query: 803  YFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGP 982
            YFK           WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  
Sbjct: 232  YFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF-- 289

Query: 983  LIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
            ++      K+ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct: 290  MLGLETHDKKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI 335



>gb:BC074434_2557938 Xenopus laevis MGC84682 protein, mRNA (cDNA clone
            MGC:84682 IMAGE:6946035), complete cds.
          Length = 332

 Score =  448 bits (1152), Expect = e-124
 Identities = 217/343 (63%), Positives = 256/343 (74%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            + +++AQKTWE+ NN++ +                  I+ YD+  Q +    KPWT D H
Sbjct: 2    AGSSVAQKTWELSNNMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 48

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  K+SALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 49   YFKYCKVSALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 108

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 109  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 168

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L++TYFK
Sbjct: 169  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVTYFK 228

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N +Y  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 229  SSLDRKLLELLWNKYWVNTLSSSSLLTNAEYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 286

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct: 287  LESHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI 329



>gb:BT008168_2151100 Synthetic construct Homo sapiens COP9
            constitutive photomorphogenic homolog subunit 5
            (Arabidopsis) mRNA, partial cds.
          Length = 335

 Score =  447 bits (1150), Expect = e-124
 Identities = 220/346 (63%), Positives = 255/346 (73%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            S + +AQKTWE+ NN++                    I+ YD+  Q +    KPWT D H
Sbjct: 4    SGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS 1129
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +  S
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS 334



>gb:BC001187_1967367 Homo sapiens COP9 constitutive photomorphogenic
            homolog subunit 5 (Arabidopsis), mRNA (cDNA clone
            MGC:3149 IMAGE:3354130), complete
            cds.>gb:BC001859_1967910 Homo sapiens COP9 constitutive
            photomorphogenic homolog subunit 5 (Arabidopsis), mRNA
            (cDNA clone MGC:4661 IMAGE:3530890), complete
            cds.>gb:BC007272_1970600 Homo sapiens COP9 constitutive
            photomorphogenic homolog subunit 5 (Arabidopsis), mRNA
            (cDNA clone MGC:15591 IMAGE:3161025), complete
            cds.>gb:CR541678_1993908 Homo sapiens full open reading
            frame cDNA clone RZPDo834D0428D for gene COPS5, COP9
            constitutive photomorphogenic homolog subunit 5
            (Arabidopsis); complete cds, without stopcodon.
          Length = 334

 Score =  447 bits (1150), Expect = e-124
 Identities = 220/346 (63%), Positives = 255/346 (73%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            S + +AQKTWE+ NN++                    I+ YD+  Q +    KPWT D H
Sbjct: 4    SGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS 1129
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +  S
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS 334



>gb:AK012499_1156995 Mus musculus 11 days embryo whole body cDNA,
            RIKEN full-length enriched library, clone:2700067H17
            product:COP9 (constitutive photomorphogenic) homolog,
            subunit 5 (Arabidopsis thaliana), full insert
            sequence.>gb:AF065386_2053117 Mus musculus Jun
            coactivator Jab1 (Jab1) mRNA, complete
            cds.>gb:AF068223_2053226 Mus musculus Kip1 C-terminus
            interacting protein-2 (Kic2) mRNA, complete
            cds.>gb:BC046753_2099337 Mus musculus COP9 (constitutive
            photomorphogenic) homolog, subunit 5 (Arabidopsis
            thaliana), mRNA (cDNA clone MGC:57909 IMAGE:5693100),
            complete cds.>gb:MMU70736_2123298 Mus musculus 38 kDa
            Mov34 homolog mRNA, complete cds.
          Length = 334

 Score =  447 bits (1149), Expect = e-124
 Identities = 219/343 (63%), Positives = 254/343 (74%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            S + +AQKTWE+ NN++                    I+ YD+  Q +    KPWT D H
Sbjct: 4    SGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQI 331



>gb:BC059493_2552470 Danio rerio zgc:73130, mRNA (cDNA clone MGC:73130
            IMAGE:4789910), complete cds.
          Length = 334

 Score =  446 bits (1147), Expect = e-124
 Identities = 219/346 (63%), Positives = 256/346 (73%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            + ++IA KTWE+ N+++ +                  I+ YD+  Q +    KPWT D H
Sbjct: 2    AGSSIAMKTWELSNSMQEVQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 48

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  K+SALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 49   YFKYCKLSALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 108

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 109  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 168

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 169  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 228

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQAE QL    F  ++ 
Sbjct: 229  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQAEAQLGRGSF--MLG 286

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS 1129
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN V  S
Sbjct: 287  LDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQVNTS 332



>pir|S71820|S71820 JUN-activation-domain-binding protein 1 -
            human>gb:HSU65928_2025526 Human Jun activation domain
            binding protein mRNA, complete cds.
          Length = 334

 Score =  445 bits (1145), Expect = e-124
 Identities = 219/346 (63%), Positives = 254/346 (73%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            S + +AQKTWE+ NN++                    I+ YD+  Q +    KPWT D H
Sbjct: 4    SGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDKKQQQEILAAKPWTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ G LEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGHLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS 1129
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +  S
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS 334



>gb:HSU70734_2025822 Homo sapiens 38 kDa Mov34 homolog mRNA, complete
            cds.
          Length = 334

 Score =  436 bits (1122), Expect = e-121
 Identities = 217/346 (62%), Positives = 252/346 (72%)
 Frame = +2

Query: 92   SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPH 271
            S + +AQKTWE+ NN++                    I+ YD+  Q +       T D H
Sbjct: 4    SGSGMAQKTWELANNMQEAQ-------------SIDEIYKYDKKQQQEILAANLGTKDHH 50

Query: 272  YFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ 451
            YFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQ
Sbjct: 51   YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQ 110

Query: 452  ADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
            A AYEYM  Y +  KQ GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVI
Sbjct: 111  AAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVI 170

Query: 632  DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFK 811
            DPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK
Sbjct: 171  DPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFK 230

Query: 812  XXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIA 991
                       WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ+E QL    F  ++ 
Sbjct: 231  SSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSF--MLG 288

Query: 992  PAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQS 1129
                 ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +  S
Sbjct: 289  LETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS 334



>gb:AF132563_1243648 Drosophila melanogaster LD14392 full insert cDNA.
          Length = 345

 Score =  427 bits (1099), Expect = e-118
 Identities = 210/348 (60%), Positives = 251/348 (72%)
 Frame = +2

Query: 77   MDSFTSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPW 256
            + + T  +  AQKTWE+ENN++T+                  IF YD   Q +    KPW
Sbjct: 14   ISTITMDSDAAQKTWELENNIQTLP-------------SCDEIFRYDAEQQRQIIDAKPW 60

Query: 257  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET 436
              DPH+FK +KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTET
Sbjct: 61   EKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTET 120

Query: 437  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF 616
            RVNAQA AYEYM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ +QEPF
Sbjct: 121  RVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPF 180

Query: 617  LAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD 796
            +A+V+DP RTVSAGKV +GAFRTYP+GYKPP+E  SEYQTIPLNKIEDFGVHCKQYY L+
Sbjct: 181  VAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLE 240

Query: 797  ITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRF 976
            I+YFK           WNKYWVNTL SS LL N +Y  GQI DL+EKLEQ+EN L     
Sbjct: 241  ISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGR--- 297

Query: 977  GPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
                     +K  E +L+K T D ++ T+E +HGLM+Q++KD LFN V
Sbjct: 298  ----GTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKV 341



>gb:AE014297_1139896 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003713_1221889 Drosophila melanogaster
            chromosome 3R, section 51 of 118 of the complete
            sequence.
          Length = 327

 Score =  426 bits (1095), Expect = e-118
 Identities = 209/338 (61%), Positives = 247/338 (73%)
 Frame = +2

Query: 107  AQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYFKRV 286
            AQKTWE+ENN++T+                  IF YD   Q +    KPW  DPH+FK +
Sbjct: 6    AQKTWELENNIQTLP-------------SCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDI 52

Query: 287  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE 466
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct: 53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE 112

Query: 467  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRT 646
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ +QEPF+A+V+DP RT
Sbjct: 113  YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRT 172

Query: 647  VSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKXXXXX 826
            VSAGKV +GAFRTYP+GYKPP+E  SEYQTIPLNKIEDFGVHCKQYY L+I+YFK     
Sbjct: 173  VSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDR 232

Query: 827  XXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRK 1006
                  WNKYWVNTL SS LL N +Y  GQI DL+EKLEQ+EN L              +
Sbjct: 233  RLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGR-------GTDVNE 285

Query: 1007 KEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
            K  E +L+K T D ++ T+E +HGLM+Q++KD LFN V
Sbjct: 286  KRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKV 323



>gb:AF129083_1243390 Drosophila melanogaster COP9 signalosome subunit
            5 CSN5 mRNA, complete cds.
          Length = 327

 Score =  422 bits (1085), Expect = e-117
 Identities = 207/338 (61%), Positives = 247/338 (73%)
 Frame = +2

Query: 107  AQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYFKRV 286
            AQKTWE+ENN++T+                  IF YD   Q +    KPW  DPH+FK +
Sbjct: 6    AQKTWELENNIQTLP-------------SCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDI 52

Query: 287  KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE 466
            KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AY+
Sbjct: 53   KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYK 112

Query: 467  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRT 646
            YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGI+VSTQMLNQ +QEPF+A+V+DP RT
Sbjct: 113  YMTAYMEAAKKVGRMEHAVGWYHSHPGYGCWLSGINVSTQMLNQTYQEPFVAIVVDPVRT 172

Query: 647  VSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKXXXXX 826
            VSAGKV +GAFRTYP+GYKPP+E  SEYQTIPLNKIEDFGVHCKQYY L+I+YFK     
Sbjct: 173  VSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDR 232

Query: 827  XXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPAQRK 1006
                  WNKYWVNTL SS LL N +Y  GQI DL+EKLEQ+EN L              +
Sbjct: 233  RLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGR-------GTDVNE 285

Query: 1007 KEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTV 1120
            K  E +L+K T D ++ T+E +HGLM+Q++KD LFN V
Sbjct: 286  KRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKV 323



>pir|T29320|T29320 hypothetical protein B0547.1 - Caenorhabditis
            elegans>gb:U80814_1406378 Caenorhabditis elegans cosmid
            B0547, complete sequence.
          Length = 368

 Score =  376 bits (966), Expect = e-103
 Identities = 182/364 (50%), Positives = 240/364 (65%)
 Frame = +2

Query: 77   MDSFTSSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPW 256
            +D+   S+++ Q+ WE ENNV+ +D                 IF Y+   Q + +  KPW
Sbjct: 3    VDNVKPSSSVPQRNWEKENNVQNVD----------------SIFEYNNKQQVEIRNAKPW 46

Query: 257  TNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTET 436
              DPHYFK++KISA+ALLKM +HA+ GG +E+MGL+QG+ D ++ I++D FALPVEGTET
Sbjct: 47   DKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTET 106

Query: 437  RVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF 616
            RVNAQA AYEYM  YS+     GR E VVGWYHSHPGYGCWLSGIDVSTQ LNQ+FQEP+
Sbjct: 107  RVNAQAQAYEYMTVYSEMCDTEGRKEKVVGWYHSHPGYGCWLSGIDVSTQTLNQKFQEPW 166

Query: 617  LAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLD 796
            +A+VIDP RT+SAGKV+IGAFRTYPEGY+PPD+  SEYQ+IPL KIEDFGVHCK+YYSLD
Sbjct: 167  VAIVIDPLRTMSAGKVDIGAFRTYPEGYRPPDDVPSEYQSIPLAKIEDFGVHCKRYYSLD 226

Query: 797  ITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRF 976
            +++FK           WN YW++TLSSSPL  N +++  QI D+ +KL   + +L  +  
Sbjct: 227  VSFFKSQLDAHILTSLWNSYWISTLSSSPLFSNVEFLNNQIQDINQKLSAVDKKLQLN-- 284

Query: 977  GPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQSNRSRTESSG 1156
                    R  +    L K+  D+  +  E   G +S ++K +LF          + +S 
Sbjct: 285  -------DRSVDGHEALMKVVTDAKAVGDELETGRISHLVKQLLFARQAGGGCGCSHASA 337

Query: 1157 PEPM 1168
              PM
Sbjct: 338  GSPM 341



>gb:AE017350_1759168 Cryptococcus neoformans var. neoformans JEC21
            chromosome 10, complete sequence.
          Length = 371

 Score =  340 bits (873), Expect = 3e-92
 Identities = 177/364 (48%), Positives = 225/364 (61%), Gaps = 24/364 (6%)
 Frame = +2

Query: 98   AAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYF 277
            A+ A+KT+EI NNV+ +D                 IF Y    +     E PW  DPHYF
Sbjct: 2    ASTARKTFEINNNVQVVD-------------PSAAIFQYSREEEKLLDDEAPWRTDPHYF 48

Query: 278  KRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQAD 457
              VKISA+AL+KMV HARSGG  E+MG+M GK       +MD  ALPV+GTETRVNA  +
Sbjct: 49   HTVKISAVALIKMVTHARSGGIYEIMGIMYGKVRDGTFWIMDVAALPVQGTETRVNAGNE 108

Query: 458  AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
            A EYMV++   N +AG+ E + GWYHSHPGYGCWLSGIDV+TQ+ NQ+F +P+LAVVIDP
Sbjct: 109  AMEYMVNFQTANAEAGKGELLRGWYHSHPGYGCWLSGIDVNTQLNNQKFNDPYLAVVIDP 168

Query: 638  TRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKXX 817
             RTVSAGKVEIGAFRTYPEGY PP    S+YQ+IP++KIEDFGVH   YY L +  +K  
Sbjct: 169  NRTVSAGKVEIGAFRTYPEGYTPPATGNSQYQSIPMDKIEDFGVHANAYYPLKVEIYKSK 228

Query: 818  XXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFGPLIAPA 997
                     WNKYWV TLSS+ L+ N +Y   Q+ DL  KL  A   +S+S     + P 
Sbjct: 229  LDEKMLDLLWNKYWVATLSSNSLVSNLEYSTSQVQDLNAKLRAASQSISNSSSKLKLKPT 288

Query: 998  QRK------------------------KEEESQLAKITCDSAKITVEQVHGLMSQVIKDI 1105
            Q                          +EEE+ L K+T +S++IT E  +G++SQ++K+ 
Sbjct: 289  QPTTKGKETTEGSDKKLKKGEKEFSGVEEEETPLNKVTQESSRITSEAENGIISQLLKEK 348

Query: 1106 LFNT 1117
            LFNT
Sbjct: 349  LFNT 352



>gb:AB070063_1870934 Macaca fascicularis testis cDNA
           clone:QtsA-10115, full insert sequence.
          Length = 195

 Score =  318 bits (816), Expect = 1e-85
 Identities = 147/190 (77%), Positives = 163/190 (85%)
 Frame = +2

Query: 320 VHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQ 499
           +HARSGG +EVMGLM GK DG+ +I+MD+FALPVEGTETRVNAQA AYEYM  Y +  KQ
Sbjct: 1   MHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQ 60

Query: 500 AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAF 679
            GRLEN +GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF+AVVIDPTRT+SAGKV +GAF
Sbjct: 61  VGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAF 120

Query: 680 RTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDITYFKXXXXXXXXXXXWNKYW 859
           RTYP+GYKPPDE  SEYQTIPLNKIEDFGVHCKQYY+L+++YFK           WNKYW
Sbjct: 121 RTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYW 180

Query: 860 VNTLSSSPLL 889
           VNTLSSS LL
Sbjct: 181 VNTLSSSSLL 190



>gb:CR382131_1663658 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 354

 Score =  300 bits (769), Expect = 3e-80
 Identities = 157/355 (44%), Positives = 213/355 (60%), Gaps = 19/355 (5%)
 Frame = +2

Query: 116  TWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYFKRVKIS 295
            T+++EN++  +D  P              ++ YD+  Q       PW  DP YF+ V +S
Sbjct: 6    TFQVENDIVDVDSTPQQGFDRDD------LYKYDDVEQKAILAAHPWRTDPSYFRNVLVS 59

Query: 296  ALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMV 475
            ++AL+KM +HARSGG IEVMG+M GK   +  +VMD + LPVEGTETRVNAQ +  E+MV
Sbjct: 60   SIALVKMAMHARSGGAIEVMGMMTGKILPNTFVVMDCYPLPVEGTETRVNAQQEGIEFMV 119

Query: 476  DYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSA 655
            +Y Q  K  GR EN+VGWYHSHPGYGCWLSGIDV TQ  NQQFQEPFLAVV+DP RT+SA
Sbjct: 120  EYLQGLKDVGRRENIVGWYHSHPGYGCWLSGIDVDTQFQNQQFQEPFLAVVVDPNRTISA 179

Query: 656  GKVEIGAFRTYPEGYKPPDEPV--SEYQTIPLNKIEDFGVHCKQYYSLDITYFKXXXXXX 829
            GKVEIGAFRTYP+ YKPP +    ++ Q++PL+K +D+G H ++YY LD+++FK      
Sbjct: 180  GKVEIGAFRTYPKDYKPPKKATKQNQDQSVPLSKAKDYGAHSERYYELDVSFFKSSLDEN 239

Query: 830  XXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEK-------LEQAENQLSHSRFGPLI 988
                 WNK W  TLS S +  N DY +  + DL+EK       L +   Q     F   +
Sbjct: 240  LLQLLWNKNWAATLSQSTIQLNHDYTSKLMLDLSEKNAQLAIGLGEKTPQSQGRGFREAM 299

Query: 989  APAQRK----------KEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVR 1123
            + A  +          K +   + +   D  +I  +++ GLMS  I+  LF   +
Sbjct: 300  SKADNEPHTNLLNYSTKGQWEAVNRSVKDGVQIGSDELQGLMSLEIQRRLFGRAK 354



>gb:CR382138_1670821 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 469

 Score =  267 bits (682), Expect = 4e-70
 Identities = 135/257 (52%), Positives = 171/257 (66%), Gaps = 5/257 (1%)
 Frame = +2

Query: 209 YYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDA 388
           ++   +     + +PW ++  YFK+  IS+LAL KM VHA+SGG IEVMG+M GK   ++
Sbjct: 38  FFSINSDESIMKARPWKSNAKYFKKTYISSLALCKMSVHAKSGGAIEVMGMMTGKIIKNS 97

Query: 389 IIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSG 568
           IIVMD + LPVEGTETRVNAQA+ YEYMV Y +  KQ GR EN+VGWYHSHPGYGCWLSG
Sbjct: 98  IIVMDVYPLPVEGTETRVNAQAEGYEYMVQYLENLKQVGRDENIVGWYHSHPGYGCWLSG 157

Query: 569 IDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDE--PVSEYQTIP 742
           IDV+TQ LNQ FQ+P+LA+VIDP +T   GKVEIGAFRT+P+ YK PD   P +  + +P
Sbjct: 158 IDVATQSLNQNFQDPYLAIVIDPMKTEDQGKVEIGAFRTFPDNYKSPDSAAPTNNTRGVP 217

Query: 743 LNKIEDFGVHCKQYYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGN--GDYVAGQ 916
            +K +DFGVH  +YYSLDI  FK            NK W+  L  S    N     +   
Sbjct: 218 PSKQKDFGVHSDKYYSLDIQIFKSNLDTEILNIISNKSWIGKLIKSVNTANHQEQNMIEN 277

Query: 917 ISDLAEKLEQAE-NQLS 964
           +  L  KL++ E NQL+
Sbjct: 278 VFKLINKLQKKEVNQLN 294



>gb:AY232223_1177516 Drosophila yakuba clone yak-ad_CSN5 mRNA
           sequence.
          Length = 185

 Score =  263 bits (673), Expect = 4e-69
 Identities = 127/193 (65%), Positives = 148/193 (76%)
 Frame = +2

Query: 107 AQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTNDPHYFKRV 286
           AQKTWE+ENN++T+                  IF YD   Q +    KPW  DPH+FK +
Sbjct: 6   AQKTWELENNIQTLP-------------SCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDI 52

Query: 287 KISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYE 466
           KISALALLKMV+HARSGGT+EVMGLM GK + + +IVMDAFALPVEGTETRVNAQA AYE
Sbjct: 53  KISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYE 112

Query: 467 YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRT 646
           YM  Y +  K+ GR+E+ VGWYHSHPGYGCWLSGIDVSTQMLNQ +QEPF+A+V+DP RT
Sbjct: 113 YMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRT 172

Query: 647 VSAGKVEIGAFRT 685
           VSAGKV +GAFRT
Sbjct: 173 VSAGKVCLGAFRT 185



>gb:AY078082_1935972 Homo sapiens Jun activation domain binding
            protein mRNA, complete cds.
          Length = 179

 Score =  241 bits (615), Expect = 2e-62
 Identities = 118/181 (65%), Positives = 137/181 (75%)
 Frame = +2

Query: 587  MLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFG 766
            MLNQQFQEPF+AVVIDPTRT+SAGKV +GAFRTYP+GYKPPDE  SEYQTIPLNKIEDFG
Sbjct: 1    MLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFG 60

Query: 767  VHCKQYYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQ 946
            VHCKQYY+L+++YFK           WNKYWVNTLSSS LL N DY  GQ+ DL+EKLEQ
Sbjct: 61   VHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQ 120

Query: 947  AENQLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNTVRQ 1126
            +E QL    F  ++      ++ E +LAK T DS K T+E +HGLMSQVIKD LFN +  
Sbjct: 121  SEAQLGRGSF--MLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINI 178

Query: 1127 S 1129
            S
Sbjct: 179  S 179



>sp|O94454|CSN5_SCHPO COP9 signalosome complex subunit 5 (CSN
           complex subunit 5) (SGN5).>pir|T37756|T37756 jun
           activation domain binding protein homolog - fission
           yeast (Schizosaccharomyces pombe)>gb:SPAC1687_1716618
           S.pombe chromosome I cosmid c1687.
          Length = 299

 Score =  240 bits (612), Expect = 5e-62
 Identities = 115/241 (47%), Positives = 156/241 (64%), Gaps = 6/241 (2%)
 Frame = +2

Query: 203 IFYYDETAQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDG 382
           +F +DE  +    +E PW +DP +F+ VKISA+ALLKM+ H   G  +EVMG +QGK +G
Sbjct: 8   VFRFDEEKERAKIRESPWKHDPEFFRSVKISAVALLKMLRHVSQGMPLEVMGYVQGKVEG 67

Query: 383 DAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWL 562
            ++I++D+FALPVEGTETRVNA  +A EY V Y    K   R ENV+GWYHSHP YGCWL
Sbjct: 68  ASLIILDSFALPVEGTETRVNAHEEAQEYSVQYHTLCKSVYRHENVIGWYHSHPNYGCWL 127

Query: 563 SGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEG------YKPPDEPVS 724
           SG+DV TQ  NQ++Q+PF+AVV+DP R++ +  V IGAFRTYP G       K    P  
Sbjct: 128 SGVDVETQRQNQKYQDPFVAVVLDPKRSLESPYVNIGAFRTYPVGNDGSIRTKSRHHPSV 187

Query: 725 EYQTIPLNKIEDFGVHCKQYYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDY 904
            ++ +P +KIED G H + YYSL ITYF             N+ W  +++   +L N ++
Sbjct: 188 LFKNLPSSKIEDAGAHAEAYYSLPITYFHSKAEKKVTEFLRNRNWSRSITECSILQNNEF 247

Query: 905 V 907
           +
Sbjct: 248 L 248



>gb:BT003909_1637034 Arabidopsis thaliana clone RAFL15-21-A19 (R20659)
            putative c-JUN coactivator protein AJH1 (At1g22920) mRNA,
            partial cds.
          Length = 139

 Score =  205 bits (521), Expect = 2e-51
 Identities = 106/138 (76%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = +2

Query: 764  GVHCKQYYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE 943
            GVHCKQYYSLDITYFK           WNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE
Sbjct: 1    GVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLE 60

Query: 944  QAENQLSHSRFGPLIAPA--QRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDILFNT 1117
            QAE+QL++SR+G  IAPA  QR+KE+E QLAKIT DSAKITVEQVHGLMSQVIKDILFN+
Sbjct: 61   QAESQLANSRYGG-IAPAGHQRRKEDEPQLAKITRDSAKITVEQVHGLMSQVIKDILFNS 119

Query: 1118 VRQSNRSRTESSGPEPMV 1171
             RQS +S  +SS PEPM+
Sbjct: 120  ARQSKKSADDSSDPEPMI 137



>gb:AE016815_1746089 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 420

 Score =  195 bits (496), Expect = 1e-48
 Identities = 95/196 (48%), Positives = 133/196 (67%)
 Frame = +2

Query: 224 AQTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMD 403
           +Q + QQE  W  DP YF++  +SALA +K++ HA  GG +EV+G++ G    + I+V+D
Sbjct: 54  SQVRVQQEL-WKQDPTYFQKAALSALACMKILRHAFDGGDMEVLGMLLGYVQDEMIVVVD 112

Query: 404 AFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVST 583
           ++ LPVEGTETRVNAQ ++YEY V Y +T    G    +VGWYHSHPGYGCWLSGID  T
Sbjct: 113 SYRLPVEGTETRVNAQMESYEYTVQYLETAVPEGLA--IVGWYHSHPGYGCWLSGIDAET 170

Query: 584 QMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDF 763
           Q LNQ FQ+P+LA+V+DP R+ ++G ++IGAFRT PE        VS +     +    +
Sbjct: 171 QTLNQNFQDPYLAIVVDPKRSKASGVIDIGAFRTMPE--TADTRSVSSH-----SNASRY 223

Query: 764 GVHCKQYYSLDITYFK 811
           G H  +YY L+++YF+
Sbjct: 224 GHHSARYYELEVSYFE 239



>gb:CR382124_1656704 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 373

 Score =  171 bits (434), Expect = 2e-41
 Identities = 84/162 (51%), Positives = 113/162 (69%)
 Frame = +2

Query: 263 DPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV 442
           +P +F++  IS LA  KM+ HA  GG IEVMG++ G T  D I+V D ++LPV+GTETRV
Sbjct: 59  NPCHFQKCLISRLATTKMLSHAVDGGDIEVMGMLVGYTSNDMIVVKDCYSLPVQGTETRV 118

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
           NA  ++YEYMV Y   +    + + +VGWYHSHPGYGCWLS ID+ TQ LNQ +Q+P+LA
Sbjct: 119 NAHMESYEYMVQY--LDAFVTKEDKIVGWYHSHPGYGCWLSNIDIQTQSLNQNYQDPYLA 176

Query: 623 VVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLN 748
           +V+DP +++S   ++IGAFRT P   K  +E V  Y   PLN
Sbjct: 177 IVVDPKKSLSGNTLDIGAFRTLPS--KDNNEHVDYY---PLN 213



>gb:CR380953_1650861 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 465

 Score =  160 bits (406), Expect = 4e-38
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
 Frame = +2

Query: 260 NDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETR 439
           N P +++ V +S LA  K++ HA  GG IEVMG++ G   G+  ++ D F LPVEGTET 
Sbjct: 66  NSPLFYQNVLLSKLACSKILCHATKGGNIEVMGMLLGNVIGNTFVIFDCFELPVEGTETM 125

Query: 440 VNAQADAYEYMVDY--SQTNKQAGRLE---NVVGWYHSHPGYGCWLSGIDVSTQMLNQQF 604
           VNA  ++YEYMV +      +   R E   N++GWYHSHPGY CWLS ID+ TQ LNQQ 
Sbjct: 126 VNAHMESYEYMVQFYHEMVERSYTRNEENLNIIGWYHSHPGYDCWLSNIDMQTQSLNQQH 185

Query: 605 QEPFLAVVIDPTRTVSAGKVEIGAFRTYPE 694
           Q+P+LA+V+DP ++ +  KV IG+FRTY +
Sbjct: 186 QDPYLAIVVDPHKSKNDQKVRIGSFRTYQD 215



>pir|S67775|S67775 hypothetical protein YDL216c - yeast
           (Saccharomyces cerevisiae)>gb:CS39KBCIV_1673773
           S.cerevisiae 39kb DNA segment of chromosome
           IV.>gb:SCYDL216C_1711794 S.cerevisiae chromosome IV
           reading frame ORF YDL216c.
          Length = 455

 Score =  149 bits (377), Expect = 9e-35
 Identities = 82/178 (46%), Positives = 109/178 (61%), Gaps = 10/178 (5%)
 Frame = +2

Query: 227 QTKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDA 406
           +TK +Q+   T+ P Y   V IS L+  K+  +A  GG IE+MG++ G T  D I+VMD 
Sbjct: 69  KTKLKQQSS-TDIPSY-THVLISKLSCEKITHYAVRGGNIEIMGILMGFTLKDNIVVMDC 126

Query: 407 FALPVEGTETRVNAQADAYEYMVDY----------SQTNKQAGRLENVVGWYHSHPGYGC 556
           F LPV GTETRVNAQ ++YEYMV Y                 G   NVVGW+HSHPGY C
Sbjct: 127 FNLPVVGTETRVNAQLESYEYMVQYIDEMYNHNDGGDGRDYKGAKLNVVGWFHSHPGYDC 186

Query: 557 WLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEY 730
           WLS ID+ TQ LNQ+FQ+P++A+V+DP +++    + +GAFRT     K  D   + Y
Sbjct: 187 WLSNIDIQTQDLNQRFQDPYVAIVVDPLKSLEDKILRMGAFRTIES--KSDDNSATSY 242



>gb:DDU96916_1377465 Dictyostelium discoideum sks1 multidrug
            resistance protein homolog gene, complete cds.
          Length = 306

 Score =  137 bits (346), Expect = 4e-31
 Identities = 102/289 (35%), Positives = 144/289 (49%), Gaps = 8/289 (2%)
 Frame = +2

Query: 266  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKT-DGDAIIVMDAFALPVEGTETRV 442
            P   + + IS+LALLKM+ HAR+G  +EVMGLM G+  D   I V+D FA+P  GT   V
Sbjct: 25   PDTAETIHISSLALLKMLQHARAGVPLEVMGLMLGELIDEYTIRVIDVFAMPQSGTSVSV 84

Query: 443  NAQADAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFL 619
             A    ++  M+D     KQ GR E V+GWYHSHPG+GCWLS +DV+TQ   +Q Q   +
Sbjct: 85   EAIDPVFQTKMLDML---KQTGRDEIVIGWYHSHPGFGCWLSSVDVNTQQSFEQLQSRAV 141

Query: 620  AVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQ 781
            AVV+DP ++V  GKV I AFRT      P  EP     T  L  ++D  +        + 
Sbjct: 142  AVVVDPLQSV-RGKVVIDAFRTIKT--SPTAEP--RQITSNLGHLQDPSIQALIHGSIRN 196

Query: 782  YYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQL 961
            YYS+ I Y K             K W   L       +      QI++L E  +Q +  +
Sbjct: 197  YYSIAINYRKNELEQKMLLNLHKKKWTEGLIVDKFDTHEQSNEKQINNLLELTKQYQKSI 256

Query: 962  SHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDIL 1108
                        + +K+E S + K+  D  +  +  VH LM+  +  +L
Sbjct: 257  QDE------DKIEPEKKEVSAVGKL--DPKRHLISDVHTLMANNVVRVL 297



>gb:AC117176_1207993 Dictyostelium discoideum chromosome 2 map
            5018074-5200947 strain AX4, complete sequence.
          Length = 306

 Score =  137 bits (346), Expect = 4e-31
 Identities = 102/289 (35%), Positives = 144/289 (49%), Gaps = 8/289 (2%)
 Frame = +2

Query: 266  PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKT-DGDAIIVMDAFALPVEGTETRV 442
            P   + + IS+LALLKM+ HAR+G  +EVMGLM G+  D   I V+D FA+P  GT   V
Sbjct: 25   PDTAETIHISSLALLKMLQHARAGVPLEVMGLMLGELIDEYTIRVIDVFAMPQSGTSVSV 84

Query: 443  NAQADAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFL 619
             A    ++  M+D     KQ GR E V+GWYHSHPG+GCWLS +DV+TQ   +Q Q   +
Sbjct: 85   EAIDPVFQTKMLDML---KQTGRDEIVIGWYHSHPGFGCWLSSVDVNTQQSFEQLQSRAV 141

Query: 620  AVVIDPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQ 781
            AVV+DP ++V  GKV I AFRT      P  EP     T  L  ++D  +        + 
Sbjct: 142  AVVVDPLQSV-RGKVVIDAFRTIKT--SPTAEP--RQITSNLGHLQDPSIQALIHGLNRN 196

Query: 782  YYSLDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQL 961
            YYS+ I Y K             K W   L       +      QI++L E  +Q +  +
Sbjct: 197  YYSIAINYRKNELEQKMLLNLHKKKWTEGLIVDKFDTHEQSNEKQINNLLELTKQYQKSI 256

Query: 962  SHSRFGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDIL 1108
                        + +K+E S + K+  D  +  +  VH LM+  +  +L
Sbjct: 257  QDE------DKIEPEKKEVSAVGKL--DPKRHLISDVHTLMANNVVRVL 297



>gb:CR382125_1657851 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 311

 Score =  129 bits (325), Expect = 1e-28
 Identities = 88/237 (37%), Positives = 121/237 (51%), Gaps = 7/237 (2%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  D 
Sbjct: 32  VYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDV 91

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +DV+TQ   +Q     +AVV+DP
Sbjct: 92  FQAKMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDP 148

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFG--VH--CKQYYSLDIT 802
            ++V  GKV I AFR   P       EP      I L    +    +H   + YYSL+I 
Sbjct: 149 IQSVK-GKVVIDAFRLIDPSTVMRNQEPRQNTSNIGLINKPNIQALIHGLNRHYYSLNID 207

Query: 803 YFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR 973
           Y K             + W + L         ++  G+   + +  EQ   ++   R
Sbjct: 208 YHKTSAEMNMLMNLHKEQWQSGLKMHDFKEREEHNLGETQKMIKIAEQFTKRIEEER 264



>gb:CR382138_1671838 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 311

 Score =  127 bits (318), Expect = 6e-28
 Identities = 84/204 (41%), Positives = 113/204 (55%), Gaps = 8/204 (3%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R+G  +EVMGLM G+  D   I V+D FA+P  GT   V A  D 
Sbjct: 32  VHISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDFTIHVIDVFAMPQSGTGVSVEAVDDV 91

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     +Q GR + VVGWYHSHPG+GCWLS +DV+TQ   +Q  +  +AVV+DP
Sbjct: 92  FQTKMMDML---RQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLNKRAVAVVVDP 148

Query: 638 TRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSLDI 799
            ++V  GKV I AFRT         + P +  S    +    I+   +H   + YYSL+I
Sbjct: 149 IQSVK-GKVVIDAFRTIDTTTLMMGQEPRQTTSNVGHLNKPSIQAL-IHGLNRHYYSLNI 206

Query: 800 TYFKXXXXXXXXXXXWNKYWVNTL 871
            Y K             K W + L
Sbjct: 207 DYHKTSYETNMLLNLHKKNWQSGL 230



>gb:AE014134_1127607 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003608_1217714 Drosophila melanogaster
           chromosome 2L, section 17 of 83 of the complete
           sequence.>gb:AF145313_1244600 Drosophila melanogaster
           26S proteasome regulatory complex subunit p37B mRNA,
           complete cds.>gb:AY070977_1295062 Drosophila
           melanogaster RE07468 full length cDNA.
          Length = 308

 Score =  127 bits (318), Expect = 6e-28
 Identities = 90/235 (38%), Positives = 124/235 (52%), Gaps = 9/235 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 27  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVD 86

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 87  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 143

Query: 632 DPTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYS 790
           DP ++V  GKV I AFR   P       EP     T  L  ++   V        + YYS
Sbjct: 144 DPIQSVK-GKVVIDAFRLINPNMLVLGQEP--RQTTSNLGHLQKPSVQALIHGLNRHYYS 200

Query: 791 LDITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAEN 955
           + I Y K             K W + L+ S      ++ +     +AE L+ A+N
Sbjct: 201 ISINYRKNELEQKMLLNLHKKSWKDGLTLSDY---NEHCSINEDTVAEMLDLAKN 252



>gb:CR380958_1653469 Candida glabrata strain CBS138 chromosome L
            complete sequence.
          Length = 306

 Score =  126 bits (317), Expect = 8e-28
 Identities = 92/258 (35%), Positives = 132/258 (51%), Gaps = 8/258 (3%)
 Frame = +2

Query: 284  VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
            V IS++ALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  D 
Sbjct: 27   VYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVNVVDVFAMPQSGTGVSVEAVDDV 86

Query: 461  YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
            ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +DV+TQ   +Q     +AVV+DP
Sbjct: 87   FQARMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNNRAVAVVVDP 143

Query: 638  TRTVSAGKVEIGAFRTYPEG----YKPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSLDI 799
             ++V  GKV I AFR    G     + P +  S    +    I+   +H   + YYSL+I
Sbjct: 144  IQSVK-GKVVIDAFRLIDTGALINNQEPRQTTSNSGLMNKANIQAL-IHGLNRHYYSLNI 201

Query: 800  TYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSRFG 979
             Y K             + W + L              ++ D  EK  + EN  +  R  
Sbjct: 202  DYHKTPAETKMLLNLHKEQWQSGL--------------KMQDYQEK--ETENLEATKRMV 245

Query: 980  PLIAPAQRKKEEESQLAK 1033
             +     ++ EEE +L++
Sbjct: 246  AVAQQYSKRIEEEKELSE 263



>gb:MM26SPROT_2113733 Mus musculus mRNA for 26S proteasome
           non-ATPase subunit.
          Length = 309

 Score =  125 bits (315), Expect = 1e-27
 Identities = 89/234 (38%), Positives = 123/234 (52%), Gaps = 8/234 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 28  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVD 87

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 88  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 144

Query: 632 DPTRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSL 793
           DP ++V  GKV I AFR            P +  S    +    I+   +H   + YYS+
Sbjct: 145 DPIQSVK-GKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQAL-IHGLNRHYYSI 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAEN 955
            I Y K             K W+  L+   L    ++     S + E LE A+N
Sbjct: 203 TINYRKNELEQKMLLNLHKKSWMEGLT---LQDYSEHCKHNESVVKEMLELAKN 253



>gb:AK012013_1156717 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610312C03
           product:26S proteasome-associated pad1 homolog, full
           insert sequence.>gb:BC066336_1987072 Homo sapiens
           proteasome (prosome, macropain) 26S subunit, non-ATPase,
           14, mRNA (cDNA clone MGC:87397 IMAGE:5296432), complete
           cds.>gb:HSU86782_2026902 Human 26S proteasome-associated
           pad1 homolog (POH1) mRNA, complete
           cds.>gb:BC003742_2089302 Mus musculus proteasome
           (prosome, macropain) 26S subunit, non-ATPase, 14, mRNA
           (cDNA clone MGC:5840 IMAGE:3599671), complete cds.
          Length = 310

 Score =  125 bits (315), Expect = 1e-27
 Identities = 89/234 (38%), Positives = 123/234 (52%), Gaps = 8/234 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 29  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVD 88

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 89  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 145

Query: 632 DPTRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSL 793
           DP ++V  GKV I AFR            P +  S    +    I+   +H   + YYS+
Sbjct: 146 DPIQSVK-GKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQAL-IHGLNRHYYSI 203

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAEN 955
            I Y K             K W+  L+   L    ++     S + E LE A+N
Sbjct: 204 TINYRKNELEQKMLLNLHKKSWMEGLT---LQDYSEHCKHNESVVKEMLELAKN 254



>gb:AK011974_1156694 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610303K13
           product:26S proteasome-associated pad1 homolog, full
           insert sequence.
          Length = 259

 Score =  125 bits (315), Expect = 1e-27
 Identities = 89/234 (38%), Positives = 123/234 (52%), Gaps = 8/234 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 29  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVD 88

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 89  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 145

Query: 632 DPTRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSL 793
           DP ++V  GKV I AFR            P +  S    +    I+   +H   + YYS+
Sbjct: 146 DPIQSVK-GKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQAL-IHGLNRHYYSI 203

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAEN 955
            I Y K             K W+  L+   L    ++     S + E LE A+N
Sbjct: 204 TINYRKNELEQKMLLNLHKKSWMEGLT---LQDYSEHCKHNESVVKEMLELAKN 254



>gb:AB025633_1516591 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQM1.>gb:AY070073_1566715 Arabidopsis thaliana
           putative 26S proteasome, non-ATPase regulatory subunit
           (At5g23540) mRNA, complete cds.>gb:AY091329_1574533
           Arabidopsis thaliana putative 26S proteasome, non-ATPase
           regulatory subunit (At5g23540) mRNA, complete
           cds.>gb:AY230843_1591565 Arabidopsis thaliana 26S
           proteasome subunit RPN11A (RPN11a) mRNA, RPN11a-1
           allele, complete cds.>gb:AY230844_1591566 Arabidopsis
           thaliana 26S proteasome subunit RPN11a (RPN11a) mRNA,
           RPN11a-1 allele, complete cds.>gb:AY230845_1591567
           Arabidopsis thaliana 26S proteasome subunit RPN11
           (RPN11) mRNA, RPN11-2 allele, complete cds.
          Length = 308

 Score =  125 bits (314), Expect = 2e-27
 Identities = 80/207 (38%), Positives = 113/207 (54%), Gaps = 8/207 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V+ +A
Sbjct: 28  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTG--VSVEA 85

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
             + +  +     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   +  +AVV+D
Sbjct: 86  VDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALNQRAVAVVVD 145

Query: 635 PTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSL 793
           P ++V  GKV I AFR+  P+      EP     T  L  +    +        + YYS+
Sbjct: 146 PIQSVK-GKVVIDAFRSINPQTIMLGQEP--RQTTSNLGHLNKPSIQALIHGLNRHYYSI 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLS 874
            I Y K             K W + L+
Sbjct: 203 AINYRKNELEEKMLLNLHKKKWTDGLT 229



>gb:AY086277_1571330 Arabidopsis thaliana clone 23276 mRNA, complete
           sequence.
          Length = 308

 Score =  125 bits (313), Expect = 2e-27
 Identities = 80/207 (38%), Positives = 113/207 (54%), Gaps = 8/207 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V+ +A
Sbjct: 28  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTG--VSVEA 85

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
             + +  +     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   +  +AVV+D
Sbjct: 86  VDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALNQRAVAVVVD 145

Query: 635 PTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSL 793
           P ++V  GKV I AFR+  P+      EP     T  L  +    +        + YYS+
Sbjct: 146 PIQSVK-GKVVIDAFRSINPQTIMLGHEP--RQTTSNLGHLNKPSIQALIHGLNRHYYSI 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLS 874
            I Y K             K W + L+
Sbjct: 203 AINYRKNELEEKMLLNLHKKKWTDGLT 229



>pir|T33344|T33344 hypothetical protein K07D4.3 - Caenorhabditis
           elegans>gb:AF077534_1239215 Caenorhabditis elegans
           cosmid K07D4, complete sequence.
          Length = 312

 Score =  125 bits (313), Expect = 2e-27
 Identities = 79/183 (43%), Positives = 106/183 (57%), Gaps = 9/183 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A    
Sbjct: 33  VYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMPQSGTGVSVEAVDPV 92

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   +  +AVV+DP
Sbjct: 93  FQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSDRAVAVVVDP 149

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSLD 796
            ++V  GKV I AFRT  P+      EP     T  L  ++   +        + YYS+ 
Sbjct: 150 IQSVK-GKVVIDAFRTINPQSMALNQEP--RQTTSNLGHLQKPSIQALIHGLNRHYYSIP 206

Query: 797 ITY 805
           I Y
Sbjct: 207 IAY 209



>sp|P43588|MPR1_YEAST Proteasome regulatory subunit RPN11 (MPR1
            protein).>pir|S56259|S56259 26S proteasome regulatory
            particle chain RPN11 - yeast  (Saccharomyces
            cerevisiae)>gb:AY692755_1622802 Saccharomyces cerevisiae
            clone FLH112885.01X YFR004W gene, complete
            cds.>gb:SCMTP_1708804 S.cerevisiae (GRF88) mpr1
            gene.>gb:YSCCHRVIN_1728514 Saccharomyces cerevisiae
            chromosome VI complete DNA sequence.
          Length = 306

 Score =  125 bits (313), Expect = 2e-27
 Identities = 95/276 (34%), Positives = 136/276 (49%), Gaps = 16/276 (5%)
 Frame = +2

Query: 284  VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
            V IS++ALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  D 
Sbjct: 27   VYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDV 86

Query: 461  YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
            ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +DV+TQ   +Q     +AVV+DP
Sbjct: 87   FQAKMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDP 143

Query: 638  TRTVSAGKVEIGAFRTYPEG----YKPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSLDI 799
             ++V  GKV I AFR    G       P +  S    +    I+   +H   + YYSL+I
Sbjct: 144  IQSVK-GKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQAL-IHGLNRHYYSLNI 201

Query: 800  TYFKXXXXXXXXXXXWNKYWVNTL--------SSSPLLGNGDYVAGQISDLAEKLEQAEN 955
             Y K             + W + L          S L      V  +I++   K  + E 
Sbjct: 202  DYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMV--KIAEQYSKRIEEEK 259

Query: 956  QLSHSRFGPLIAPAQRKKEEESQLAKITCDSAKITV 1063
            +L+           Q  K+  S+ A  T ++  ++V
Sbjct: 260  ELTEEELKTRYVGRQDPKKHLSETADETLENNIVSV 295



>gb:GCY249916_1385233 Geodia cydonium mRNA for putative multidrug
           resistance protein (pohl gene).
          Length = 310

 Score =  124 bits (312), Expect = 3e-27
 Identities = 83/202 (41%), Positives = 108/202 (53%), Gaps = 9/202 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A    
Sbjct: 31  VYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVTVIDVFAMPQSGTGVSVEAVDPV 90

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +      +AVV+DP
Sbjct: 91  FQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFETLSTRAVAVVVDP 147

Query: 638 TRTVSAGKVEIGAFR-TYPEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSLD 796
            ++V  GKV I AFR T P       EP     T  L  ++   +        + YYSL 
Sbjct: 148 IQSVK-GKVVIDAFRLTDPRMQAMGHEP--RQTTSNLGHLQKPSIQALIHGLGRHYYSLP 204

Query: 797 ITYFKXXXXXXXXXXXWNKYWV 862
           I Y K             K W+
Sbjct: 205 INYRKNELEQRMLLNLHKKMWM 226



>gb:AC104707_1737756 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1118_F06, complete sequence.
          Length = 307

 Score =  124 bits (311), Expect = 4e-27
 Identities = 84/207 (40%), Positives = 111/207 (53%), Gaps = 9/207 (4%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V+ +A
Sbjct: 27  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVVDVFAMPQSGTG--VSVEA 84

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
             + +  +     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +      +AVVID
Sbjct: 85  VDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALNPRAVAVVID 144

Query: 635 PTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTI-PLNK------IEDFGVHCKQYYS 790
           P ++V  GKV I AFR   P+      EP      +  LNK      I     H   YYS
Sbjct: 145 PIQSVK-GKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRH---YYS 200

Query: 791 LDITYFKXXXXXXXXXXXWNKYWVNTL 871
           + I Y K             K W + L
Sbjct: 201 IAINYRKNELEEKMLLNLHKKKWTDGL 227



>gb:AY152546_1585221 Saccharomyces cerevisiae 26S proteasome
           regulatory subunit (RPN11) gene, RPN11-1 allele,
           complete cds.
          Length = 306

 Score =  124 bits (311), Expect = 4e-27
 Identities = 82/204 (40%), Positives = 111/204 (54%), Gaps = 8/204 (3%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS++ALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  D 
Sbjct: 27  VYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDV 86

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +DV+TQ   +Q     +AVV+DP
Sbjct: 87  FQAKMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDP 143

Query: 638 TRTVSAGKVEIGAFRTYPEG----YKPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSLDI 799
            ++V  GKV I AFR    G       P +  S    +    I+   +H   + YYSL+I
Sbjct: 144 IQSVK-GKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQAL-IHGLNRHYYSLNI 201

Query: 800 TYFKXXXXXXXXXXXWNKYWVNTL 871
            Y K             + W + L
Sbjct: 202 DYHKTAQETKMLMNLHKEQWQSGL 225



>gb:AB037152_1519109 Oryza sativa (japonica cultivar-group) OsRPN11
           mRNA for 26S proteasome regulatory particle non-ATPase
           subunit11, complete cds.>gb:AP000969_1820687 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           1, clone:P0011D01.
          Length = 307

 Score =  124 bits (311), Expect = 4e-27
 Identities = 84/207 (40%), Positives = 111/207 (53%), Gaps = 9/207 (4%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V+ +A
Sbjct: 27  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVVDVFAMPQSGTG--VSVEA 84

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
             + +  +     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +      +AVVID
Sbjct: 85  VDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALNPRAVAVVID 144

Query: 635 PTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTI-PLNK------IEDFGVHCKQYYS 790
           P ++V  GKV I AFR   P+      EP      +  LNK      I     H   YYS
Sbjct: 145 PIQSVK-GKVVIDAFRLINPQTMMLGQEPRQTTSNVGHLNKPSIQALIHGLNRH---YYS 200

Query: 791 LDITYFKXXXXXXXXXXXWNKYWVNTL 871
           + I Y K             K W + L
Sbjct: 201 IAINYRKNELEEKMLLNLHKKKWTDGL 227



>gb:BC045094_2549046 Xenopus laevis 26S proteasome-associated pad1
           homolog, mRNA (cDNA clone MGC:53911 IMAGE:5569802),
           complete cds.>gb:BC073436_2557276 Xenopus laevis
           MGC80929 protein, mRNA (cDNA clone MGC:80929
           IMAGE:5516050), complete cds.
          Length = 310

 Score =  124 bits (310), Expect = 5e-27
 Identities = 82/207 (39%), Positives = 112/207 (54%), Gaps = 8/207 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 29  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVD 88

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 89  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 145

Query: 632 DPTRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSL 793
           DP ++V  GKV I AFR            P +  S    +    I+   +H   + YYS+
Sbjct: 146 DPIQSVK-GKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQAL-IHGLNRHYYSI 203

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLS 874
            I Y K             K W+  L+
Sbjct: 204 TINYRKNELEQKMLLNLHKKSWMEGLT 230



>gb:AE016820_1749959 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 311

 Score =  124 bits (310), Expect = 5e-27
 Identities = 82/204 (40%), Positives = 110/204 (53%), Gaps = 8/204 (3%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H+R+G  +EVMGLM G   D   + V+D FA+P  GT   V A  D 
Sbjct: 32  VYISSLALLKMLKHSRAGVPMEVMGLMLGDFVDEYTVNVVDVFAMPQSGTGVSVEAVDDV 91

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +DV TQ   +Q     +AVV+DP
Sbjct: 92  FQAKMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDVDTQRSFEQLNSRAVAVVVDP 148

Query: 638 TRTVSAGKVEIGAFRTYPEG----YKPPDEPVSEYQTIPLNKIEDFGVH--CKQYYSLDI 799
            ++V  GKV I AFR          + P +  S    +    I+   +H   + YYSL+I
Sbjct: 149 IQSVK-GKVVIDAFRLISPATVVRNQEPRQTTSNVGLLNKPNIQSL-IHGLNRHYYSLNI 206

Query: 800 TYFKXXXXXXXXXXXWNKYWVNTL 871
            Y K             + W + L
Sbjct: 207 DYHKTSAELNMLMNLHKEQWQSGL 230



>gb:AX969775_1485084 Sequence 578 from Patent EP1104808.
          Length = 149

 Score =  124 bits (310), Expect = 5e-27
 Identities = 60/84 (71%), Positives = 68/84 (80%)
 Frame = +2

Query: 230 TKFQQEKPWTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAF 409
           +K    + WT D HYFK  KISALALLKMV+HARSGG +EVMGLM GK DG+ +I+MD+F
Sbjct: 65  SKKSWRRTWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSF 124

Query: 410 ALPVEGTETRVNAQADAYEYMVDY 481
           ALPVEGTETRVNAQA AYEYM  Y
Sbjct: 125 ALPVEGTETRVNAQAAAYEYMAAY 148



>gb:CNS07EGH_1374233 chromosome XI of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).
          Length = 294

 Score =  123 bits (308), Expect = 9e-27
 Identities = 98/290 (33%), Positives = 141/290 (48%), Gaps = 11/290 (3%)
 Frame = +2

Query: 284  VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
            V+IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V +    
Sbjct: 21   VQISSLALLKMLKHGRAGIPLEVMGLMLGEFVDEYTVKVVDVFAMPQSGTNVTVESVDPI 80

Query: 461  YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT 640
            ++  ++     K  GR E VVGWYHSHPG+GCWLS +D+STQ   ++  +  +AVV+DP 
Sbjct: 81   FQ--MEMMSILKATGRHETVVGWYHSHPGFGCWLSTVDISTQQSFEKLCKRAVAVVVDPI 138

Query: 641  RTVSAGKVEIGAFRTYPE-----GYKPPD--EPVSEYQTIPLNKIEDFGVH--CKQYYSL 793
            ++V  GKV I AFR         G +P      +   +T  L  I    +H   K YYS 
Sbjct: 139  QSVK-GKVVIDAFRLIDNQLGVLGGEPRQVTSNIGYLKTPTLISI----IHGLNKHYYSF 193

Query: 794  DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLSHSR 973
            +IT  K             K W + L              ++ D+  K E+A        
Sbjct: 194  NITCRKNDFEQKMLLNLHRKTWADNL--------------KLGDVRSKREEALK------ 233

Query: 974  FGPLIAPAQRKKEEESQLAKITCDSAKI-TVEQVHGLMSQVIKDILFNTV 1120
               LI    +  EEE  LA    D AK+  ++    L+ +  + I+ NT+
Sbjct: 234  ---LIESYGKAFEEEKNLAGKNPDMAKVGRIDYRRRLLEKCEESIMENTI 280



>sp|P41883|YPT5_CAEEL Hypothetical 35.8 kDa protein F37A4.5 in
           chromosome III.>pir|S44642|S44642 hypothetical protein
           F37A4.5 - Caenorhabditis elegans>gb:U00032_1401373
           Caenorhabditis elegans cosmid F37A4, complete sequence.
          Length = 319

 Score =  122 bits (307), Expect = 1e-26
 Identities = 69/141 (48%), Positives = 87/141 (61%), Gaps = 1/141 (0%)
 Frame = +2

Query: 266 PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRV 442
           P   + V IS+LALLKM+ HARSG  +EVMGLM G   D   I V D FA+P  GT   V
Sbjct: 23  PDTSETVNISSLALLKMLRHARSGIPLEVMGLMLGDFVDDYTINVTDVFAMPQSGTSVTV 82

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
            +    Y+    +    K  GR ENVVGWYHSHPG+GCWLS +DV+TQ   +      +A
Sbjct: 83  ESVDPVYQ--TKHMDLLKLVGRTENVVGWYHSHPGFGCWLSSVDVNTQQSFEALHPRAVA 140

Query: 623 VVIDPTRTVSAGKVEIGAFRT 685
           VV+DP ++V  GKV + AFR+
Sbjct: 141 VVVDPIQSVK-GKVMLDAFRS 160



>gb:AF014465_1231880 Schistosoma mansoni Pad1 homolog (SmPOH) mRNA,
           complete cds.
          Length = 313

 Score =  122 bits (305), Expect = 2e-26
 Identities = 79/190 (41%), Positives = 109/190 (57%), Gaps = 8/190 (4%)
 Frame = +2

Query: 266 PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRV 442
           P   ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V
Sbjct: 28  PDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVTVVDVFAMPQSGTGVSV 87

Query: 443 NAQADAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFL 619
            A    ++  M+D     +Q GR E VVGWYHSHPG+GCWLSG+D++TQ   +   +  +
Sbjct: 88  EAVDPVFQAKMLDML---RQTGRPEMVVGWYHSHPGFGCWLSGVDMNTQQSFEALSDRAV 144

Query: 620 AVVIDPTRTVSAGKVEIGAFRTYPEGY----KPPDEPVSEYQTIPLNKIEDFGVH--CKQ 781
           AVV+DP ++V  GKV I AFR          + P +  S    +    I+   +H   + 
Sbjct: 145 AVVVDPIQSVK-GKVVIDAFRLINPNLVIANQEPRQTTSNVGHLSKPTIQAL-IHGLNRH 202

Query: 782 YYSLDITYFK 811
           YYSL I Y K
Sbjct: 203 YYSLPINYRK 212



>gb:CR382132_1666042 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 312

 Score =  121 bits (304), Expect = 3e-26
 Identities = 78/185 (42%), Positives = 106/185 (57%), Gaps = 9/185 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  D 
Sbjct: 32  VYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVHVIDVFAMPQSGTGVSVEAVDDV 91

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR + VVGWYHSHPG+GCWLS +D++TQ   +Q  +  +AVV+DP
Sbjct: 92  FQTRMMDML---KQTGRDQMVVGWYHSHPGFGCWLSSVDINTQQSFEQLNKRAVAVVVDP 148

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSLD 796
            ++V  GKV I AFR           EP     T  +  +    +H       + YYS++
Sbjct: 149 IQSVK-GKVVIDAFRLINTNSVLLGQEP--RLSTSNVGHLNKPTIHALIHGLNRHYYSIN 205

Query: 797 ITYFK 811
           I Y K
Sbjct: 206 INYKK 210



>sp|P41878|RPNB_SCHPO 26S proteasome regulatory subunit
           rpn11.>pir|T43293|T43293 multidrug resistance protein
           sks1 - fission yeast  (Schizosaccharomyces
           pombe)>gb:D84656_1674867 Yeast DNA for bfr2+
           protein/pad1+ protein/sks1+ protein, ORF N313, ORF N150,
           complete cds, and for ORF N118, partial
           cds.>gb:SPAC31G5_1717718 S.pombe chromosome I cosmid
           c31G5.>gb:YSPF34A45_1731102 Yeast sks1+ gene
           (K-252a-resistance gene) encoding 308AA protein,
           complete cds.
          Length = 308

 Score =  121 bits (304), Expect = 3e-26
 Identities = 91/235 (38%), Positives = 119/235 (50%), Gaps = 10/235 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R G  +EVMGLM G+  D   + V+D FA+P  GT   V A    
Sbjct: 30  VYISSLALLKMLRHGRHGTPMEVMGLMLGEFVDDFTVRVVDVFAMPQSGTGVSVEAVDPV 89

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR E VVGWYHSHPG+GCWLS +D++TQ   +Q     +AVV+DP
Sbjct: 90  FQKNMMDML---KQTGRPEMVVGWYHSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDP 146

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTI-PLNK------IEDFGVHCKQYYSL 793
            ++V  GKV I AFR   P       EP      +  +NK      I   G H   YYSL
Sbjct: 147 IQSVK-GKVVIDAFRLINPSTLMMGQEPRQTTSNLGHINKPSIQALIHGLGRH---YYSL 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQ 958
            I Y K             + W + L    LL N +  A +     +K++    Q
Sbjct: 203 RINYKKTELEEIMLLNLHKQPWAHGL----LLENFNSAAEKNHASIDKMKSLSEQ 253



>gb:SDO249917_1397406 Aphrocallistes vastus mRNA for putative
           multidrug resistance protein (pohl gene).
          Length = 294

 Score =  120 bits (302), Expect = 5e-26
 Identities = 82/235 (34%), Positives = 120/235 (51%), Gaps = 11/235 (4%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G   D   + V+D FA+P  GT   V A  
Sbjct: 14  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGDFVDDYTVKVIDVFAMPQSGTGVSVEAVD 73

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +      +AVV+
Sbjct: 74  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALTARAVAVVV 130

Query: 632 DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSL 793
           DP ++V  GKV I AFR          +   +  T  +  ++   +        + YYS+
Sbjct: 131 DPIQSVK-GKVVIDAFRLISTATLASTQEARQ-TTSNIGHLQKPSIQAVIHGLGRHYYSM 188

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPL---LGNGDYVAGQISDLAEKLEQA 949
            I Y K             K W++ L          N + +  ++ +LA+   +A
Sbjct: 189 PINYKKNELEQKMLMNLHKKTWMDGLRLEEFKEHADNNETIVCEMLELAKAYNKA 243



>gb:AVA245813_1285862 Aphrocallistes vastus mRNA for potential
           multidrug resistance protein (POHL gene).
          Length = 308

 Score =  120 bits (302), Expect = 5e-26
 Identities = 82/235 (34%), Positives = 120/235 (51%), Gaps = 11/235 (4%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G   D   + V+D FA+P  GT   V A  
Sbjct: 28  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGDFVDDYTVKVIDVFAMPQSGTGVSVEAVD 87

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +      +AVV+
Sbjct: 88  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALTARAVAVVV 144

Query: 632 DPTRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSL 793
           DP ++V  GKV I AFR          +   +  T  +  ++   +        + YYS+
Sbjct: 145 DPIQSVK-GKVVIDAFRLISTATLASTQEARQ-TTSNIGHLQKPSIQAVIHGLGRHYYSM 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPL---LGNGDYVAGQISDLAEKLEQA 949
            I Y K             K W++ L          N + +  ++ +LA+   +A
Sbjct: 203 PINYKKNELEQKMLMNLHKKTWMDGLRLEEFKEHADNNETIVCEMLELAKAYNKA 257



>gb:AE017341_1754051 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 310

 Score =  120 bits (301), Expect = 6e-26
 Identities = 83/205 (40%), Positives = 106/205 (51%), Gaps = 9/205 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V ISALALLKM+ H R+G  +EVMGLM G+  D   I  +D FA+P  GT   V +    
Sbjct: 33  VHISALALLKMLKHGRAGVPMEVMGLMLGEFVDDYTISCVDVFAMPQSGTTVTVESVDHV 92

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR E VVGWYHSHPG+GCWLS +DV+TQ   +Q     +AVVIDP
Sbjct: 93  FQTKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLHPRAVAVVIDP 149

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSLD 796
            ++V  GKV I AFR+  P       E  S   T  +  +    +        + YYSL 
Sbjct: 150 IQSV-RGKVVIDAFRSINPAALATGQE--SRQTTSNIGHLNKPSIQALIHGLNRHYYSLA 206

Query: 797 ITYFKXXXXXXXXXXXWNKYWVNTL 871
           I Y K             + W   L
Sbjct: 207 IDYKKTEAEQGMLLNLHKRGWTEGL 231



>gb:AP004324_1840167 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1215_E11.
          Length = 308

 Score =  120 bits (300), Expect = 8e-26
 Identities = 66/140 (47%), Positives = 89/140 (63%), Gaps = 1/140 (0%)
 Frame = +2

Query: 266 PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRV 442
           P   +++ +S LALLKM+ H R+G  +EVMGLM G+  D   + V D FA+P  GT   V
Sbjct: 20  PDTSEQINVSPLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVTVADVFAMPQSGTGVSV 79

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
            A   A++   +  +  +Q GR E VVGWYHSHPG+GCWLSG D++TQ   +Q     +A
Sbjct: 80  EAVDHAFQS--EMLEMLRQTGRPEMVVGWYHSHPGFGCWLSGTDMATQQSFEQLHPRAVA 137

Query: 623 VVIDPTRTVSAGKVEIGAFR 682
           VVIDP ++V  GKV + AFR
Sbjct: 138 VVIDPVQSVK-GKVVMDAFR 156



>pir|T44427|T44427 hypothetical protein - fission yeast
           (Schizosaccharomyces pombe)>gb:YSPPAD1_1731163 Yeast
           pad1+ gene for ORF, complete cds.
          Length = 308

 Score =  119 bits (297), Expect = 2e-25
 Identities = 90/235 (38%), Positives = 119/235 (50%), Gaps = 10/235 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V IS+LALLKM+ H R G  +EVMGLM G+  D   + V+D FA+P  GT   V A    
Sbjct: 30  VYISSLALLKMLRHGRHGTPMEVMGLMLGEFVDDFTVRVVDVFAMPQSGTGVSVEAVDPV 89

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D     KQ GR E VVGWY+SHPG+GCWLS +D++TQ   +Q     +AVV+DP
Sbjct: 90  FQKNMMDML---KQTGRPEMVVGWYNSHPGFGCWLSSVDINTQQSFEQLTPRAVAVVVDP 146

Query: 638 TRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTI-PLNK------IEDFGVHCKQYYSL 793
            ++V  GKV I AFR   P       EP      +  +NK      I   G H   YYSL
Sbjct: 147 IQSVK-GKVVIDAFRLINPSTLMMGQEPRQTTSNLGHINKPSIQALIHGLGRH---YYSL 202

Query: 794 DITYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQ 958
            I Y K             + W + L    LL N +  A +     +K++    Q
Sbjct: 203 RINYKKTELEEIMLLNLHKQPWAHGL----LLENFNSAAEKNHASIDKMKSLSEQ 253



>gb:AF404119_1268497 Trypanosoma brucei proteasome regulatory
           non-ATP-ase subunit 11 (Rpn11) mRNA, complete cds.
          Length = 305

 Score =  118 bits (296), Expect = 2e-25
 Identities = 82/206 (39%), Positives = 108/206 (52%), Gaps = 14/206 (6%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAII-VMDAFALPVEGTETRVNAQADA 460
           V+IS+LALLKM++H R+G  +EVMGLM G+   D  + V D F++P   T T  + +A  
Sbjct: 27  VQISSLALLKMLMHGRAGVPLEVMGLMIGELIDDYTVRVSDVFSMPQ--TATGQSVEAVD 84

Query: 461 YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT 640
            EY V         GR E VVGWYHSHPG+GCWLSG DV T    +Q     ++VVIDP 
Sbjct: 85  PEYQVHMLDKLSVVGRPEKVVGWYHSHPGFGCWLSGEDVMTASSYEQLTPRSVSVVIDPI 144

Query: 641 RTVSAGKVEIGAFRTYPEGYKPP----DEP---------VSEYQTIPLNKIEDFGVHCKQ 781
           ++V  GKV I AFRT  + +  P     EP         ++    I L +  D     + 
Sbjct: 145 QSV-RGKVVIDAFRTTKDPHTGPRIMFQEPRQTTSNIGWLTRPSPIALTRGLD-----RD 198

Query: 782 YYSLDITYFKXXXXXXXXXXXWNKYW 859
           YYSL IT+ K           + K W
Sbjct: 199 YYSLPITFRKKNHELALLLNVYKKGW 224



>gb:PFMAL13_1191728 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 311

 Score =  118 bits (295), Expect = 3e-25
 Identities = 80/205 (39%), Positives = 105/205 (51%), Gaps = 7/205 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS LALLK++ H R+G  +EVMGLM G+  D   I ++D FA+P  G    V A  
Sbjct: 31  EQVYISPLALLKILKHGRAGVPMEVMGLMLGEIVDEYTIRIVDVFAMPQSGNSVSVEAVD 90

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
             Y+   +  +  K+ GR E VVGWYHSHPG+GCWLSG DV+TQ   +Q     + VV+D
Sbjct: 91  PVYQ--TNMLEELKKTGRHEMVVGWYHSHPGFGCWLSGTDVNTQKSFEQLNPRTIGVVVD 148

Query: 635 PTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSE-----YQTIPLNKIEDFGVHCKQYYSLD 796
           P ++V  GKV I  FR   P       EP        Y T P       G++ + YYS+ 
Sbjct: 149 PIQSVK-GKVVIDCFRLINPHILMLGQEPRQTTSNIGYLTKPTLTALVHGLN-RNYYSIV 206

Query: 797 ITYFKXXXXXXXXXXXWNKYWVNTL 871
           I Y K               W N L
Sbjct: 207 INYRKNELEKNMLLNLHKDMWTNPL 231



>gb:BX538352_1358973 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 3/4.
          Length = 315

 Score =  117 bits (294), Expect = 4e-25
 Identities = 76/189 (40%), Positives = 103/189 (54%), Gaps = 7/189 (3%)
 Frame = +2

Query: 266 PHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRV 442
           P   ++V IS+LALLKM+ H R+G  +EVMGL+ G+  D  ++ V+D F++P  G    V
Sbjct: 31  PDTSEQVYISSLALLKMLKHGRAGVPMEVMGLLLGEFIDDYSVRVVDVFSMPQSGNSVSV 90

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
            A    Y+   D  +  K+ GR E VVGWYHSHPG+GCW SG DVSTQ   +Q     + 
Sbjct: 91  EAVDPVYQ--TDMLEMLKRVGRSELVVGWYHSHPGFGCWFSGTDVSTQQSFEQLNPRAVG 148

Query: 623 VVIDPTRTVSAGKVEIGAFRTY-PEGYKPPDEPVSEYQTI-----PLNKIEDFGVHCKQY 784
           +V+DP ++V  GKV I  FR   P       EP      I     P       G++ + Y
Sbjct: 149 IVVDPIQSVK-GKVVIDCFRLISPHSVIAGQEPRQTTSNIGHLQKPSITALVHGLN-RNY 206

Query: 785 YSLDITYFK 811
           YS+ I Y K
Sbjct: 207 YSIAIRYRK 215



>gb:AJ720599_2502786 Gallus gallus mRNA for hypothetical protein,
           clone 20p24.
          Length = 155

 Score =  116 bits (290), Expect = 1e-24
 Identities = 65/131 (49%), Positives = 87/131 (66%), Gaps = 2/131 (1%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQA 454
           ++V IS+LALLKM+ H R+G  +EVMGLM G+  D   + V+D FA+P  GT   V A  
Sbjct: 29  EQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVD 88

Query: 455 DAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI 631
             ++  M+D     KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AVV+
Sbjct: 89  PVFQAKMLDML---KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVV 145

Query: 632 DPTRTVSAGKV 664
           DP ++V  GKV
Sbjct: 146 DPIQSVK-GKV 155



>pir|E90112|E90112 26S proteasome regulatory subunit [imported] -
           Guillardia theta nucleomorph>gb:GTAJ10592_1681139
           Guillardia theta DNA for complete sequence of
           nucleomorph chromosome 2.
          Length = 281

 Score =  105 bits (262), Expect = 2e-21
 Identities = 68/182 (37%), Positives = 105/182 (57%), Gaps = 6/182 (3%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           + IS+LAL+KM+ H+++G  +EVMGL+ G   D   I V D FA+P  GT   V +   +
Sbjct: 17  INISSLALIKMLKHSKAGVPVEVMGLLLGNFVDEINISVNDVFAMPQTGTGISVESLDPS 76

Query: 461 YEY-MVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           ++  M+D      Q G    +VGWYHSHPG+GCWLSG+D++TQ   +   +  +A+VIDP
Sbjct: 77  FQTKMLDLLS---QLGNKSLIVGWYHSHPGFGCWLSGVDINTQQNFENLNKRSVAIVIDP 133

Query: 638 TRTVSAGKVEIGAFRTYPEGYKPPDEPVSEYQTIPLN----KIEDFGVHCKQYYSLDITY 805
            ++    ++ I A+R +    K   E  S   T  ++    + +D G++ K YYSL I+ 
Sbjct: 134 IQSFK-NRMFIEAYRLFSGNQKVRLERESLSITSNIDTKSFQKDDQGIN-KYYYSLRIST 191

Query: 806 FK 811
            K
Sbjct: 192 IK 193



>gb:GLA297367_1385348 Giardia lamblia mpr1 gene for non-ATPase
           subunit MPR1 of 26S proteasome.
          Length = 298

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 53/137 (38%), Positives = 78/137 (56%), Gaps = 1/137 (0%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V +S +AL+KM+ H + G  IEVMGL+ G   D   + V D F++P  G    V++  + 
Sbjct: 33  VIVSHVALIKMLRHCKQGIPIEVMGLLLGTFVDKYTVYVSDCFSMPQVGQADSVDSVDEV 92

Query: 461 YEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT 640
           ++   +  +  K+    EN VGWYHSHPGY  WLS ID +T    ++     +A+V+DP 
Sbjct: 93  FQ--AEMMEMLKKVNVPENCVGWYHSHPGYFAWLSHIDQNTHKSFERLDYRSIAIVLDPM 150

Query: 641 RTVSAGKVEIGAFRTYP 691
            + S GK+ I AFR  P
Sbjct: 151 NSTS-GKLVIEAFRLIP 166



>gb:AF014466_1231881 Schistosoma mansoni trans-spliced variant
           protein (SmPOH.Trans) mRNA, partial cds.
          Length = 167

 Score = 90.1 bits (222), Expect = 9e-17
 Identities = 49/103 (47%), Positives = 65/103 (63%), Gaps = 1/103 (0%)
 Frame = +2

Query: 377 DGDAIIVMDAFALPVEGTETRVNAQADAYEY-MVDYSQTNKQAGRLENVVGWYHSHPGYG 553
           D   I V+D FA+P  GT   V A    ++  M+D     +Q GR E VVGWYHSHPG+G
Sbjct: 52  DFGVIKVVDVFAMPQSGTGVSVEAVDPVFQAKMLDML---RQTGRPEMVVGWYHSHPGFG 108

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFR 682
           CWLSG+D++TQ   +   +  +AVV+DP ++V  GKV I AFR
Sbjct: 109 CWLSGVDMNTQQSFEALSDRAVAVVVDPIQSVK-GKVVIDAFR 150



>gb:AP004324_1840168 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1215_E11.
          Length = 176

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 54/131 (41%), Positives = 69/131 (52%)
 Frame = -3

Query: 678 NAPISTFPAETVLVGSITTARKGS*NCWFSICVETSIPESQHP*PGWE*YHPTTFSNRPA 499
           NA ++TFP  T+  GSITTA     +C    CV  S+PESQ P PGWE YHPTT S RP 
Sbjct: 7   NASMTTFPL-TLCTGSITTATARGCSCSKLCCVAMSVPESQQPKPGWEWYHPTTISGRPV 65

Query: 498 CLFVCE*STMYXXXXXXALTLVSVPSTGRAKASMTMMASPSVFPCIRPITSMVPPERAWT 319
           C  +   S          LT V +       A++T+ +S +  P I PITS+  P R   
Sbjct: 66  CRSISSISLWNAWSTASTLTPVPLCGMANTSATVTVYSSTN-SPSISPITSIGTPARPCL 124

Query: 318 TILRSASAEIL 286
           +ILR A  + L
Sbjct: 125 SILRRARGDTL 135



>gb:AF195189_1249789 Drosophila melanogaster yippee interacting
           protein 5 (yip5) mRNA, partial cds.
          Length = 229

 Score = 77.0 bits (188), Expect = 8e-13
 Identities = 56/161 (34%), Positives = 76/161 (47%), Gaps = 7/161 (4%)
 Frame = +2

Query: 494 KQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIG 673
           KQ GR E VVGWYHSHPG+GCWLSG+D++TQ   +   E  +AV     ++V  GKV I 
Sbjct: 19  KQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVXXYSIQSVK-GKVVID 77

Query: 674 AFRTY-PEGYKPPDEPVSEYQTIPLNKIEDFGVHC------KQYYSLDITYFKXXXXXXX 832
           AFR   P       EP     T  L  ++   V        + YYS+ I Y K       
Sbjct: 78  AFRLINPNMLVLGQEP--RQTTSNLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKM 135

Query: 833 XXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAEN 955
                 K W + L+ S      ++ +     +AE L+ A+N
Sbjct: 136 LLNLHKKSWKDGLTLSDY---NEHCSINEDTVAEMLDFAKN 173



>gb:AP006172_1861325 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 307

 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 72/284 (25%), Positives = 120/284 (42%), Gaps = 12/284 (4%)
 Frame = +2

Query: 290  ISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQADAYE 466
            +S LALLK++VHA     +  MG++ G+  DG ++ V+DAF LP          QA    
Sbjct: 28   VSPLALLKILVHAARDSPVAAMGVILGEEVDGFSVRVVDAFPLP-RCAGGGAFTQAIDPR 86

Query: 467  YMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRT 646
            Y+        +  RLE VVGWY S+PG+    S  D       +Q     + V +DP ++
Sbjct: 87   YIEGMLAMLNKTDRLEGVVGWYRSNPGFYGRPSNHDSVFHKAFEQLNPRAILVAVDPVKS 146

Query: 647  VSAGKVEIGAFR---TYPEGYKPPDEPVSEYQTI-----PLNKIEDFGVH-CKQYYSLDI 799
             + G   + AFR   +Y E          EY ++     P  +++ F       +YS+ I
Sbjct: 147  -ATGNFTMNAFRSVTSYHETSSNVGALNREYYSVAEDEKPFFELDIFAQGLASVFYSILI 205

Query: 800  TYFKXXXXXXXXXXXWNKYWVNTLSSSPLLGNGDYVAGQISDLAE--KLEQAENQLSHSR 973
            ++ K            N   +N L S   +G+    +     L +   + ++E +     
Sbjct: 206  SHRK------------NDLEINILKSMDKMGSKGSSSEDCRSLCQFPVMSESEKKNVEEM 253

Query: 974  FGPLIAPAQRKKEEESQLAKITCDSAKITVEQVHGLMSQVIKDI 1105
               L+   Q ++E +   A      A+  +E++  LMS  I  I
Sbjct: 254  LIDLLTKYQNEEEMQESDAPENPPDAENHLEELKNLMSACILQI 297



>pir|T02766|T02766 adhesin WI-1 - Ajellomyces
            dermatitidis>gb:BDU37772_1632838 Ajellomyces dermatitidis
            WI-1 adhesin gene, complete cds.
          Length = 1146

 Score = 22.3 bits (46), Expect(17) = 1e-08
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +WKLWD W
Sbjct: 819  DWKLWDKW 826



 Score = 22.3 bits (46), Expect(17) = 1e-08
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +WKLWD W
Sbjct: 531  DWKLWDKW 538



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 963  DWELWDKW 970



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 915  DWELWDKW 922



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 867  DWELWDKW 874



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 843  DWELWDKW 850



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 795  DWELWDKW 802



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 747  DWELWDKW 754



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 699  DWELWDKW 706



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 675  DWELWDKW 682



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 651  DWELWDKW 658



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 627  DWELWDKW 634



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 579  DWELWDKW 586



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 507  DWELWDKW 514



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 459  DWELWDKW 466



 Score = 20.8 bits (42), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +W+LWD W
Sbjct: 411  DWELWDKW 418



 Score = 20.4 bits (41), Expect(17) = 1e-08
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +2

Query: 1235 NWKLWDCW 1258
            +WKLW+ W
Sbjct: 1011 DWKLWNKW 1018



>gb:BC082208_2562558 Xenopus laevis MGC99130 protein, mRNA (cDNA
           clone MGC:99130 IMAGE:7205758), complete cds.
          Length = 261

 Score = 53.5 bits (127), Expect = 9e-06
 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 3/118 (2%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
           V I   A L  V H+ S    EVMGL  G+ D   ++ + +  +     + +   +    
Sbjct: 6   VHIQGDAFLVCVTHSLSTEREEVMGLCIGEVDTQKLVHIHSVIILRRSDKRKDRVEISPE 65

Query: 464 EYMVDYSQTNKQA---GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
           +      + ++ A   GR   VVGWYHSHP    W S +DV TQ + Q     F+ ++
Sbjct: 66  QLSAATIEADRLADITGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDVGFVGLI 123



>gb:AY222996_1176461 Schistosoma japonicum clone ZZD1069 mRNA
           sequence.
          Length = 356

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 5/127 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH-ARSG----GTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV 442
           K+V +  L LL +V H +RSG    G   V+G++ G  +G  + V ++FA+P E   T  
Sbjct: 22  KKVVVHPLVLLGVVDHYSRSGKVTSGQKRVVGVLLGSLNGSILDVSNSFAVPFEEDATDP 81

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
           +     ++Y+       K+    E +VGWYHS P     L   D+    L +++    + 
Sbjct: 82  DVWFLDHDYLESMFAMFKKVNAREKIVGWYHSGPK----LCTNDIKINELFRKYASNSVL 137

Query: 623 VVIDPTR 643
           VV+D  R
Sbjct: 138 VVVDVRR 144



>gb:AY093768_1575426 Arabidopsis thaliana At1g80210/F18B13_28 mRNA,
           complete cds.>gb:BT002265_1635868 Arabidopsis thaliana
           At1g80210/F18B13_28 mRNA, complete cds.
          Length = 406

 Score = 50.4 bits (119), Expect = 8e-05
 Identities = 42/148 (28%), Positives = 66/148 (44%), Gaps = 14/148 (9%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQG----KTDGDAIIVMDAFALPVEGTETRVNAQ 451
           V +S    L  + HA S  T E+MGL+ G      DG +   M   A P    ++R + Q
Sbjct: 6   VNMSEDVWLTCLTHALSTETEEIMGLLLGDIEYSKDGGSATAMIWGASP----QSRSDRQ 61

Query: 452 ADAYEYMVDY-----SQTNKQA---GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQ 607
            D  E   +      +Q ++     GR   V+GWYHSHP      S +DV TQ + Q   
Sbjct: 62  KDRVETNPEQLAAASAQADRMTISTGRTTRVIGWYHSHPHITVLPSHVDVRTQAMYQLLD 121

Query: 608 EPFLAVVID--PTRTVSAGKVEIGAFRT 685
             F+ ++           G++++ AF++
Sbjct: 122 SGFIGLIFSCFSEDANKVGRIQVIAFQS 149



>gb:NCB24G3_1689849 Neurospora crassa DNA linkage group II BAC clone
           B24G3.
          Length = 352

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 6/129 (4%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH-----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRV 442
           + V ++ L LL +V H     A    +  V+G++ G+ DG  + V ++FA+P E  +   
Sbjct: 14  RSVSVAPLVLLSVVDHYNRTQANKSKSKRVVGVLLGQNDGKNVRVSNSFAVPFEEDDKDP 73

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
           +     + Y+   +   K+    E ++GWYHS P      S +D++ ++  +    P L 
Sbjct: 74  SVWFLDHNYVESMNDMFKKVNAREKLIGWYHSGPKLRA--SDLDIN-ELFKRYTPNPLLV 130

Query: 623 VV-IDPTRT 646
           +V + P  T
Sbjct: 131 IVDVQPKET 139



>gb:AF028783_1762367 Hypocrea jecorina proteasome regulatory subunit
           12 (prs12) gene, complete cds.
          Length = 342

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 34/123 (27%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIE----VMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           + V ++ L LL  V H     T +    V+G++ G+ DG  + V ++FA+P E  E   +
Sbjct: 14  RNVSVAPLVLLSAVDHYNRTVTSKTKRRVVGVLLGQNDGKNVRVSNSFAVPFEEDEKDPS 73

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                + Y+   +   K+    E +VGWYH+ P     L   D+    L +++    L V
Sbjct: 74  VWFLDHNYVESMNDMFKKVNAREKLVGWYHTGPK----LRASDLEINELFKRYTPNPLLV 129

Query: 626 VID 634
           +ID
Sbjct: 130 IID 132



>gb:AY075635_1567776 Arabidopsis thaliana AT3g06820/F3E22_4 mRNA,
           complete cds.>gb:AY149940_1584889 Arabidopsis thaliana
           At3g06820/F3E22_4 mRNA, complete cds.
          Length = 405

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 37/144 (25%), Positives = 66/144 (45%), Gaps = 10/144 (6%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTD----GDAIIVMDAFALPVEGTETRVN-A 448
           V +S    L  + HA S  T E+MGL+ G  +    G++   M   A P   ++ + +  
Sbjct: 6   VNMSEDVWLTCLTHALSTETEEIMGLLLGDIEYSKNGESATAMIWGASPQPRSDRQKDRV 65

Query: 449 QADAYEYMVDYSQTNKQA---GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFL 619
           + +  +     +Q ++     GR   V+GWYHSHP      S +DV TQ + Q     F+
Sbjct: 66  ETNPEQLAAASAQADRMTISTGRTTRVIGWYHSHPHITVLPSHVDVRTQAMYQLLDSGFI 125

Query: 620 AVVID--PTRTVSAGKVEIGAFRT 685
            ++           G++++ AF++
Sbjct: 126 GLIYSCFSEDANKVGRIQVIAFQS 149



>gb:AE016814_1745714 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 326

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 48/93 (51%), Gaps = 3/93 (3%)
 Frame = +2

Query: 275 FKRVKISALALLKMVVHARSGGTIE---VMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           +++V ++ L LL ++ H +   T +    +G++ G   G  I V ++FALP E  E   +
Sbjct: 5   YEQVNVAPLVLLSVLDHYKRMNTPDNKRCVGVLLGDNSGSTIKVTNSFALPFEEDEKNPD 64

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
                + Y+ + +   K+    E ++GWYHS P
Sbjct: 65  VWFLDHNYIENMNDMCKKINAKEKMIGWYHSGP 97



>gb:DD1039PPR1_1376824 Dictyostelium discoideum unknown (1039) gene,
           partial cds.
          Length = 445

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 32/111 (28%), Positives = 47/111 (42%), Gaps = 5/111 (4%)
 Frame = +2

Query: 341 TIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA--QADAYEYMVDYSQTNKQAGRLE 514
           +IE  G++ G    D   +        EGT    N   + + +EY            +LE
Sbjct: 288 SIETCGILSGTLSNDVFRITTIIIPKQEGTTDTCNTIEEHEIFEY------------QLE 335

Query: 515 N---VVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAG 658
           N    +GW H+HP   C+LS +DV T    Q   +  +AVVI P    + G
Sbjct: 336 NDLLTLGWIHTHPTQDCFLSAVDVHTHCSYQYLLQEAIAVVISPMANPNFG 386



>gb:AK173300_2070234 Mus musculus mRNA for mKIAA1915 protein.
          Length = 745

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 6/125 (4%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTIEVMGLMQGK-TDGDAIIVMDAFALPVEGTETRVNAQAD 457
           +VK++A ALL M +HA      EV+GL+ G+ ++ D ++ + A A P     T +  + D
Sbjct: 493 QVKVAAEALLIMNLHAHVS-MAEVIGLLGGRYSEADKVLEVCA-AEPCNSLSTGLQCEMD 550

Query: 458 AYEYMVDYSQTNKQ-AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLA 622
                V  +Q ++  A R  +V+GWYHSHP +    S  D+ TQ   Q +       F+ 
Sbjct: 551 P----VSQTQASETLALRGYSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIG 606

Query: 623 VVIDP 637
           +++ P
Sbjct: 607 MIVSP 611



>gb:AC104713_1737853 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1362_G11, complete sequence.
          Length = 416

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 8/154 (5%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGK---TDGDAIIVMDAFALPVEGTETRVNAQA 454
           V+I     L  + HA +  T EVMGL+ G    +    +  +   A P    E + +   
Sbjct: 6   VRIGEEVWLTCLSHALTTETEEVMGLLFGDIKHSSRGGVTALIWGASPQMRCERKKDRVE 65

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
              E +   +  +   G    V+GWYHSHP      S +DV TQ + Q  +  F+ ++  
Sbjct: 66  VNPELLAAATALSATIGEKTRVIGWYHSHPHITVLPSHVDVRTQAMFQLMEPGFVGLIFS 125

Query: 635 --PTRTVSAGKVEIGAFRTY---PEGYKPPDEPV 721
                    GK+++ AF++     +   P ++PV
Sbjct: 126 CFSEDAQKVGKIQVIAFQSLGGNQQSVVPVNDPV 159



>gb:ATAC023912_1543773 Arabidopsis thaliana chromosome III BAC F3E22
           genomic sequence, complete sequence.
          Length = 374

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 39/145 (26%), Positives = 64/145 (44%), Gaps = 19/145 (13%)
 Frame = +2

Query: 308 LKMVVHARSGGTIEVMGLMQGKTD----GDAIIVMDAFALPVEGTETR------------ 439
           L  + HA S  T E+MGL+ G  +    G++   M   A P   ++ +            
Sbjct: 7   LTCLTHALSTETEEIMGLLLGDIEYSKNGESATAMIWGASPQPRSDRQKDRVETNPEQLA 66

Query: 440 -VNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF 616
             +AQAD   +++  S      GR   V+GWYHSHP      S +DV TQ + Q     F
Sbjct: 67  AASAQADI-SFLMTIS-----TGRTTRVIGWYHSHPHITVLPSHVDVRTQAMYQLLDSGF 120

Query: 617 LAVVID--PTRTVSAGKVEIGAFRT 685
           + ++           G++++ AF++
Sbjct: 121 IGLIFSCFSEDANKVGRIQVIAFQS 145



>gb:BX942841_2568113 Zebrafish DNA sequence from clone CH211-59D15
           in linkage group 20 Contains the gene for a novel
           protein similar to human KIAA1915, the gene for a novel
           protein (zgc:63921), the gene for a novel protein
           similar to vertebrate 3'(2'), 5'-bisphosphate
           nucleotidase 1 (BPNT1), the gene for a novel protein
           similar to FOS-like antigen 2 (FOSL2), the gene for a
           novel protein similar to vertebrate YLP motif containing
           1 (YLPM1), the 5' end of the gene for a novel protein
           similar to vertebrate cytosolic 5'-nucleotidase IB
           (NT5C1B), the gene for a novel protein similar to
           vertebrate synaptotagmins, a novel gene and three CpG
           islands, complete sequence.
          Length = 716

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 6/124 (4%)
 Frame = +2

Query: 284 VKISALALLKMVVHAR-SGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA 460
           V + A AL+ M +HA  S G  EV+GL+ G  + +  ++    A P     T +  + D 
Sbjct: 517 VIVCAEALIVMDIHAHVSMG--EVIGLLGGTYEEEDKVLKICSAEPCNSLSTGLQCEMDP 574

Query: 461 YEYMVDYSQTNKQAG-RLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLAV 625
               V  +Q ++  G +  +VVGWYHSHP +    S  D+ TQ   Q +      PF+ +
Sbjct: 575 ----VSQTQASEVLGVKGLSVVGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAPFIGM 630

Query: 626 VIDP 637
           ++ P
Sbjct: 631 IVSP 634



>gb:BX293995_1991748 Human DNA sequence from clone RP11-143H17 on
           chromosome X Contains the 3' end of a novel gene (C6.1A)
           and a phosphatidylinositol binding clathrin assembly
           protein (PICALM) pseudogene, complete
           sequence.>gb:BX470111_1991813 Human DNA sequence from
           clone GS1-273L24 on chromosome X Contains the 5' end of
           the F8 gene for coagulation factor VIII procoagulant
           component (hemophilia A), the FUNDC2 gene for FUN14
           domain containing 2, the MTCP1 gene for mature T-cell
           proliferation 1, the 5' end of a novel gene (C6.1A) and
           two CpG islands, complete sequence.
          Length = 291

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 48/187 (25%), Positives = 70/187 (37%), Gaps = 33/187 (17%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ---- 451
           V + + A L  + HA S    EVMGL  G+ + D             GTE R  A+    
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDT---RSDSKFAYTGTEMRTVAEKVDA 68

Query: 452 --------------ADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                         +D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAEMLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVVID---PTRTVSAGKVEIGAFRTYPEGYKPPDEPVS 724
            W S +DV TQ + Q   + F+ ++       +    G+V    F++         +  S
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQA------QKSS 182

Query: 725 EYQTIPL 745
           EY+ I +
Sbjct: 183 EYERIEI 189



>gb:AK011876_1156639 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610204E15
           product:T-cell receptor alpha chain, full insert
           sequence.
          Length = 291

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 47/187 (25%), Positives = 71/187 (37%), Gaps = 33/187 (17%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETR-------- 439
           V + + A L  + HA S    EVMGL  G+ + D   +         GTE R        
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDD---IRSDSKFTYTGTEMRTVQEKMDT 68

Query: 440 ----------VNAQADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                     +  ++D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  IRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVVID---PTRTVSAGKVEIGAFRTYPEGYKPPDEPVS 724
            W S +DV TQ + Q   + F+ ++       +    G+V    F++         +  S
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQA------QKSS 182

Query: 725 EYQTIPL 745
           EY+ I +
Sbjct: 183 EYERIEI 189



>pir|I38167|I38167 hypothetical CpG-island associated protein C6.1A
           [imported] - human>gb:BX293995_1991749 Human DNA
           sequence from clone RP11-143H17 on chromosome X Contains
           the 3' end of a novel gene (C6.1A) and a
           phosphatidylinositol binding clathrin assembly protein
           (PICALM) pseudogene, complete
           sequence.>gb:BX470111_1991811 Human DNA sequence from
           clone GS1-273L24 on chromosome X Contains the 5' end of
           the F8 gene for coagulation factor VIII procoagulant
           component (hemophilia A), the FUNDC2 gene for FUN14
           domain containing 2, the MTCP1 gene for mature T-cell
           proliferation 1, the 5' end of a novel gene (C6.1A) and
           two CpG islands, complete sequence.>gb:HSRNAC61A_2020032
           H.sapiens c6.1A mRNA.
          Length = 291

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 48/187 (25%), Positives = 70/187 (37%), Gaps = 33/187 (17%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ---- 451
           V + + A L  + HA S    EVMGL  G+ + D             GTE R  A+    
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDT---RSDSKFAYTGTEMRTVAEKVDA 68

Query: 452 --------------ADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                         +D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVVID---PTRTVSAGKVEIGAFRTYPEGYKPPDEPVS 724
            W S +DV TQ + Q   + F+ ++       +    G+V    F++         +  S
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQA------QKSS 182

Query: 725 EYQTIPL 745
           EY+ I +
Sbjct: 183 EYERIEI 189



>sp|P46737|C61A_MOUSE C6.1A protein.>gb:AK030736_1162148 Mus
           musculus 8 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:5730441E05
           product:T-cell receptor alpha chain, full insert
           sequence.>gb:AK038919_1165214 Mus musculus adult male
           hypothalamus cDNA, RIKEN full-length enriched library,
           clone:A230075K09 product:T-cell receptor alpha chain,
           full insert sequence.>gb:BC021313_2093363 Mus musculus
           c6.1a protein, mRNA (cDNA clone MGC:29148
           IMAGE:5026715), complete cds.>gb:BC048179_2099573 Mus
           musculus c6.1a protein, mRNA (cDNA clone MGC:61192
           IMAGE:6825974), complete cds.>gb:S68022_2138948 Mus sp.
           c6.1A (c6.1A) mRNA, complete cds.
          Length = 291

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 47/187 (25%), Positives = 71/187 (37%), Gaps = 33/187 (17%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETR-------- 439
           V + + A L  + HA S    EVMGL  G+ + D   +         GTE R        
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDD---IRSDSKFTYTGTEMRTVQEKMDT 68

Query: 440 ----------VNAQADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                     +  ++D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  IRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVVID---PTRTVSAGKVEIGAFRTYPEGYKPPDEPVS 724
            W S +DV TQ + Q   + F+ ++       +    G+V    F++         +  S
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQA------QKSS 182

Query: 725 EYQTIPL 745
           EY+ I +
Sbjct: 183 EYERIEI 189



>gb:S68015_2040959 c6.1A [human, mRNA, 1020 nt].
          Length = 321

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 41/145 (28%), Positives = 56/145 (38%), Gaps = 30/145 (20%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ---- 451
           V + + A L  + HA S    EVMGL  G+ + D             GTE R  A+    
Sbjct: 17  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDT---RSDSKFAYTGTEMRTVAEKVDA 73

Query: 452 --------------ADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                         +D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 74  VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 133

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVV 628
            W S +DV TQ + Q   + F+ ++
Sbjct: 134 VWPSHVDVRTQAMYQMMDQGFVGLI 158



>gb:AL450024_1927860 Human DNA sequence from clone RP11-162J4 on
           chromosome 1 Contains the 5' end of a novel gene
           (KIAA1915), complete sequence.>gb:HS592A1_1999092 Human
           DNA sequence from clone RP4-592A1 on chromosome
           1p31.2-32.3 Contains the 3' end of a novel gene
           (KIAA1915), an adenylate kinase 2 (AK2) pseudogene, the
           TACSTD2 gene for tumor-associated calcium signal
           transducer 2 and a CpG island, complete sequence.
          Length = 828

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA 460
           +VK+++ ALL M +HA      EV+GL+ G+      +V    A P     T +  + D 
Sbjct: 576 QVKVASEALLIMDLHAHVS-MAEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCEMDP 634

Query: 461 YEYMVDYSQTNKQ-AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLAV 625
               V  +Q ++  A R  +V+GWYHSHP +    S  D+ TQ   Q +       F+ +
Sbjct: 635 ----VSQTQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGM 690

Query: 626 VIDP 637
           ++ P
Sbjct: 691 IVSP 694



>gb:AB067502_1870810 Homo sapiens mRNA for KIAA1915 protein, partial
           cds.
          Length = 726

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA 460
           +VK+++ ALL M +HA      EV+GL+ G+      +V    A P     T +  + D 
Sbjct: 474 QVKVASEALLIMDLHAHVS-MAEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCEMDP 532

Query: 461 YEYMVDYSQTNKQ-AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLAV 625
               V  +Q ++  A R  +V+GWYHSHP +    S  D+ TQ   Q +       F+ +
Sbjct: 533 ----VSQTQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGM 588

Query: 626 VIDP 637
           ++ P
Sbjct: 589 IVSP 592



>gb:AX399998_1467311 Sequence 169 from Patent WO0218424.
          Length = 980

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 5/124 (4%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADA 460
           +VK+++ ALL M +HA      EV+GL+ G+      +V    A P     T +  + D 
Sbjct: 507 QVKVASEALLIMDLHAHVS-MAEVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCEMDP 565

Query: 461 YEYMVDYSQTNKQ-AGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLAV 625
               V  +Q ++  A R  +V+GWYHSHP +    S  D+ TQ   Q +       F+ +
Sbjct: 566 ----VSQTQASETLAVRGFSVIGWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGM 621

Query: 626 VIDP 637
           ++ P
Sbjct: 622 IVSP 625



>gb:CR859371_1183489 Pongo pygmaeus mRNA; cDNA DKFZp459H1729 (from
           clone DKFZp459H1729).
          Length = 247

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 41/145 (28%), Positives = 56/145 (38%), Gaps = 30/145 (20%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ---- 451
           V + + A L  + HA S    EVMGL  G+ + D             GTE R  A+    
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDT---RSDSKFAYTGTEMRTVAEKVDA 68

Query: 452 --------------ADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                         +D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVV 628
            W S +DV TQ + Q   + F+ ++
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLI 153



>pir|T41067|T41067 26S proteasome regulatory subunit 12 - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPCC1682_1720995
           S.pombe chromosome III cosmid c1682.
          Length = 324

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVV---HARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           ++V +  L LL  V     +  G    V+G++ G+ +GD + V +++A+P E  E   + 
Sbjct: 15  QQVIVHPLVLLSAVDSYNRSAKGTKRRVVGILLGQNNGDVVNVANSYAIPFEEDEKNASV 74

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + +M   ++  K+    E +VGWYH+ P
Sbjct: 75  WFLDHNFMESMNEMFKKINANEKLVGWYHTGP 106



>sp|P46736|C61A_HUMAN C6.1A protein.>gb:AY438030_1950665 Homo
           sapiens BRCA1/BRCA2-containing complex subunit 36
           (BRCC36) mRNA, complete cds.>gb:BC002999_1968596 Homo
           sapiens chromosome X open reading frame 53, mRNA (cDNA
           clone MGC:3961 IMAGE:2821917), complete
           cds.>gb:BC006540_1970370 Homo sapiens chromosome X open
           reading frame 53, mRNA (cDNA clone MGC:2329
           IMAGE:2821917), complete cds.>gb:BX293995_1991750 Human
           DNA sequence from clone RP11-143H17 on chromosome X
           Contains the 3' end of a novel gene (C6.1A) and a
           phosphatidylinositol binding clathrin assembly protein
           (PICALM) pseudogene, complete
           sequence.>gb:BX470111_1991812 Human DNA sequence from
           clone GS1-273L24 on chromosome X Contains the 5' end of
           the F8 gene for coagulation factor VIII procoagulant
           component (hemophilia A), the FUNDC2 gene for FUN14
           domain containing 2, the MTCP1 gene for mature T-cell
           proliferation 1, the 5' end of a novel gene (C6.1A) and
           two CpG islands, complete sequence.
          Length = 316

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 41/145 (28%), Positives = 56/145 (38%), Gaps = 30/145 (20%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQ---- 451
           V + + A L  + HA S    EVMGL  G+ + D             GTE R  A+    
Sbjct: 12  VHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDT---RSDSKFAYTGTEMRTVAEKVDA 68

Query: 452 --------------ADAYEYMVDYSQTNKQA------------GRLENVVGWYHSHPGYG 553
                         +D  +  V+ S     A            GR   VVGWYHSHP   
Sbjct: 69  VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHIT 128

Query: 554 CWLSGIDVSTQMLNQQFQEPFLAVV 628
            W S +DV TQ + Q   + F+ ++
Sbjct: 129 VWPSHVDVRTQAMYQMMDQGFVGLI 153



>gb:S72931_2041284 Homo sapiens T-cell receptor alpha chain-c6.1A
           fusion protein (c6.1A-TCRC) gene, partial cds.
          Length = 363

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +2

Query: 503 GRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
           GR   VVGWYHSHP    W S +DV TQ + Q   + F+ ++
Sbjct: 68  GRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLI 109



>gb:AF285833_1783147 Arabidopsis thaliana eukaryotic initiation
           factor 3H1 subunit (TIF3H1) mRNA, complete cds.
          Length = 337

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 30/120 (25%), Positives = 56/120 (46%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
           V+I  LA+LK++ H +      V G + G   G  + V + F  PV   +  +  +AD  
Sbjct: 25  VQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEI--EADGA 82

Query: 464 EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTR 643
            Y ++  +  ++     N VGWY S    G + +   + T M  Q+  +  + ++ DP++
Sbjct: 83  NYQLEMMRCLREVNVDNNTVGWYQS-TVLGSYQTVELIETFMNYQENIKRCVCIIYDPSK 141



>gb:CR382138_1671529 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 339

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH---ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           K V +S L LL +V H           V+G++ G    D I V +++A+P E  E   + 
Sbjct: 13  KTVTVSPLVLLSVVDHYNRVAKDSKKRVVGVVLGDNSSDTIRVTNSYAIPFEEDEKNPSV 72

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + ++    +  K+    E ++GWYHS P
Sbjct: 73  WFLDHNFIESMGEMFKKINAKEKLIGWYHSGP 104



>sp|Q9C5Z2|IF33_ARATH Eukaryotic translation initiation factor 3
           subunit 3 (eIF-3 gamma) (eIF3 p38 subunit)
           (eIF3h).>pir|B86242|B86242 hypothetical protein
           [imported] - Arabidopsis thaliana>gb:AE005172_890097
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AY054641_1563295 Arabidopsis thaliana
           Unknown protein (T16B5.3) mRNA, complete
           cds.>gb:AY081546_1568806 Arabidopsis thaliana unknown
           protein (T16B5.3) mRNA, complete
           cds.>gb:AY087338_1572370 Arabidopsis thaliana clone
           34385 mRNA, complete sequence.>gb:BT000765_1635036
           Arabidopsis thaliana clone RAFL09-35-P08 (R18748)
           putative translation initiation factor (At1g10840) mRNA,
           complete cds.>gb:T16B5_1723513 Arabidopsis thaliana
           chromosome 1 BAC T16B5 sequence, complete sequence.
          Length = 337

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 30/120 (25%), Positives = 56/120 (46%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
           V+I  LA+LK++ H +      V G + G   G  + V + F  PV   +  +  +AD  
Sbjct: 25  VQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEI--EADGA 82

Query: 464 EYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTR 643
            Y ++  +  ++     N VGWY S    G + +   + T M  Q+  +  + ++ DP++
Sbjct: 83  NYQLEMMRCLREVNVDNNTVGWYQS-TVLGSYQTVELIETFMNYQENIKRCVCIIYDPSK 141



>gb:AY558039_1614266 Saccharomyces cerevisiae clone FLH006585.01X
           YOR261C gene, complete cds.
          Length = 338

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIE---VMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           ++V I+ L LL  + H     T E    +G++ G  +   I V ++FALP E  E   + 
Sbjct: 6   EKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDV 65

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + Y+ + ++  K+    E ++GWYHS P
Sbjct: 66  WFLDHNYIENMNEMCKKINAKEKLIGWYHSGP 97



>pir|S67158|S67158 26S proteasome regulatory particle chain RPN8 -
           yeast  (Saccharomyces cerevisiae)>gb:SCYOR261C_1714502
           S.cerevisiae chromosome XV reading frame ORF YOR261c.
          Length = 338

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIE---VMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           ++V I+ L LL  + H     T E    +G++ G  +   I V ++FALP E  E   + 
Sbjct: 6   EKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDV 65

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + Y+ + ++  K+    E ++GWYHS P
Sbjct: 66  WFLDHNYIENMNEMCKKINAKEKLIGWYHSGP 97



>gb:CR382129_1661323 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 445

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/114 (27%), Positives = 47/114 (41%)
 Frame = +2

Query: 317 VVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNK 496
           V HA +   +E  G++ GK   +A  V      P E T      Q    E + +    N 
Sbjct: 288 VAHANTVKNLETCGILCGKLSRNAFFVTHLMIPPQESTSD--TCQTTNEELLFEQIDEND 345

Query: 497 QAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAG 658
                  V+GW H+HP   C++S +D+ TQ   Q      +A+V  P    + G
Sbjct: 346 LF-----VLGWIHTHPTQTCFMSSVDLHTQNSYQIMLPEAVALVCAPQHDPNFG 394



>gb:CR380957_1652895 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 329

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIE---VMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA 454
           V I+ L LL ++ H     T E    +G++ G +  + I V ++FALP E  E   +   
Sbjct: 8   VTIAPLVLLSVLDHYERTNTPEGKRCVGVILGDSQTNTIRVTNSFALPFEEDEKNSDVWF 67

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
             + Y+   ++  K+    E ++GWYHS P
Sbjct: 68  LDHNYIESMNEMCKKINAKEKLIGWYHSGP 97



>gb:BC044358_2548668 Danio rerio proteasome (prosome, macropain) 26S
           subunit, non-ATPase, 7 (Mov34 homolog), mRNA (cDNA clone
           MGC:55284 IMAGE:2600064), complete
           cds.>gb:BC066605_2554472 Danio rerio proteasome
           (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34
           homolog), mRNA (cDNA clone MGC:77188 IMAGE:6961810),
           complete cds.
          Length = 327

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           +RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   ERVVVHPLVLLSVVDHFNRIGKVGSQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +Q+    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKQYCSNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>gb:AP003284_1827238 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0671D01.>gb:AP004364_1840802 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0445H04.
          Length = 537

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/61 (42%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +2

Query: 524 GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVI---DPTRTVSAGKVEIGAFRTYPE 694
           GW H+HP   C+LS ID+ TQ   Q      +A+VI   DPTR V  G+   G FR    
Sbjct: 429 GWIHTHPSQTCFLSSIDLHTQYSYQVMLPEAVAIVIAPTDPTRQVFYGR-NCGIFRLTDP 487

Query: 695 G 697
           G
Sbjct: 488 G 488



>gb:CR382130_1663132 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 337

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 3/123 (2%)
 Frame = +2

Query: 275 FKRVKISALALLKMVVHARS---GGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           +++V ++ L LL +V H           V+G++ G   G+ I V +++A+P E  + + +
Sbjct: 25  YEQVTVAPLVLLSVVDHYNRIAMNTKKRVVGVLLGDNTGNTIRVTNSYAIPFEEDDKQPD 84

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                + ++ +     K+    E ++GWYHS P     L   D+    L +++    L +
Sbjct: 85  VWFLDHNFVENMGDMFKKINAKEKLIGWYHSGPN----LRASDLQINELFKRYTPNPLLL 140

Query: 626 VID 634
           ++D
Sbjct: 141 IVD 143



>gb:CR382123_1655885 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 333

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
 Frame = +2

Query: 275 FKRVKISALALLKMVVHARSGGTIE---VMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           +++V ++ L LL ++ H +   T E    +G++ G +    + + ++FALP E  E   +
Sbjct: 5   YEQVSVAPLVLLSVLDHHQRTNTPENKRCLGVILGDSSTATVRITNSFALPFEEDEKNPD 64

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHS 538
                + Y+   ++  K+    E ++GWYHS
Sbjct: 65  VWFLDHNYIETMNEMCKKINAKEKLIGWYHS 95



>gb:AC098833_1736909 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1288_A07, complete sequence.
          Length = 430

 Score = 42.0 bits (97), Expect = 0.027
 Identities = 43/168 (25%), Positives = 71/168 (42%), Gaps = 22/168 (13%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGD------AIIVMDAFALPVEGTETRVN 445
           V+I     L  + HA +  T EVMGL+ G           A+I   +  +  E  + RV 
Sbjct: 6   VRIGEEVWLTCLSHALTTETEEVMGLLFGDIKHSSRGGVTALIWGASPQMRCERKKDRVE 65

Query: 446 ----------AQAD-AYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQML 592
                     AQA+ ++   +     +   G    V+GWYHSHP      S +DV TQ +
Sbjct: 66  VNPELLAAATAQAEISFFPSISVIFLSATIGEKTRVIGWYHSHPHITVLPSHVDVRTQAM 125

Query: 593 NQQFQEPFLAVVID--PTRTVSAGKVEIGAFRTY---PEGYKPPDEPV 721
            Q  +  F+ ++           GK+++ AF++     +   P ++PV
Sbjct: 126 FQLMEPGFVGLIFSCFSEDAQKVGKIQVIAFQSLGGNQQSVVPVNDPV 173



>gb:BC061390_2553164 Xenopus tropicalis hypothetical protein
           MGC75962, mRNA (cDNA clone MGC:75962 IMAGE:5384136),
           complete cds.
          Length = 429

 Score = 41.6 bits (96), Expect = 0.035
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 7/90 (7%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  SAG +E+ A 
Sbjct: 336 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTSAGMLEVSAC 395

Query: 680 RTYPEGYKPPDEPVSEYQTIPLNKIEDFGV 769
           +   +G+ P  +   ++ T     ++D G+
Sbjct: 396 K--KKGFHPHSKEPRQFNTCRHVTVQDAGI 423



>gb:CNS07EGB_1373112 chromosome IV of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 258

 Score = 41.6 bits (96), Expect = 0.035
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
           V +  L LL  V H +  GT  V G++ G  DG+ I + ++FA   E  E          
Sbjct: 4   VIVHPLVLLSAVDHYKRKGTKRVAGILLGDDDGE-IHITESFACIFEEDEDGWFMDTSYI 62

Query: 464 EYMVD--YSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
             M D  Y   +K       V+GWYH+ P    + + +D+ T+ L    + PFLA++
Sbjct: 63  RSMFDLFYKVNHKL-----KVMGWYHTGP--RMYENDLDI-TRSLGSFVESPFLAII 111



>gb:BC088002_2565516 Xenopus tropicalis cDNA clone MGC:107920
           IMAGE:7024376, complete cds.
          Length = 320

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 4/122 (3%)
 Frame = +2

Query: 281 RVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   + 
Sbjct: 8   RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSV 67

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
               ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V+
Sbjct: 68  WFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVI 123

Query: 629 ID 634
           ID
Sbjct: 124 ID 125



>gb:BC081139_2562042 Xenopus laevis MGC84052 protein, mRNA (cDNA
           clone MGC:84052 IMAGE:6948113), complete cds.
          Length = 320

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 4/122 (3%)
 Frame = +2

Query: 281 RVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   + 
Sbjct: 8   RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSV 67

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
               ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V+
Sbjct: 68  WFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVI 123

Query: 629 ID 634
           ID
Sbjct: 124 ID 125



>gb:BC078476_2561017 Xenopus laevis cDNA clone IMAGE:6872787,
           partial cds.
          Length = 309

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 4/122 (3%)
 Frame = +2

Query: 281 RVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   + 
Sbjct: 8   RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSV 67

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
               ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V+
Sbjct: 68  WFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVI 123

Query: 629 ID 634
           ID
Sbjct: 124 ID 125



>gb:BC077668_2560363 Xenopus tropicalis Psmd7 protein, mRNA (cDNA
           clone IMAGE:7027546), partial cds.
          Length = 316

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 4/122 (3%)
 Frame = +2

Query: 281 RVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   + 
Sbjct: 8   RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWHKKILDVSNSFAVPFDEDDKDDSV 67

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
               ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V+
Sbjct: 68  WFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVI 123

Query: 629 ID 634
           ID
Sbjct: 124 ID 125



>gb:AJ719835_2502022 Gallus gallus partial mRNA for hypothetical
           protein, clone 7b3.
          Length = 322

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 4/122 (3%)
 Frame = +2

Query: 281 RVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           RV +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +     
Sbjct: 8   RVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKILDVSNSFAVPFDEDDKDDTV 67

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVV 628
               ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V+
Sbjct: 68  WFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLVI 123

Query: 629 ID 634
           ID
Sbjct: 124 ID 125



>gb:BC000338_1966628 Homo sapiens proteasome (prosome, macropain)
           26S subunit, non-ATPase, 7 (Mov34 homolog), mRNA (cDNA
           clone IMAGE:2822691), partial cds.
          Length = 326

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>gb:BT012645_1641715 Arabidopsis thaliana At1g10600 mRNA, complete
           cds.>gb:AK175458_1817446 Arabidopsis thaliana mRNA for
           hypothetical protein, complete cds, clone:
           RAFL21-88-J24.
          Length = 223

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT 640
           VGW H+HP  GC++S +D+ T    Q       A+V+ PT
Sbjct: 123 VGWIHTHPSQGCFMSSVDLHTHYSYQVMVPEAFAIVVAPT 162



>gb:AK031013_1162255 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830490F08
           product:proteasome (prosome, macropain) 26S subunit,
           non-ATPase, 7, full insert sequence.
          Length = 312

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>pir|S65491|S65491 26S proteasome regulatory chain 12 - human
          Length = 321

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>pir|JC4154|JC4154 26S proteasome regulatory chain, p40 -
           human>gb:HUMP40MOV_2035389 Homo sapiens mRNA for
           proteasome subunit p40 / Mov34 protein, complete cds.
          Length = 324

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIVKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>sp|P26516|PSD7_MOUSE 26S proteasome non-ATPase regulatory subunit 7
           (26S proteasome regulatory subunit S12) (Proteasome
           subunit p40) (Mov34 protein).>pir|A40556|BWMSV4 Mov-34
           protein - mouse>gb:MUSMOV34_2129214 Mouse Mov-34 protein
           mRNA, complete cds.>gb:MUSMOV347_2129215 Mouse Mov-34 36
           kD protein gene, exon 7.
          Length = 321

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>sp|P51665|PSD7_HUMAN 26S proteasome non-ATPase regulatory subunit 7
           (26S proteasome regulatory subunit S12) (Proteasome
           subunit p40) (Mov34 protein
           homolog).>gb:BC012606_1973705 Homo sapiens proteasome
           (prosome, macropain) 26S subunit, non-ATPase, 7 (Mov34
           homolog), mRNA (cDNA clone MGC:13607 IMAGE:4334058),
           complete cds.
          Length = 324

 Score = 41.2 bits (95), Expect = 0.046
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 4/123 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH----ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVN 445
           ++V +  L LL +V H     + G    V+G++ G      + V ++FA+P +  +   +
Sbjct: 7   QKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDS 66

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E +VGWYH+ P     L   D++   L +++    + V
Sbjct: 67  VWFLDHDYLENMYGMFKKVNARERIVGWYHTGPK----LHKNDIAINELMKRYCPNSVLV 122

Query: 626 VID 634
           +ID
Sbjct: 123 IID 125



>gb:BC068799_2555299 Xenopus laevis hypothetical protein MGC81376,
           mRNA (cDNA clone MGC:81376 IMAGE:6634402), complete cds.
          Length = 431

 Score = 40.8 bits (94), Expect = 0.060
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 7/90 (7%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  SAG +E+ A 
Sbjct: 338 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTSAGMLEVSAC 397

Query: 680 RTYPEGYKPPDEPVSEYQTIPLNKIEDFGV 769
           +   +G+ P  +   ++ T     + D G+
Sbjct: 398 K--KKGFHPHSKEPRQFNTCRHVMVRDAGI 425



>gb:AE017341_1753875 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 350

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 3/133 (2%)
 Frame = +2

Query: 284 VKISALALLKMVVHARS---GGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQA 454
           V I  L LL +V HA          V+G++ G+ +G +I V ++FA+P E  E       
Sbjct: 17  VVIHPLVLLSVVDHAARVPLSKNKRVLGVLLGQDNGTSINVANSFAIPFEEDERDPKTFF 76

Query: 455 DAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVID 634
              +Y+ +  +  ++    E  +G+YH+ P     L   D+    L ++F    + V++D
Sbjct: 77  LDLDYVEEMWRMFRKVNAKERPIGFYHTGPR----LRSSDLEITELFKRFCPRPVMVIVD 132

Query: 635 PTRTVSAGKVEIG 673
             RT S G+ + G
Sbjct: 133 -VRT-SGGRGDTG 143



>gb:SPAC19B12_1716908 S.pombe chromosome I cosmid c19B12.
          Length = 435

 Score = 39.3 bits (90), Expect = 0.18
 Identities = 31/130 (23%), Positives = 53/130 (40%), Gaps = 3/130 (2%)
 Frame = +2

Query: 317 VVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA--QADAYEYMVDYSQT 490
           VV   +   +E  G++ GK   +A  +        E T        +A  +E+   ++  
Sbjct: 276 VVKPNTKKNLETCGILCGKLRQNAFFITHLVIPLQEATSDTCGTTDEASLFEFQDKHNLL 335

Query: 491 NKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEI 670
                     +GW H+HP   C++S +D+ T    Q      +A+V+ P++  S      
Sbjct: 336 T---------LGWIHTHPTQTCFMSSVDLHTHCSYQLMLPEAIAIVMAPSKNTS------ 380

Query: 671 GAFRTY-PEG 697
           G FR   PEG
Sbjct: 381 GIFRLLDPEG 390



>gb:AP005838_1858819 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0041C07.
          Length = 454

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 8/77 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTR--------TVSAGKVEIGA 676
           +GW H+HP   C++S +D+     NQ+      A+V+ P++        TV  G  EIG 
Sbjct: 358 LGWIHTHPTQECFMSSVDLHNHYSNQKDLREAFAIVVAPSKREQNIFHLTVPDGMDEIG- 416

Query: 677 FRTYPEGYKPPDEPVSE 727
                 G+ P D    E
Sbjct: 417 -DCDDRGFHPHDRTTYE 432



>pir|D70446|D70446 conserved hypothetical protein aq_1691 - Aquifex
           aeolicus>gb:AE000751_26951 Aquifex aeolicus VF5 section
           83 of 109 of the complete genome.>gb:AE000657_977482
           Aquifex aeolicus VF5 complete genome.
          Length = 138

 Score = 38.9 bits (89), Expect = 0.23
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 2/91 (2%)
 Frame = +2

Query: 284 VKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAY 463
           +K+    L KM+  A      E  GL+ GK++G   I  +AF  P        + + D Y
Sbjct: 2   LKVKKEVLEKMIKQAERDYPYETCGLLIGKSEGGIRIAYEAFETP----NANPDRKHDRY 57

Query: 464 EYM-VDYSQTNKQA-GRLENVVGWYHSHPGY 550
           E    DY +    A  +   +VG YHSHP +
Sbjct: 58  EIAPKDYMRAEDYAISKGMEIVGVYHSHPDH 88



>gb:HSM806021_2018139 Homo sapiens mRNA; cDNA DKFZp313C082 (from
           clone DKFZp313C082); complete cds.
          Length = 234

 Score = 38.1 bits (87), Expect = 0.39
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 5/102 (4%)
 Frame = +2

Query: 347 EVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQ-AGRLENVV 523
           EV+GL+ G+      +V    A P     T +  + D     V  +Q ++  A R  +V+
Sbjct: 3   EVIGLLGGRYSEVDKVVEVCAAEPCNSLSTGLQCEMDP----VSQTQASETLAVRGFSVI 58

Query: 524 GWYHSHPGYGCWLSGIDVSTQMLNQQF----QEPFLAVVIDP 637
           GWYHSHP +    S  D+ TQ   Q +       F+ +++ P
Sbjct: 59  GWYHSHPAFDPNPSLRDIDTQAKYQSYFSRGGAKFIGMIVSP 100



>gb:AE013599_1133765 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003464_1211064 Drosophila melanogaster
           chromosome 2R, section 72 of 74 of the complete
           sequence.>gb:AY089283_1296939 Drosophila melanogaster
           AT07973 full insert cDNA.
          Length = 338

 Score = 37.7 bits (86), Expect = 0.51
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 5/123 (4%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTI----EVMGLMQGKTDGDAII-VMDAFALPVEGTETRVN 445
           +V +  L LL +V H    G I     V+G++ G      ++ V ++FA+P +  +   +
Sbjct: 10  KVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNSFAVPFDEDDKDKS 69

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAV 625
                ++Y+ +     K+    E VVGWYH+ P     L   D++   L +++    + V
Sbjct: 70  VWFLDHDYLENMYGMFKKVNARERVVGWYHTGPK----LHQNDIAINELVRRYCPNSVLV 125

Query: 626 VID 634
           +ID
Sbjct: 126 IID 128



>gb:AP003331_1828036 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1088D01.
          Length = 517

 Score = 37.4 bits (85), Expect = 0.67
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRT 646
           +GW H+HP   C+LS ID+      Q      +A+V+ PT T
Sbjct: 417 LGWIHTHPTQSCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDT 458



>gb:BC074422_2557927 Xenopus laevis MGC84444 protein, mRNA (cDNA
           clone MGC:84444 IMAGE:7019737), complete cds.
          Length = 431

 Score = 37.0 bits (84), Expect = 0.87
 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 7/79 (8%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  SAG +E+   
Sbjct: 338 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTSAGMLEVSVC 397

Query: 680 RTYPEGYKPPDEPVSEYQT 736
           +   +G+ P  +   ++ T
Sbjct: 398 K--KKGFHPHSKEPRQFST 414



>gb:AP004224_1838931 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1111E11.
          Length = 518

 Score = 37.0 bits (84), Expect = 0.87
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 8/75 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKV-------EIGAF 679
           +GW H+HP   C+LS ID+      Q      +A+V+ PT T     +        +G  
Sbjct: 416 LGWIHTHPTQTCFLSSIDLHNHYSYQVMLPEAIAIVMAPTDTTRKHGIFHLTDPGGMGVI 475

Query: 680 RTYPE-GYKPPDEPV 721
               E G+ P +EP+
Sbjct: 476 HDCQESGFHPHEEPL 490



>gb:AX886042_1481495 Sequence 1905 from Patent EP1033401.
          Length = 58

 Score = 37.0 bits (84), Expect = 0.87
 Identities = 18/29 (62%), Positives = 24/29 (82%)
 Frame = +2

Query: 278 KRVKISALALLKMVVHARSGGTIEVMGLM 364
           ++V IS+LALLKM+ H R+G  +EVMGLM
Sbjct: 29  EQVYISSLALLKMLKHGRAGVPMEVMGLM 57



>gb:BC056382_2102355 Mus musculus sex comb on midleg-like 2
           (Drosophila), mRNA (cDNA clone MGC:73927 IMAGE:6853936),
           complete cds.
          Length = 722

 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 562 PWTEDPRLF 570



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 534 PWTEDPRLF 542



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 506 PWTEDPRLF 514



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 478 PWTEDPRLF 486



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 450 PWTEDPRLF 458



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 422 PWTEDPRLF 430



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 394 PWTEDPRLF 402



 Score = 20.4 bits (41), Expect(8) = 1.4
 Identities = 6/9 (66%), Positives = 6/9 (66%)
 Frame = +2

Query: 251 PWTNDPHYF 277
           PWT DP  F
Sbjct: 366 PWTEDPRLF 374



>gb:BC082885_2562959 Xenopus laevis hypothetical LOC494775, mRNA
           (cDNA clone MGC:84247 IMAGE:6955867), complete cds.
          Length = 416

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 30/132 (22%), Positives = 51/132 (38%), Gaps = 10/132 (7%)
 Frame = +2

Query: 344 IEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVV 523
           +E  G++ GK   +   V         G     N +++   +++       Q G +   +
Sbjct: 271 VETCGILCGKLLQNEFTVTHVIVPKQSGGPDYCNTESEEELFLIQ-----DQQGLI--TL 323

Query: 524 GWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAFR 682
           GW H+HP    +LS +D+ T    Q      +A+V  P        +    G  EIG  R
Sbjct: 324 GWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLTDYGMKEIGECR 383

Query: 683 T---YPEGYKPP 709
               +P   +PP
Sbjct: 384 QKGFHPHCKEPP 395



>gb:AF164597_2477920 Lapemis hardwickii AMSH-like mRNA, complete
           cds.
          Length = 397

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 7/59 (11%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGA 676
           +GW HSHP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A
Sbjct: 304 LGWIHSHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNEVGIFRLTNAGMLEVSA 362



>gb:AY084581_1569669 Arabidopsis thaliana clone 112350 mRNA,
           complete sequence.
          Length = 507

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           +GW H+HP   C++S IDV T    Q      +A+V+ P
Sbjct: 407 LGWIHTHPTQSCFMSSIDVHTHYSYQIMLPEAVAIVMAP 445



>gb:AY072212_1567099 Arabidopsis thaliana unknown protein
           (At1g48790) mRNA, complete cds.>gb:AY096591_1576131
           Arabidopsis thaliana unknown protein (At1g48790) mRNA,
           complete cds.
          Length = 507

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           +GW H+HP   C++S IDV T    Q      +A+V+ P
Sbjct: 407 LGWIHTHPTQSCFMSSIDVHTHYSYQIMLPEAVAIVMAP 445



>gb:AC073555_1541083 Arabidopsis thaliana chromosome 1 BAC F11I4
           genomic sequence, complete sequence.
          Length = 505

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 15/39 (38%), Positives = 22/39 (56%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
           +GW H+HP   C++S IDV T    Q      +A+V+ P
Sbjct: 405 LGWIHTHPTQSCFMSSIDVHTHYSYQIMLPEAVAIVMAP 443



>gb:CR861012_1185047 Pongo pygmaeus mRNA; cDNA DKFZp459M0218 (from
           clone DKFZp459M0218).
          Length = 436

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A 
Sbjct: 343 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLSEAIAIVCSPKHKDTGIFRLTNAGMLEVSAC 402

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 403 K--KKGFHP 409



>sp|P26270|PSD7_DROME 26S proteasome non-ATPase regulatory subunit 7
           (26S proteasome regulatory subunit S12) (Proteasome
           subunit p40) (Mov34 protein).>gb:DROMOV34_1382308
           Drosophila melanogaster Mov34 protein mRNA, complete
           cds.
          Length = 338

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +2

Query: 281 RVKISALALLKMVVHARSGGTI----EVMGLMQGKTDGDAII-VMDAFALPVEGTETRVN 445
           +V +  L LL +V H    G I     V+G++ G      ++ V + FA+P +  +   +
Sbjct: 10  KVIVHPLVLLSVVDHFNRMGKIGNQKRVVGVLLGCWRSKGVLDVSNTFAVPFDVDDKDKS 69

Query: 446 AQADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
                ++Y+ +     K+    E VVGWYH+ P
Sbjct: 70  VWFLDHDYLENMYGMFKKVNARERVVGWYHTGP 102



>gb:AL157394_1920888 Human DNA sequence from clone RP11-399O19 on
           chromosome 10 Contains the 5' end of a novel gene
           (MGC22805), a novel pseudogene (FLJ12598), the gene for
           a novel Mov34/MPN/PAD-1 family domain containing protein
           (KIAA1373 FLJ35627 FLJ33359), a novel gene (FLJ36021),
           the ACTA2 gene for actin alpha 2 smooth muscle aorta,
           the TNFRSF6 gene for tumor necrosis factor receptor
           superfamily member 6 and two CpG islands, complete
           sequence.
          Length = 270

 Score = 35.4 bits (80), Expect = 2.5
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A 
Sbjct: 177 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSAC 236

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 237 K--KKGFHP 243



>gb:AL157394_1920886 Human DNA sequence from clone RP11-399O19 on
           chromosome 10 Contains the 5' end of a novel gene
           (MGC22805), a novel pseudogene (FLJ12598), the gene for
           a novel Mov34/MPN/PAD-1 family domain containing protein
           (KIAA1373 FLJ35627 FLJ33359), a novel gene (FLJ36021),
           the ACTA2 gene for actin alpha 2 smooth muscle aorta,
           the TNFRSF6 gene for tumor necrosis factor receptor
           superfamily member 6 and two CpG islands, complete
           sequence.
          Length = 461

 Score = 35.4 bits (80), Expect = 2.5
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A 
Sbjct: 343 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSAC 402

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 403 K--KKGFHP 409



>gb:AB037794_1866585 Homo sapiens mRNA for KIAA1373 protein, partial
           cds.
          Length = 463

 Score = 35.4 bits (80), Expect = 2.5
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A 
Sbjct: 345 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSAC 404

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 405 K--KKGFHP 411



>gb:BT020354_1642749 Arabidopsis thaliana At4g16144 gene, complete
           cds.
          Length = 507

 Score = 35.4 bits (80), Expect = 2.5
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT 640
           +GW H+HP   C++S +D+ T    Q      +A+V+ PT
Sbjct: 407 LGWIHTHPTQTCFMSSVDLHTHYSYQIMLPEAVAIVMAPT 446



>pir|JC7982|JC7982 AMSH-like protein (AMSH-LP) -
           Human>gb:AB010120_1864159 Homo sapiens mRNA for AMSH-LP,
           complete cds.>gb:AL157394_1920887 Human DNA sequence
           from clone RP11-399O19 on chromosome 10 Contains the 5'
           end of a novel gene (MGC22805), a novel pseudogene
           (FLJ12598), the gene for a novel Mov34/MPN/PAD-1 family
           domain containing protein (KIAA1373 FLJ35627 FLJ33359),
           a novel gene (FLJ36021), the ACTA2 gene for actin alpha
           2 smooth muscle aorta, the TNFRSF6 gene for tumor
           necrosis factor receptor superfamily member 6 and two
           CpG islands, complete sequence.>gb:BC010846_1972787 Homo
           sapiens associated molecule with the SH3 domain of STAM
           (AMSH) like protein, mRNA (cDNA clone MGC:8774
           IMAGE:3898533), complete cds.
          Length = 436

 Score = 35.4 bits (80), Expect = 2.5
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+ A 
Sbjct: 343 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSAC 402

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 403 K--KKGFHP 409



>gb:AY075309_1296157 Drosophila melanogaster AT31826 full insert
           cDNA.
          Length = 420

 Score = 34.7 bits (78), Expect = 4.3
 Identities = 26/104 (25%), Positives = 40/104 (38%)
 Frame = +2

Query: 326 ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAG 505
           A +   IE  G++ G    + + +        +GT    N     +E  +   Q   Q  
Sbjct: 266 ANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTM---HEEQIFDVQDQMQLI 322

Query: 506 RLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
            L    GW H+HP    +LS +D+ T    Q      LA+V  P
Sbjct: 323 TL----GWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAP 362



>gb:AE014297_1142186 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003774_1224179 Drosophila melanogaster
           chromosome 3R, section 112 of 118 of the complete
           sequence.
          Length = 420

 Score = 34.7 bits (78), Expect = 4.3
 Identities = 26/104 (25%), Positives = 40/104 (38%)
 Frame = +2

Query: 326 ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAG 505
           A +   IE  G++ G    + + +        +GT    N     +E  +   Q   Q  
Sbjct: 266 ANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGTPDSCNTM---HEEQIFDVQDQMQLI 322

Query: 506 RLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDP 637
            L    GW H+HP    +LS +D+ T    Q      LA+V  P
Sbjct: 323 TL----GWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVCAP 362



>gb:AY083159_2075977 Rattus norvegicus AMSH mRNA, complete
           cds.>gb:BC061711_2104573 Rattus norvegicus associated
           molecule with the SH3 domain of STAM, mRNA (cDNA clone
           MGC:72308 IMAGE:5597943), complete cds.
          Length = 424

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 10/73 (13%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        +    G  EI   
Sbjct: 331 LGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTC 390

Query: 680 RT---YPEGYKPP 709
           R    +P G  PP
Sbjct: 391 RQKGFHPHGRDPP 403



>gb:AF175409_1887943 Homo sapiens MOT8 mRNA, complete
           cds.>gb:AL391808_1927029 Human DNA sequence from clone
           RP11-319A11 on chromosome 1 Contains the 5' end of the
           gene for a transmembrane protein SHREW1 and a CpG
           island\n\, complete sequence.>gb:AY282806_1941897 Homo
           sapiens transmembrane protein SHREW1 mRNA, complete
           cds.>gb:HS426F10_1998580 Human DNA sequence from clone
           RP3-426F10 on chromosome 1p36.21-36.33 Contains 3' end
           of the gene for the transmembrane protein SHREW1,
           complete sequence.>gb:HS77N19_1999474 Human DNA sequence
           from clone RP1-77N19 on chromosome 1p36.2-36.3 Contains
           part of the gene for the transmembrane protein SHREW1,
           complete sequence.
          Length = 411

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = +3

Query: 315 WLSMRAPVAPSRLWALCRGKPTATPSLSWMP 407
           WL  R+P  P RLW+   G+P   P+  W P
Sbjct: 51  WLLPRSPPRPPRLWSFRSGQPARVPAPVWSP 81



>gb:AK017600_1159233 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730422L11
           product:associated molecule with the SH3 domain of STAM,
           full insert sequence.>gb:AK019907_1160238 Mus musculus
           adult male pituitary gland cDNA, RIKEN full-length
           enriched library, clone:5330424L14 product:associated
           molecule with the SH3 domain of STAM, full insert
           sequence.>gb:AB010123_2043514 Mus musculus mRNA for
           AMSH, complete cds.>gb:BC003497_2089262 Mus musculus
           Stam binding protein, mRNA (cDNA clone MGC:6953
           IMAGE:3153829), complete cds.>gb:BC006939_2090501 Mus
           musculus Stam binding protein, mRNA (cDNA clone MGC:6839
           IMAGE:2649718), complete cds.>gb:BC025111_2094912 Mus
           musculus Stam binding protein, mRNA (cDNA clone
           MGC:36212 IMAGE:4194332), complete cds.
          Length = 424

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 10/73 (13%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        +    G  EI   
Sbjct: 331 LGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTC 390

Query: 680 RT---YPEGYKPP 709
           R    +P G  PP
Sbjct: 391 RQKGFHPHGRDPP 403



>gb:AY458641_619591 Uncultured bacterium 463 clone EBAC080-L32B05
           genomic sequence.
          Length = 185

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = +2

Query: 443 NAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLA 622
           N+QAD Y  M+ +  T ++       V  Y+S   Y CW  G  VS   + Q  Q  F+ 
Sbjct: 85  NSQADLY--MIWHLVTEERTD-----VRSYNSMSYYNCWGCGPAVSDVSVRQYTQGTFIV 137

Query: 623 VVIDPTRTVSAGKVEI-GAFRTYPE 694
            +IDP R+ S  +  I    R  PE
Sbjct: 138 DMIDPLRSKSVWRSVIESRLRNQPE 162



>gb:AE017311_438819 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 3 of 12 of the complete
           genome.>gb:AE017285_1071980 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 338

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = +2

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGI 571
           + D +  +V+   T  Q GRL  VV WY +  GY C L+ +
Sbjct: 289 KGDPHSSIVEAEYTTVQDGRLAKVVAWYDNEWGYSCRLADL 329



>sp|O24412|PSD7_ARATH Probable 26S proteasome non-ATPase regulatory
           subunit 7 (MOV34 protein).>gb:AB005237_1509414
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MJJ3.>gb:ATU54560_1557087 Arabidopsis thaliana
           putative 26S proteasome subunit athMOV34 mRNA, complete
           cds.>gb:AY087393_1572424 Arabidopsis thaliana clone
           34868 mRNA, complete sequence.>gb:AY230839_1591561
           Arabidopsis thaliana 26S proteasome subunit RPN8a
           (RPN8a) mRNA, RPN8a-1 allele, complete
           cds.>gb:AY230840_1591562 Arabidopsis thaliana 26S
           proteasome subunit RPN8a (RPN8a) mRNA, RPN8a-2 allele,
           complete cds.>gb:BT002610_1636213 Arabidopsis thaliana
           At5g05780/MJJ3_19 mRNA, complete
           cds.>gb:AF378878_1793463 Arabidopsis thaliana
           AT5g05780/MJJ3_19 mRNA, complete cds.
          Length = 308

 Score = 34.3 bits (77), Expect = 5.7
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH---ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           ++V +  L LL +V H        +  V+G++ G +    + V +++A+P E  +   + 
Sbjct: 15  EKVVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNSYAVPFEEDDKDPSI 74

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + Y        K+    E+VVGWY + P
Sbjct: 75  WFLDHNYHESMFHMFKRINAKEHVVGWYSTGP 106



>gb:BC018343_2092664 Mus musculus RIKEN cDNA 1700095N21 gene, mRNA
           (cDNA clone MGC:25766 IMAGE:4010423), complete cds.
          Length = 421

 Score = 33.9 bits (76), Expect = 7.4
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+   
Sbjct: 328 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTC 387

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 388 K--KKGFHP 394



>gb:BC017625_2092521 Mus musculus RIKEN cDNA E130307M08 gene, mRNA
           (cDNA clone MGC:28784 IMAGE:4488477), complete cds.
          Length = 434

 Score = 33.9 bits (76), Expect = 7.4
 Identities = 39/138 (28%), Positives = 61/138 (44%), Gaps = 10/138 (7%)
 Frame = +2

Query: 347 EVMGLMQGKTD--GDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENV 520
           EV+G + G+ D     + V+ AF       +T   A  +   Y V +        R  ++
Sbjct: 225 EVVGYLGGRWDINNQMLTVLRAFPCRSRLGDTDTAATVEEEIYQVLFL-------RGLSL 277

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQ-QFQ------EPFLAVVIDPTRTVSAG-KVEIGA 676
           VGWYHSHP      S  D+  QM  Q + Q      +P LA++  P  + + G + +I  
Sbjct: 278 VGWYHSHPHSPAVPSLQDIDAQMEYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKICP 337

Query: 677 FRTYPEGYKPPDEPVSEY 730
           F   P    PP++  S+Y
Sbjct: 338 FWVMP----PPEQRPSDY 351



>gb:AB066212_2047115 Mus musculus mRNA for ALM beta, complete cds.
          Length = 270

 Score = 33.9 bits (76), Expect = 7.4
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+   
Sbjct: 177 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTC 236

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 237 K--KKGFHP 243



>gb:AB010121_2043512 Mus musculus mRNA for AMSH-LP, complete
           cds.>gb:AB010122_2043513 Mus musculus mRNA for AMSH-LP,
           complete cds.>gb:AB066211_2047114 Mus musculus mRNA for
           ALM alpha, complete cds.>gb:AB066213_2047116 Mus
           musculus mRNA for ALM alpha 2, complete cds.
          Length = 436

 Score = 33.9 bits (76), Expect = 7.4
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 7/69 (10%)
 Frame = +2

Query: 521 VGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPT-------RTVSAGKVEIGAF 679
           +GW H+HP    +LS +D+ T    Q      +A+V  P        R  +AG +E+   
Sbjct: 343 LGWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTC 402

Query: 680 RTYPEGYKP 706
           +   +G+ P
Sbjct: 403 K--KKGFHP 409



>gb:AK005113_1152833 Mus musculus adult male cerebellum cDNA, RIKEN
           full-length enriched library, clone:1500002F13
           product:COP9 (constitutive photomorphogenic) homolog,
           subunit 5 (Arabidopsis thaliana), full insert sequence.
          Length = 48

 Score = 33.9 bits (76), Expect = 7.4
 Identities = 17/58 (29%), Positives = 26/58 (44%)
 Frame = +2

Query: 92  SSAAIAQKTWEIENNVETMDLPPTXXXXXXXXXXXXXIFYYDETAQTKFQQEKPWTND 265
           S + +AQKTWE+ NN++                    I+ YD+  Q +    KPWT +
Sbjct: 4   SGSGMAQKTWELANNMQ-------------EAQSIDEIYKYDKKQQQEILAAKPWTKE 48



>gb:AC007292_1875244 Homo sapiens chromosome 19, cosmid R31167,
           complete sequence.
          Length = 498

 Score = 33.5 bits (75), Expect = 9.7
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 12/140 (8%)
 Frame = +2

Query: 347 EVMGLMQGKTDGDAIIVMDAFALPVEG----TETRVNAQADAYEYMVDYSQTNKQAGRLE 514
           EV+G + G+ D ++ ++    A P        ET    + + Y+ +           R  
Sbjct: 289 EVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFL---------RGL 339

Query: 515 NVVGWYHSHPGYGCWLSGIDVSTQMLNQ-QFQ------EPFLAVVIDPTRTVSAG-KVEI 670
           ++VGWYHSHP      S  D+  QM  Q + Q      +P LA++  P  + + G + +I
Sbjct: 340 SLVGWYHSHPHSPALPSLQDIDAQMDYQLRLQGSSNGFQPCLALLCSPYYSGNPGPESKI 399

Query: 671 GAFRTYPEGYKPPDEPVSEY 730
             F   P    PP++  S+Y
Sbjct: 400 SPFWVMP----PPEQRPSDY 415



>gb:AC073395_1541032 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete sequence.>gb:AY258412_1593311
           Arabidopsis thaliana 26S proteasome subunit RPN8b
           (RPN8b) mRNA, partial cds.
          Length = 310

 Score = 33.5 bits (75), Expect = 9.7
 Identities = 21/92 (22%), Positives = 42/92 (45%), Gaps = 3/92 (3%)
 Frame = +2

Query: 278 KRVKISALALLKMVVH---ARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTETRVNA 448
           ++V +  L LL +V H        +  V+G++ G +    + V +++A+P E  +   + 
Sbjct: 15  EKVIVHPLVLLSIVDHYNRVAKDTSKRVVGVLLGSSSRGTVDVTNSYAVPFEEDDKDTSI 74

Query: 449 QADAYEYMVDYSQTNKQAGRLENVVGWYHSHP 544
               + Y        K+    E++VGWY + P
Sbjct: 75  WFLDHNYHESMFHMFKRINAKEHIVGWYSTGP 106



>gb:BX572100_799155 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 333

 Score = 33.5 bits (75), Expect = 9.7
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 3/46 (6%)
 Frame = -2

Query: 502 SLFICLRIIDHVLISIGLSINPSLSAFDGK---SEGIHDNDGVAVG 374
           S+ +  +++DH  +S+ +S+ PSL  FDG    S G + +DG+A+G
Sbjct: 198 SVGVGYKVLDHKKLSLRVSLGPSLIWFDGGSGCSTGDYVSDGIALG 243



>gb:AE015724_317217 Shewanella oneidensis MR-1 section 273 of 457 of
           the complete genome.>gb:AE014299_952814 Shewanella
           oneidensis MR-1 complete genome.
          Length = 401

 Score = 33.5 bits (75), Expect = 9.7
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 2/127 (1%)
 Frame = +2

Query: 254 WTNDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDGDAIIVMDAFALPVEGTE 433
           WTN P  F RV I++ A ++M+     G  +  + L+ G +D    +  +     ++   
Sbjct: 26  WTNHPFLFNRVDINSAAQIEMI----RGLGVPFVYLISGSSDDAEAVDEEEEIEEIDEMP 81

Query: 434 TRVNAQADAYEYM-VDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLN-QQFQ 607
              + +AD  + M +   +  +   +  NV G   S P     LS   V   + + Q+ Q
Sbjct: 82  PERDLKADTRKSMRLSQKRFLESVNQCRNVFGKIVSDPEGAYRLSAALVEDLLSHLQEVQ 141

Query: 608 EPFLAVV 628
           +PFL +V
Sbjct: 142 KPFLTLV 148


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,320,845,274
Number of Sequences: 1806583
Number of extensions: 27260562
Number of successful extensions: 77749
Number of sequences better than 10.0: 166
Number of HSP's better than 10.0 without gapping: 73737
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77586
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 105392098266
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)