BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3214
         (828 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T02594|T02594 hypothetical protein At2g14820 [imported] - Ar...   160   2e-38   Arabidopsis thaliana [mouse-ear cress]
gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04 ...   150   2e-35   
gb:AY054668_1563322 Arabidopsis thaliana putative protein (At4g3...   123   5e-27   
pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis t...   123   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacti...   103   5e-21   
gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome...   103   5e-21   
pir|H84619|H84619 hypothetical protein At2g23050 [imported] - Ar...    98   2e-19   Arabidopsis thaliana [mouse-ear cress]
pir|G96701|G96701 unknown protein, 76653-74502 [imported] - Arab...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA ...    85   2e-15   
gb:AP004023_1836514 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocot...    82   1e-14   
gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome...    82   1e-14   
gb:AY150514_1585079 Arabidopsis thaliana unknown protein (At4g31...    80   5e-14   
gb:AY091021_1574252 Arabidopsis thaliana unknown protein (At4g31...    80   5e-14   
pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis t...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic s...    79   8e-14   
gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genom...    77   4e-13   
gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genom...    77   4e-13   
gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene...    77   5e-13   
gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC...    76   7e-13   
gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC...    75   1e-12   
gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome...    75   2e-12   
pir|G86428|G86428 F26G16.2 protein - Arabidopsis thaliana>gb:AE0...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA...    74   3e-12   
pir|T48346|T48346 photoreceptor-interacting protein-like - Arabi...    74   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genom...    72   1e-11   
gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complet...    72   1e-11   
gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome...    72   1e-11   
gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome...    71   2e-11   
gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome...    71   3e-11   
pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis thal...    71   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AC105928_1738265 Oryza sativa (japonica cultivar-group) chrom...    69   8e-11   
gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome...    69   1e-10   
gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07 ...    68   2e-10   
gb:AY360388_1602177 Oryza sativa (japonica cultivar-group) chrom...    67   4e-10   
gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...    67   4e-10   
gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRN...    66   7e-10   
pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis t...    66   7e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY084797_1569881 Arabidopsis thaliana clone 118259 mRNA, comp...    65   2e-09   
gb:AB028619_1518048 Arabidopsis thaliana genomic DNA, chromosome...    65   2e-09   
pir|G96568|G96568 probable non-phototropic hypocotyl, 25081-2661...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|D84920|D84920 hypothetical protein At2g47860 [imported] - Ar...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T50813|T50813 non-phototropic hypocotyl 3-like protein - Ara...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...    64   3e-09   
gb:AC144738_1744167 Oryza sativa (japonica cultivar-group) chrom...    64   5e-09   
gb:AP005693_1856166 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
gb:AY448010S4_1606587 Ipomoea trifida haplotype S1 self-incompat...    62   1e-08   
pir|T51779|T51779 non-phototropic hypocotyl 3-like protein - Ara...    62   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP004044_1836817 Oryza sativa (japonica cultivar-group) genom...    60   4e-08   
gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14...    60   4e-08   
gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T2...    59   1e-07   
gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...    59   1e-07   
gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14...    57   4e-07   
gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clo...    56   9e-07   
gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, compl...    56   9e-07   
gb:AY035063_1559836 Arabidopsis thaliana unknown protein (At2g30...    56   9e-07   
pir|C84709|C84709 hypothetical protein At2g30510 [imported] - Ar...    56   9e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AC119291_1739678 Oryza sativa (japonica cultivar-group) chrom...    55   2e-06   
gb:AE016959_1022020 Oryza sativa (japonica cultivar-group) chrom...    54   4e-06   
gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome...    53   8e-06   
gb:AP003985_1835948 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis th...    50   5e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis t...    47   3e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis tha...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complet...    42   0.011   
gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome...    42   0.011   
gb:AP004031_1836648 Oryza sativa (japonica cultivar-group) genom...    41   0.024   
gb:AP003960_1835723 Oryza sativa (japonica cultivar-group) genom...    37   0.45    
gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC...    36   0.77    
gb:BX294142_768226 Pirellula sp. strain 1 complete genome; segme...    34   2.9     
gb:AY080713_1568435 Arabidopsis thaliana unknown protein (At1g50...    34   3.8     
gb:AY305378_607545 Ralstonia eutropha H16 megaplasmid pHG1, comp...    33   6.5     
sp|P94317|DNAK_BRAJA|DNAK_BRAJA Chaperone protein dnaK (Heat shock protein ...    33   6.5     Bradyrhizobium japonicum
gb:AY328383_609766 Bradyrhizobium sp. La5-8 DnaK (dnaK) gene, pa...    33   8.5     


>pir|T02594|T02594 hypothetical protein At2g14820 [imported] -
           Arabidopsis thaliana>gb:AC004705_1532116 Arabidopsis
           thaliana chromosome 2 clone F26C24 map mi398, complete
           sequence.
          Length = 634

 Score =  160 bits (406), Expect = 2e-38
 Identities = 88/153 (57%), Positives = 114/153 (74%), Gaps = 6/153 (3%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           I+K E+KR+C+LMDC+KLS +ACMHAVQN+RLPLRVVVQVLFFEQVRA ASSGSSTPDLP
Sbjct: 442 ITKGEKKRMCKLMDCRKLSVEACMHAVQNDRLPLRVVVQVLFFEQVRAAASSGSSTPDLP 501

Query: 646 KAI-KDL-NCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL----GNAGMADR 485
           + + ++L +C +YGSSRS  T  E++W+ VA+ +E+RALK E+AAL+L    G   M DR
Sbjct: 502 RGMGRELRSCGTYGSSRSVPTVMEDEWEAVATEEEMRALKSEIAALKLQEESGRKSM-DR 560

Query: 484 ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSK 386
           A               AISK++ L++SK+IF K
Sbjct: 561 AG------------VTAISKIRSLIMSKKIFGK 581



>gb:AC135500_1742438 Oryza sativa chromosome 3 BAC OSJNBa0034J04
            genomic sequence, complete sequence.>gb:AC136972_1743280
            Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic
            sequence, complete sequence.
          Length = 634

 Score =  150 bits (380), Expect = 2e-35
 Identities = 94/196 (47%), Positives = 123/196 (62%), Gaps = 8/196 (4%)
 Frame = -3

Query: 826  ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSG--SSTPD 653
            +SKSE+K +CRLMDCKKLS DAC+HAVQNERLPLRVVVQVLFFEQ+RA+A+SG   +  +
Sbjct: 444  LSKSEKKALCRLMDCKKLSQDACLHAVQNERLPLRVVVQVLFFEQIRASAASGRTDAAAE 503

Query: 652  LPKAIKDL----NCASYGSSRS-ATTTTEEDWDGVASADELRALKGELAALRL-GNAGMA 491
            L  A+  L    N  SYGSSRS ATTTTEED  GV ++ ++ +     ++LRL  N+G +
Sbjct: 504  LTSAVHSLLPRENGNSYGSSRSAATTTTEEDGTGVPTSSDINS----FSSLRLANNSGGS 559

Query: 490  DRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXXSTTM 311
            +R++G +     S D  ++ SK KG L+ K+I SK+W                   S   
Sbjct: 560  ERSSGSSDINNKSCDDKSS-SKSKGSLMPKKILSKLWSGKTNASENSSSDTSESPGSLNP 618

Query: 310  EEAKSTPSRKGRYSVS 263
            EE KST SR  R  V+
Sbjct: 619  EEVKSTTSRNTRRLVT 634



>gb:AY054668_1563322 Arabidopsis thaliana putative protein
           (At4g37590; F19F18.80) mRNA, complete
           cds.>gb:AY081497_1568757 Arabidopsis thaliana putative
           protein (At4g37590) mRNA, complete cds.
          Length = 580

 Score =  123 bits (308), Expect = 5e-27
 Identities = 78/156 (50%), Positives = 98/156 (62%), Gaps = 7/156 (4%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSST 659
           ++KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+ST
Sbjct: 419 MNKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNST 478

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMAD 488
           P++  A           SRS  TT +ED   WD     ++++AL+GELA LRL       
Sbjct: 479 PEVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRL------- 516

Query: 487 RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW 380
                  K    S     + K  GL VS R+FSK+W
Sbjct: 517 ------AKNQQESHNQGKLMKGGGLGVS-RVFSKLW 545



>pir|T04716|T04716 hypothetical protein F19F18.80 - Arabidopsis
           thaliana>gb:ATCHRIV87_1547713 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           87.>gb:ATF19F18_1549299 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19F18 (ESSA project).
          Length = 586

 Score =  123 bits (308), Expect = 5e-27
 Identities = 78/156 (50%), Positives = 98/156 (62%), Gaps = 7/156 (4%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN----ASSGSST 659
           ++KSE+KRICRLMDC+KLSA+AC HAVQNERLP+RVVVQVLFFEQVRAN    +S+G+ST
Sbjct: 425 MNKSEKKRICRLMDCRKLSAEACAHAVQNERLPMRVVVQVLFFEQVRANNNGSSSTGNST 484

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEED---WDGVASADELRALKGELAALRLGNAGMAD 488
           P++  A           SRS  TT +ED   WD     ++++AL+GELA LRL       
Sbjct: 485 PEVIPA-----------SRSTNTTDQEDTECWD----TEDIKALRGELANLRL------- 522

Query: 487 RANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW 380
                  K    S     + K  GL VS R+FSK+W
Sbjct: 523 ------AKNQQESHNQGKLMKGGGLGVS-RVFSKLW 551



>gb:AY054694_1563348 Arabidopsis thaliana photoreceptor-interacting
           protein-like (At5g67440; K8K14.18) mRNA, complete
           cds.>gb:AY128721_1580801 Arabidopsis thaliana
           photoreceptor-interacting protein-like (At5g67440) mRNA,
           complete cds.
          Length = 579

 Score =  103 bits (256), Expect = 5e-21
 Identities = 75/190 (39%), Positives = 97/190 (51%), Gaps = 2/190 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           I+KSE+K   +LMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA     ++ P LP
Sbjct: 430 ITKSEKKSSSKLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRA-----TTKPSLP 484

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
            +       S+GSSR   TTTEE+ + V + +E                         TT
Sbjct: 485 PS------GSHGSSR---TTTEEECESVTATEE-------------------------TT 510

Query: 466 KTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXX--STTMEEAKST 293
            T      ++  +K KG+++S RIFSK+W                     S T    KST
Sbjct: 511 TTTRDKTSSSEKTKAKGVVMS-RIFSKLWTGKDKDGVGDVSSSDTSESPGSVTTVGDKST 569

Query: 292 PSRKGRYSVS 263
           PS + R S S
Sbjct: 570 PSTRRRRSSS 579



>gb:AB007645_1510162 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K8K14.
          Length = 579

 Score =  103 bits (256), Expect = 5e-21
 Identities = 75/190 (39%), Positives = 97/190 (51%), Gaps = 2/190 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           I+KSE+K   +LMDC+KLS +AC HAVQNERLPLRVVVQ+LFFEQVRA     ++ P LP
Sbjct: 430 ITKSEKKSSSKLMDCRKLSPEACAHAVQNERLPLRVVVQILFFEQVRA-----TTKPSLP 484

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
            +       S+GSSR   TTTEE+ + V + +E                         TT
Sbjct: 485 PS------GSHGSSR---TTTEEECESVTATEE-------------------------TT 510

Query: 466 KTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXX--STTMEEAKST 293
            T      ++  +K KG+++S RIFSK+W                     S T    KST
Sbjct: 511 TTTRDKTSSSEKTKAKGVVMS-RIFSKLWTGKDKDGVGDVSSSDTSESPGSVTTVGDKST 569

Query: 292 PSRKGRYSVS 263
           PS + R S S
Sbjct: 570 PSTRRRRSSS 579



>pir|H84619|H84619 hypothetical protein At2g23050 [imported] -
           Arabidopsis thaliana>gb:AC004401_1531653 Arabidopsis
           thaliana chromosome 2 clone F21P24 map CIC06C07,
           complete sequence.>gb:AY102541_1577770 Arabidopsis
           thaliana hypothetical protein (At2g23050/F21P24.11)
           mRNA, complete cds.>gb:BT005613_1638553 Arabidopsis
           thaliana clone U50388 unknown protein (At2g23050) mRNA,
           complete cds.>gb:AK117486_1815518 Arabidopsis thaliana
           At2g23050 mRNA for unknown protein, complete cds, clone:
           RAFL17-11-E06.
          Length = 481

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS-GSSTPDL 650
           ISKSE+KR+C LMDC+KLSA+AC HAVQNERLP+RV+VQVLFFEQ+RAN SS G STP+L
Sbjct: 404 ISKSEKKRVCGLMDCRKLSAEACEHAVQNERLPMRVIVQVLFFEQIRANGSSTGYSTPEL 463

Query: 649 PKAIKDLNCASYGSSRSATTTTEEDWD 569
                         + +   T +++WD
Sbjct: 464 --------------TTTTLNTEDDEWD 476



>pir|G96701|G96701 unknown protein, 76653-74502 [imported] -
           Arabidopsis thaliana>gb:AE005173_894412 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012563_1537764 Arabidopsis thaliana
           chromosome 1 BAC T23K23 genomic sequence, complete
           sequence.>gb:AY120729_1579611 Arabidopsis thaliana
           unknown protein (At1g67900) mRNA, complete
           cds.>gb:BT008787_1639983 Arabidopsis thaliana At1g67900
           gene, complete cds.
          Length = 631

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 14/162 (8%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS---STP 656
           ++KSERKR+CR++DCKKLS +ACMHA QNE LPLRVVVQVLF+EQ RA A++ +   +T 
Sbjct: 463 LNKSERKRVCRVLDCKKLSMEACMHAAQNEMLPLRVVVQVLFYEQARAAAATNNGEKNTT 522

Query: 655 DLPKAIKDLNCA-----SYGSSRSATTTT-----EEDWDGVASADELRALKGELAALRLG 506
           +LP  IK L  A     S  ++ + +TTT     E+ W           L G L +    
Sbjct: 523 ELPSNIKALLAAHNIDPSNPNAAAFSTTTSIAAPEDRWSVSGLKSPKSKLSGTLRSKLAE 582

Query: 505 NAGMADR-ANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKI 383
           +  + +R  NGD  +T +      AI         K++FSK+
Sbjct: 583 DEEVDERFMNGDGGRTPSRFKAFCAIPGR-----PKKMFSKL 619



>gb:AP005919_1860143 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0554A06.
          Length = 644

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 68/210 (32%), Positives = 97/210 (46%), Gaps = 22/210 (10%)
 Frame = -3

Query: 826  ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
            + K+E+++I  LMD KKLS +AC+HA QN+RLPLRVVVQVLFFEQ+R  A++G + P   
Sbjct: 442  LPKAEKRKISSLMDVKKLSKEACIHAAQNDRLPLRVVVQVLFFEQLR--AAAGGNNPAAA 499

Query: 646  KAIKDLNCASYGSSRSATTTTEEDWDGVASA-----DELRA--------LKGELAALRLG 506
             A      AS G +R      ++D D V         + RA        LK +L +L+L 
Sbjct: 500  AA-----AASGGIARLLVEEEDDDDDDVGGGGGGDWSKSRALPTPTPSLLKKQLGSLKLA 554

Query: 505  NAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIWX---------XXXXXXXX 353
             AG       D  +    S  A   S++     S+R+F ++W                  
Sbjct: 555  AAGDEGGGGDDGRQLARVSSVANQSSRLSLSSRSRRMFDRLWAGGKPPGGEVVSKSSDTS 614

Query: 352  XXXXXXXXXXSTTMEEAKSTPSRKGRYSVS 263
                           ++ S+ SR  RYSVS
Sbjct: 615  GSSQSPRSSAKPPASKSSSSSSRNRRYSVS 644



>gb:AP006068_1860884 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0020D05.>gb:AP006069_1860892 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0025F02.
          Length = 771

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 50/117 (42%), Positives = 71/117 (60%), Gaps = 12/117 (10%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +++ ERKR+CR+MDC+KLS DACMHA QNERLPLRVVVQVLF EQV+ + +  SS+    
Sbjct: 570 LTEHERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNALASSS---- 625

Query: 646 KAIKDLNCASYGSSRSATTTT------------EEDWDGVASADELRALKGELAALR 512
            A++  + A    +  A  TT            +E W   A+  ++  LK EL +++
Sbjct: 626 AALRSSSSAPGADAAPAMPTTRRQLLDGTPQSFQEGW--AAAKKDINTLKFELESMK 680



>gb:AB186127_1529351 Oryza sativa (japonica cultivar-group) mRNA for
           NPH3, complete cds.
          Length = 762

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 50/117 (42%), Positives = 71/117 (60%), Gaps = 12/117 (10%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +++ ERKR+CR+MDC+KLS DACMHA QNERLPLRVVVQVLF EQV+ + +  SS+    
Sbjct: 561 LTEHERKRLCRVMDCQKLSFDACMHAAQNERLPLRVVVQVLFTEQVKISNALASSS---- 616

Query: 646 KAIKDLNCASYGSSRSATTTT------------EEDWDGVASADELRALKGELAALR 512
            A++  + A    +  A  TT            +E W   A+  ++  LK EL +++
Sbjct: 617 AALRSSSSAPGADAAPAMPTTRRQLLDGTPQSFQEGW--AAAKKDINTLKFELESMK 671



>gb:AP004023_1836514 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1126_D09.>gb:AP004079_1837379 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1067_B01.
          Length = 185

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/99 (48%), Positives = 63/99 (63%), Gaps = 2/99 (2%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS--STPD 653
           +SKS RKR+CR+++C+KLS  AC HA QNE LPLRVVVQVLFFE  RA A +G   +  +
Sbjct: 1   MSKSARKRLCRVINCRKLSDKACAHAAQNELLPLRVVVQVLFFEHARAAAMAGGAHAAAE 60

Query: 652 LPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRAL 536
           LP +I+ L       S+S+ +  E+D         LRAL
Sbjct: 61  LPGSIRALL-----QSKSSGSDQEDDAADRVDEQRLRAL 94



>gb:AF180390_1774821 Arabidopsis thaliana non-phototropic hypocotyl
           3 (NPH3) mRNA, complete cds.
          Length = 745

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 40/56 (71%), Positives = 49/56 (87%), Gaps = 1/56 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSS 662
           +S+ ERKR+CR+MDC+KLS DACMHA QNERLPLRVVVQVLF EQV+ +NA + +S
Sbjct: 558 LSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNALANTS 613



>gb:AB008268_1510462 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSJ1.
          Length = 745

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 40/56 (71%), Positives = 49/56 (87%), Gaps = 1/56 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSS 662
           +S+ ERKR+CR+MDC+KLS DACMHA QNERLPLRVVVQVLF EQV+ +NA + +S
Sbjct: 558 LSEHERKRLCRVMDCQKLSMDACMHAAQNERLPLRVVVQVLFSEQVKISNALANTS 613



>gb:AY150514_1585079 Arabidopsis thaliana unknown protein
           (At4g31820) mRNA, complete cds.
          Length = 571

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 64/188 (34%), Positives = 91/188 (48%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           ++KSE+KR+C LMD +KL+ +A  HA QNERLPLRVVVQVL+FEQ+RAN S  +S     
Sbjct: 422 LTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVVVQVLYFEQLRANHSPVASVA--- 478

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
                       SS S    TEE+             KGE A  ++    ++ ++ G  +
Sbjct: 479 -----------ASSHSPVEKTEEN-------------KGEEATKKV---ELSKKSRG--S 509

Query: 466 KTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXXSTTMEEAKSTPS 287
           K+  S   A  +        S+RIF KIW                   S   + + S+ S
Sbjct: 510 KSTRSGGGAQLMPSR-----SRRIFEKIWPGKGEISNKSSEVSSGSSQSPPAKSSSSS-S 563

Query: 286 RKGRYSVS 263
           R+ R+S+S
Sbjct: 564 RRRRHSIS 571



>gb:AY091021_1574252 Arabidopsis thaliana unknown protein
           (At4g31820) mRNA, complete cds.
          Length = 571

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 64/188 (34%), Positives = 91/188 (48%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           ++KSE+KR+C LMD +KL+ +A  HA QNERLPLRVVVQVL+FEQ+RAN S  +S     
Sbjct: 422 LTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVVVQVLYFEQLRANHSPVASVA--- 478

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
                       SS S    TEE+             KGE A  ++    ++ ++ G  +
Sbjct: 479 -----------ASSHSPVEKTEEN-------------KGEEATKKV---ELSKKSRG--S 509

Query: 466 KTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXXSTTMEEAKSTPS 287
           K+  S   A  +        S+RIF KIW                   S   + + S+ S
Sbjct: 510 KSTRSGGGAQLMPSR-----SRRIFEKIWPGKGEISNKSSEVSSGSSQSPPAKSSSSS-S 563

Query: 286 RKGRYSVS 263
           R+ R+S+S
Sbjct: 564 RRRRHSIS 571



>pir|T06304|T06304 hypothetical protein F11C18.20 - Arabidopsis
           thaliana>gb:ATCHRIV75_1547103 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           75.>gb:ATF11C18_1548261 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11C18 (ESSA project).
          Length = 498

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 64/188 (34%), Positives = 91/188 (48%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           ++KSE+KR+C LMD +KL+ +A  HA QNERLPLRVVVQVL+FEQ+RAN S  +S     
Sbjct: 349 LTKSEKKRLCGLMDVRKLTNEASTHAAQNERLPLRVVVQVLYFEQLRANHSPVASVA--- 405

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
                       SS S    TEE+             KGE A  ++    ++ ++ G  +
Sbjct: 406 -----------ASSHSPVEKTEEN-------------KGEEATKKV---ELSKKSRG--S 436

Query: 466 KTVASSDKAAAISKMKGLLVSKRIFSKIWXXXXXXXXXXXXXXXXXXXSTTMEEAKSTPS 287
           K+  S   A  +        S+RIF KIW                   S   + + S+ S
Sbjct: 437 KSTRSGGGAQLMPSR-----SRRIFEKIWPGKGEISNKSSEVSSGSSQSPPAKSSSSS-S 490

Query: 286 RKGRYSVS 263
           R+ R+S+S
Sbjct: 491 RRRRHSIS 498



>gb:AP003224_1825592 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0010B10.
          Length = 659

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 36/51 (70%), Positives = 45/51 (88%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +S+SER+++CRLM+C+KLS +AC HA QNERLPLRVVVQVLFFEQ+R   S
Sbjct: 497 LSESEREQLCRLMNCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLRLRTS 547



>gb:AC147427_1744693 Oryza sativa chromosome 3 B1394A07 genomic
           sequence, complete sequence.
          Length = 650

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 46/106 (43%), Positives = 64/106 (60%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +S++ER+++CRLMDC+KLS +AC HA QNERLPLRVVVQVLFFEQ++   S         
Sbjct: 471 LSEAEREQLCRLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCL---- 526

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL 509
             + D N       RS+ TT+ E      +  E + LK  +  +R+
Sbjct: 527 -LVSD-NLEGSRPLRSSITTSGEAGGWATAVRENQVLKVGMDNMRM 570



>gb:AP005426_1851664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0668D04.>gb:AP005579_1854402 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1740_D06.
          Length = 618

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 36/58 (62%), Positives = 48/58 (82%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPD 653
           ISK+++K+IC L+D KKLS DA MHA QN+RLPLR+VVQVLFF+Q+RA +S+  +  D
Sbjct: 438 ISKADKKKICGLIDVKKLSTDASMHATQNDRLPLRLVVQVLFFQQLRAGSSNALALTD 495



>gb:AP004591_1842017 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0582D05.>gb:AP005250_1849561 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0009H02.
          Length = 641

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 33/51 (64%), Positives = 45/51 (88%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +S+SE++ +CR+MDC+KLS +AC HA QNERLPLRV+VQVLFFEQ++  +S
Sbjct: 457 LSESEKEELCRVMDCQKLSLEACTHAAQNERLPLRVIVQVLFFEQLQLRSS 507



>gb:AF466200_1802233 Sorghum bicolor putative protein kinase gene,
           partial cds; putative Cf-2, fertilization-independent
           endosperm proteins, hypothetical protein, putative
           non-LTR retroelement reverse transcriptase, OCL5
           protein, tryptophan synthase beta-subunit, hypothetical
           proteins, putative AP endonuclease, putative RNA
           polymerase II complex component SRB7, putative
           beta-1,3-glucanase, hypothetical protein, TNP2-like
           protein, hypothetical protein, putative
           phosphate/phosphoenolpyruvate translocator, putative
           protein, hypothetical proteins, putative
           galactosyltransferase family, hypothetical protein,
           putative cytochrome P450 family, putative lipid transfer
           protein, putative photoreceptor-interacting protein, and
           hypothetical protein genes, complete cds; and
           hypothetical protein gene, partial cds.
          Length = 658

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 32/51 (62%), Positives = 45/51 (88%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +S+SE++ +CR+MDC+KLS +AC HA QNERLPLR++VQVLFFEQ++  +S
Sbjct: 457 LSESEKEELCRVMDCQKLSLEACTHAAQNERLPLRIIVQVLFFEQLQLRSS 507



>gb:OSJN00101_1694921 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0034I13, complete sequence.
          Length = 644

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 34/47 (72%), Positives = 43/47 (91%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           ++ SER+++CRLM+C+KLS +AC HA QNERLPLRVVVQVLFFEQ+R
Sbjct: 459 LTASEREQLCRLMNCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLR 505



>gb:OSJN00035_1693653 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0044K18, complete sequence.
          Length = 627

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 59/174 (33%), Positives = 79/174 (45%), Gaps = 25/174 (14%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDL 650
           + KS RK++CR+++C+KLS  A MHA QNE LPLRVVVQVLFFE  R A  SSG      
Sbjct: 454 MDKSSRKKLCRVLNCRKLSEKASMHAAQNELLPLRVVVQVLFFENARAAGLSSGHGNRVA 513

Query: 649 PKAIKDLNCASYGSSRSATTTTEEDW--------------DGVASADELRALKGELAALR 512
            +   D    S         TTEE+               DG  S + LR     +A L+
Sbjct: 514 ARFPGDGGDVSALLGTGRPRTTEENGKDGQSPAAAGSVAADGDWSVEGLRRAASRVATLK 573

Query: 511 L----------GNAGMADRANGDTTKTVASSDKAAAISKMKGLLVSKRIFSKIW 380
           +          G+     R      ++ +S   AAA         SKR+ S++W
Sbjct: 574 MRLEEEDGEDAGDEAFVHRTRAGLARSASSRVTAAAGR-------SKRMLSRLW 620



>gb:AB006704_1509977 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSH12.
          Length = 591

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 33/51 (64%), Positives = 44/51 (86%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +++SER+++C LM+C+KLS +AC HA QNERLPLRV+VQVLFFEQ+R   S
Sbjct: 447 LTESEREQLCLLMNCQKLSLEACTHAAQNERLPLRVIVQVLFFEQMRLRTS 497



>pir|G86428|G86428 F26G16.2 protein - Arabidopsis
           thaliana>gb:AE005172_891887 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F26G16_1678079 Arabidopsis thaliana
           chromosome 1 BAC F26G16 sequence, complete sequence.
          Length = 662

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 31/51 (60%), Positives = 44/51 (86%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           ++++ER+ +CRL+DC+KLS +AC HA QNERLPLR++VQVLFFEQ++   S
Sbjct: 459 LAETERENLCRLLDCQKLSLEACTHAAQNERLPLRIIVQVLFFEQLQLRTS 509



>gb:AY049300_1561942 Arabidopsis thaliana AT5g66560/K1F13_23 mRNA,
           complete cds.>gb:BT001071_1635326 Arabidopsis thaliana
           At5g66560/K1F13_23 mRNA, complete cds.
          Length = 668

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 55/152 (36%), Positives = 77/152 (50%), Gaps = 24/152 (15%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQV-------------R 686
           +S++ER++IC +MDC+KL+ +AC HA QNERLPLR VVQVLFFEQ+             +
Sbjct: 484 VSEAEREKICGVMDCQKLTLEACTHAAQNERLPLRAVVQVLFFEQLQLRHAIAGTLLAAQ 543

Query: 685 ANASSGSSTPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALK-----GELA 521
           + ++S S+ P    AI++L            T TEED D      ++ A K      E  
Sbjct: 544 SPSTSQSTEPRPSAAIRNL------------TITEEDGDEAEGERQVDAGKWKKTVRENQ 591

Query: 520 ALRLGNAGMADRAN------GDTTKTVASSDK 443
            LRL    M  R +       +  K +A  DK
Sbjct: 592 VLRLDMDTMRTRVHRLERECSNMKKVIAKIDK 623



>pir|T48346|T48346 photoreceptor-interacting protein-like -
           Arabidopsis thaliana>gb:AB005240_1509473 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MOK16.>gb:ATF15A17_1548661 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F15A17 (ESSA project).
          Length = 592

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 35/51 (68%), Positives = 42/51 (82%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           I+ SER+ ICRLM+C+KLS +A  HA QNERLPLRV+VQVLFFEQ+R   S
Sbjct: 456 ITDSEREHICRLMNCQKLSLEASTHAAQNERLPLRVIVQVLFFEQLRLRTS 506



>gb:AP005903_1859850 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1012G11.>gb:AP005969_1860420 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1119_C03.
          Length = 594

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 9/143 (6%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA---NASSGSSTP 656
           +SK+++KR+CR++DC+KLS D    A+ N+R+PLR +VQ+LF EQ RA     +SGS++ 
Sbjct: 457 LSKADKKRLCRMIDCRKLSPDVRAQAISNDRMPLRTIVQLLFVEQERAMGGGGASGSNSA 516

Query: 655 DLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADEL------RALKGELAALRLGNAGM 494
             P AI  L          A    +ED     +AD        R   GE A  R   A M
Sbjct: 517 VAPDAIAML----------AARKEKEDEPPAPAADHKSDVHRPRGDHGERA--RADGAAM 564

Query: 493 ADRANGDTTKTVASSDKAAAISK 425
               +  TTKT  ++    A S+
Sbjct: 565 TRSLSASTTKTAGAAAPRTAESR 587



>gb:BT015362_1642190 Arabidopsis thaliana At5g67385 gene, complete
           cds.>gb:BT015895_1642513 Arabidopsis thaliana At5g67385
           gene, complete cds.
          Length = 604

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 6/139 (4%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA------NASSGS 665
           +S  ERK++C LMDC+KLS +AC HA QN+RLP++ +VQVL++EQ R       ++ S +
Sbjct: 428 MSDVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPA 487

Query: 664 STPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADR 485
             P  P A+     +SY    S      +D            LK EL  +++        
Sbjct: 488 PPPPQPAAVLPPKLSSYTDELSKLKRENQD------------LKLELLKMKMKLKEFEKE 535

Query: 484 ANGDTTKTVASSDKAAAIS 428
           +   T+ +  S++ ++ IS
Sbjct: 536 SEKKTSSSTISTNPSSPIS 554



>gb:AB013389_1512060 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1F13.
          Length = 597

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 31/47 (65%), Positives = 42/47 (89%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           +S++ER++IC +MDC+KL+ +AC HA QNERLPLR VVQVLFFEQ++
Sbjct: 441 VSEAEREKICGVMDCQKLTLEACTHAAQNERLPLRAVVQVLFFEQLQ 487



>gb:AB012242_1511718 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K24G6.
          Length = 614

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 45/107 (42%), Positives = 64/107 (59%), Gaps = 1/107 (0%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +S S++K++ +L+D +KLS +A  HA QNERLPL+ +VQVL+FEQ++  +S  SS  D  
Sbjct: 438 LSDSDKKKLSKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLKLRSSLCSSYSDEE 497

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVAS-ADELRALKGELAALRL 509
              K     S+  +  A + T    D  AS   E R LK ELA LR+
Sbjct: 498 PKPKQQQQQSWRINSGALSATMSPKDNYASLRRENRELKLELARLRM 544



>gb:AP001298_1820987 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:F20C19.
          Length = 588

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 44/103 (42%), Positives = 56/103 (54%), Gaps = 2/103 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS--GSSTPD 653
           I K ERKR+CR++DCKKLS +A   A QNE LPLRV+VQ+LF EQ RA  ++   + T +
Sbjct: 461 IEKCERKRLCRILDCKKLSVEASKKAAQNELLPLRVIVQILFVEQARATLATTRNNITTN 520

Query: 652 LPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGEL 524
               +K          RS TT  EE        DE +   G L
Sbjct: 521 ETAVLK----------RSFTTRREEGGQEEEERDETKPSGGFL 553



>pir|G86160|G86160 protein F10O3.17 [imported] - Arabidopsis
           thaliana>gb:AE005172_889320 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F10O3_1677295 Arabidopsis thaliana
           chromosome 1 BAC F10O3 sequence, complete sequence.
          Length = 634

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 47/110 (42%), Positives = 65/110 (59%), Gaps = 4/110 (3%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSSTPDL 650
           I  SER R+C+ +D +KLS +AC HA QNERLP+++ VQVL+FEQ+R  NA S S  P  
Sbjct: 457 IKDSERYRLCKTIDSQKLSQEACSHAAQNERLPVQMAVQVLYFEQIRLRNAMSSSIGP-- 514

Query: 649 PKAIKDLNCASY--GSSRSATTTTEEDWDGVASA-DELRALKGELAALRL 509
            + + + NC  +   S   A +      D  AS   E R LK E+A +R+
Sbjct: 515 TQFLFNSNCHQFPQRSGSGAGSGAISPRDNYASVRRENRELKLEVARMRM 564



>gb:AC105928_1738265 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0014O06, complete sequence.
          Length = 626

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 30/52 (57%), Positives = 41/52 (78%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS 671
           +++ ERK++CR MDC+KLS +AC HA QN+RLP++ VVQVL+ EQ R  A S
Sbjct: 444 LAEGERKKVCRAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPS 495



>gb:AB016886_1513138 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCA23.>gb:BT005761_1638685 Arabidopsis thaliana
           clone RAFL15-17-A20 (R20741) putative
           photoreceptor-interacting protein (At5g47800) mRNA,
           complete cds.>gb:BT006083_1638977 Arabidopsis thaliana
           clone U20741 putative photoreceptor-interacting protein
           (At5g47800) mRNA, complete cds.
          Length = 559

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 35/61 (57%), Positives = 45/61 (73%), Gaps = 2/61 (3%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN--ASSGSSTPD 653
           ISK E+KR+CR +DC+KLSA    HAV+NER+PLR VVQ LFF+Q   +  ASS S + +
Sbjct: 430 ISKEEKKRLCRSLDCQKLSAQVRAHAVKNERMPLRTVVQALFFDQESGSKGASSRSESQE 489

Query: 652 L 650
           L
Sbjct: 490 L 490



>gb:AC117988_1739426 Oryza sativa chromosome 3 BAC OSJNBa0057G07
           genomic sequence, complete sequence.
          Length = 632

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 28/47 (59%), Positives = 39/47 (82%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           ++  ER R+C ++DC+KL+ +AC HA QNERLPLR V+QVLFFEQ++
Sbjct: 432 LAAEERDRVCGVVDCRKLTVEACTHAAQNERLPLRAVLQVLFFEQLQ 478



>gb:AY360388_1602177 Oryza sativa (japonica cultivar-group)
           chromosome 8 BAC OSJNBa0038J12, complete
           sequence.>gb:AY360389_1602182 Oryza sativa (japonica
           cultivar-group) chromosome 8 BAC OSJNBa0024A05, complete
           sequence.
          Length = 158

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 39/86 (45%), Positives = 50/86 (58%)
 Frame = -3

Query: 814 ERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKAIK 635
           E  +I  LMD KKLS +AC+HA QN+RLPLRVV+QVLFFEQ+RA   +  +         
Sbjct: 13  EDPKISSLMDVKKLSKEACIHAAQNDRLPLRVVLQVLFFEQLRAAVGASPAV-------- 64

Query: 634 DLNCASYGSSRSATTTTEEDWDGVAS 557
                S G +R      +ED D V+S
Sbjct: 65  ----VSGGIARHLVEEEDEDNDDVSS 86



>gb:AY144442_1583524 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 614

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 29/55 (52%), Positives = 45/55 (81%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSS 662
           +++SE K++C+L+DC+KLS DA  HA QN+RLP+++VV+VL+FEQ+R  +   SS
Sbjct: 444 LTESECKKLCKLIDCQKLSQDASSHAAQNDRLPIQMVVRVLYFEQLRLKSGVPSS 498



>gb:AY094473_1575768 Arabidopsis thaliana AT3g50840/F18B3_120 mRNA,
           complete cds.>gb:BT004531_1637565 Arabidopsis thaliana
           At3g50840/F18B3_120 gene, complete cds.
          Length = 569

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 28/47 (59%), Positives = 38/47 (80%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           I + E+++IC +MDC+KL+ + C HA QNERLPLR VVQVLF EQ++
Sbjct: 413 ILEEEKEKICSVMDCRKLTVEGCTHAAQNERLPLRAVVQVLFLEQLQ 459



>pir|T08405|T08405 hypothetical protein F18B3.120 - Arabidopsis
           thaliana>gb:ATF18B3_1549088 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18B3.
          Length = 567

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 28/47 (59%), Positives = 38/47 (80%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           I + E+++IC +MDC+KL+ + C HA QNERLPLR VVQVLF EQ++
Sbjct: 411 ILEEEKEKICSVMDCRKLTVEGCTHAAQNERLPLRAVVQVLFLEQLQ 457



>gb:AY084797_1569881 Arabidopsis thaliana clone 118259 mRNA,
           complete sequence.
          Length = 429

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 6/111 (5%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR------ANASSGS 665
           + K ERK +CRL+D +KLS +A +HA QN+RLP+R ++ VLF EQ +       N+SS S
Sbjct: 239 VLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIGVLFTEQTKLSRHIDCNSSSIS 298

Query: 664 STPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALR 512
           ST   P      +    GS+    +  E +        E+R L+ ++  L+
Sbjct: 299 STTRSPTNASGSHYLEGGSAARCLSKREMN----VQQAEIRRLREDVVRLQ 345



>gb:AB028619_1518048 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MQD17.>gb:AK175160_1817148 Arabidopsis thaliana
           mRNA for putative non-phototropic hypocotyl protein,
           complete cds, clone: RAFL21-57-M15.>gb:AK175176_1817164
           Arabidopsis thaliana mRNA for putative non-phototropic
           hypocotyl protein, complete cds, clone:
           RAFL21-59-C24.>gb:AK175473_1817461 Arabidopsis thaliana
           mRNA for putative non-phototropic hypocotyl protein,
           complete cds, clone: RAFL21-90-M07.>gb:AK175544_1817532
           Arabidopsis thaliana mRNA for putative non-phototropic
           hypocotyl protein, complete cds, clone: RAFL21-96-G18.
          Length = 452

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 6/111 (5%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR------ANASSGS 665
           + K ERK +CRL+D +KLS +A +HA QN+RLP+R ++ VLF EQ +       N+SS S
Sbjct: 262 VLKQERKELCRLIDSRKLSPEAALHAAQNDRLPVRAIIGVLFTEQTKLSRHIDCNSSSIS 321

Query: 664 STPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALR 512
           ST   P      +    GS+    +  E +        E+R L+ ++  L+
Sbjct: 322 STTRSPTNASGSHYLEGGSAARCLSKREMN----VQQAEIRRLREDVVRLQ 368



>pir|G96568|G96568 probable non-phototropic hypocotyl, 25081-26618
           [imported] - Arabidopsis thaliana>gb:AE005173_893188
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC019018_1538484 Arabidopsis thaliana
           chromosome 1 BAC F14G24 genomic sequence, complete
           sequence.>gb:BT002492_1636095 Arabidopsis thaliana
           putative non-phototropic hypocotyl (At1g52770) mRNA,
           complete cds.>gb:BT008757_1639953 Arabidopsis thaliana
           At1g52770 mRNA, complete cds.
          Length = 454

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 39/112 (34%), Positives = 66/112 (58%), Gaps = 7/112 (6%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS-------SG 668
           ++K ERKR+C L+D  KLS +A +HA QN+RLP+R ++QVLF EQ + +         SG
Sbjct: 257 VTKQERKRLCGLIDSNKLSMEASLHAAQNDRLPVRTIIQVLFSEQAKLSHRSHNNIEWSG 316

Query: 667 SSTPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALR 512
           SS   + ++  + + + Y  S  A  T++ + +      E+R L+ ++A L+
Sbjct: 317 SSFSGV-RSSPNPSGSHYSDSGPARCTSKREIN--VQQAEIRRLREDMAKLK 365



>pir|D84920|D84920 hypothetical protein At2g47860 [imported] -
           Arabidopsis thaliana>gb:AC005309_1532462 Arabidopsis
           thaliana chromosome 2 clone F17A22 map CIC06C03,
           complete sequence.>gb:AC006072_1533395 Arabidopsis
           thaliana chromosome 2 clone T9J23 map CIC06C03, complete
           sequence.
          Length = 635

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 2/105 (1%)
 Frame = -3

Query: 817 SERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN--ASSGSSTPDLPK 644
           SER R+C+ + CKKLS DA  HA QNERLP+++ VQVLF+EQ R     +SG  T    +
Sbjct: 451 SERYRLCKTVSCKKLSQDASSHAAQNERLPVQIAVQVLFYEQTRLKNAMTSGGGTGGSNQ 510

Query: 643 AIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL 509
           +   L     GS  ++   +  D +  +   E R L+ E+A +R+
Sbjct: 511 SQFFLFPNRSGSGMASGAISPRD-NYASVRRENRELRLEVARMRM 554



>pir|T50813|T50813 non-phototropic hypocotyl 3-like protein -
           Arabidopsis thaliana>gb:ATF18D22_1549102 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F18D22 (ESSA
           project).
          Length = 607

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 30/62 (48%), Positives = 42/62 (67%), Gaps = 4/62 (6%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVV----QVLFFEQVRANASSGSST 659
           +S  +R+R+C+ M+C+KLS DAC+HA QN+RLPLR +V    QVLF EQV+         
Sbjct: 441 LSDHDRRRLCKTMNCEKLSLDACLHAAQNDRLPLRTIVQINTQVLFSEQVKMRMMMQDKL 500

Query: 658 PD 653
           P+
Sbjct: 501 PE 502



>gb:AY144442_1583522 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 665

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 39/130 (30%), Positives = 69/130 (53%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           + + +R+++C +MD  KLS  A +HA QN+RLPL+ V+  L+++Q++  +++ ++T  + 
Sbjct: 444 LDEIQREKVCSVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAADAAT-SMG 502

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRANGDTT 467
             + D    S  ++  A      D    A A E  AL+ ELA +R   +G      G  +
Sbjct: 503 DVVADTQTQSSSAAGRARAQAMAD---AALARENEALRVELARMRAYMSGTMQHGKGRES 559

Query: 466 KTVASSDKAA 437
            T AS  + A
Sbjct: 560 STPASPSRTA 569



>gb:AC144738_1744167 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0029B02, complete sequence.
          Length = 501

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 5/109 (4%)
 Frame = -3

Query: 820 KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-----ANASSGSSTP 656
           K ER+ +CRL+D +KL+A+A  HAVQNERLP+R VVQVLF E        A  ++GS   
Sbjct: 306 KEERRSLCRLIDARKLTAEAAAHAVQNERLPVRCVVQVLFSEHGSKLTRLAEWTTGSFRS 365

Query: 655 DLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRL 509
              ++  DL     G++  A   ++   +  A   ELR L+ +++ L++
Sbjct: 366 LQSRSPADLIVTGGGANGGARCPSKR--EVAAQHHELRRLREDVSRLQV 412



>gb:AP005693_1856166 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBa0061E21.>gb:AP006480_1862086 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone: B1052H09.
          Length = 138

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 36/78 (46%), Positives = 46/78 (58%)
 Frame = -3

Query: 790 MDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLPKAIKDLNCASYG 611
           MD KKLS +AC+HA QN+RLPLRVV+QVLFFEQ+RA   +  +              S G
Sbjct: 1   MDVKKLSKEACIHAAQNDRLPLRVVLQVLFFEQLRAAVGASPAV------------VSGG 48

Query: 610 SSRSATTTTEEDWDGVAS 557
            +R      +ED D V+S
Sbjct: 49  IARHLVEEEDEDNDDVSS 66



>gb:AY448010S4_1606587 Ipomoea trifida haplotype S1
           self-incompatibility (S-) locus, contig SR4.
          Length = 652

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 25/43 (58%), Positives = 38/43 (88%)
 Frame = -3

Query: 814 ERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           +++++C ++D +KLS DAC HA QNERLPLR+++QVLFFEQ++
Sbjct: 474 DKEQLCNIIDFQKLSIDACAHASQNERLPLRIILQVLFFEQLQ 516



>pir|T51779|T51779 non-phototropic hypocotyl 3-like protein -
           Arabidopsis thaliana>gb:ATF28D10_1550295 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F28D10.
          Length = 661

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 26/46 (56%), Positives = 38/46 (82%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQV 689
           +S  +++++C +MD ++LS DAC HA  N+RLPLRVV+QVLFFEQ+
Sbjct: 473 LSDRDKEQLCNIMDYQRLSIDACAHASHNDRLPLRVVLQVLFFEQM 518



>gb:AP004044_1836817 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1125_C01.>gb:AP005480_1852636 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0439B07.
          Length = 137

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 28/40 (70%), Positives = 34/40 (85%)
 Frame = -3

Query: 790 MDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS 671
           MD KKLS +AC+HA QN RLPLRVV+QV+FFEQ+RA A +
Sbjct: 1   MDVKKLSKEACIHAAQNNRLPLRVVMQVVFFEQLRAAAGA 40



>gb:AC012562_1537723 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 582

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSS 662
           +++ ERK++C  +DCKKLS +A  H  QN+RLP+++VV+VL+ EQ+R   A SG S
Sbjct: 420 LTEEERKKLCNFIDCKKLSQEASNHVAQNDRLPVQMVVRVLYTEQLRLKKALSGDS 475



>gb:ATAC009895_1543071 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 484

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 25/45 (55%), Positives = 35/45 (77%)
 Frame = -3

Query: 820 KSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           +SE+   CR + CKKLS +AC HA +NE+LPLR+V+QVLF  Q++
Sbjct: 346 ESEKMEACRFLHCKKLSPEACEHASKNEKLPLRIVMQVLFVSQMQ 390



>gb:AC099043_1737016 Oryza sativa chromosome 3 BAC OSJNBa0079B15
           genomic sequence, complete sequence.>gb:AC107207_1738374
           Oryza sativa chromosome 3 BAC OSJNBb0106M04 genomic
           sequence, complete sequence.
          Length = 725

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 25/47 (53%), Positives = 38/47 (80%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR 686
           + + E++++  ++D +KL+ +AC HA QNERLPLR VVQVLFFEQ++
Sbjct: 550 LREEEKEKVSGVVDGRKLTLEACTHAAQNERLPLRTVVQVLFFEQLQ 596



>gb:AC012562_1537714 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 612

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 26/56 (46%), Positives = 41/56 (73%), Gaps = 1/56 (1%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVR-ANASSGSS 662
           +++ E K +C+ +D +KLS +AC H  QN+RLP+++VV+VL+ EQ+R  N  SG S
Sbjct: 439 LNEQECKSLCKFIDTQKLSQEACNHVAQNDRLPMQMVVRVLYSEQLRMKNVMSGES 494



>gb:AK175297_1817285 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-73-G18.
          Length = 545

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 4/140 (2%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS----ST 659
           + + ER+++C  MD  KLS DA +HA QN+RLP+ +V+  L+++Q++  +        + 
Sbjct: 375 LDEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAV 434

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN 479
             LP+A+K        S   A TT          A E  AL+ EL  +++  + M    N
Sbjct: 435 VVLPEALKT------RSQLQADTTL---------AKENEALRSELMKMKMYVSDMQKNKN 479

Query: 478 GDTTKTVASSDKAAAISKMK 419
           G      +SS+ ++ +S  K
Sbjct: 480 G---AGASSSNSSSLVSSKK 496



>gb:AF181683_1774861 Arabidopsis thaliana RPT2 (RPT2) mRNA, complete
           cds.
          Length = 593

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 4/140 (2%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS----ST 659
           + + ER+++C  MD  KLS DA +HA QN+RLP+ +V+  L+++Q++  +        + 
Sbjct: 423 LDEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAV 482

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN 479
             LP+A+K        S   A TT          A E  AL+ EL  +++  + M    N
Sbjct: 483 VVLPEALKT------RSQLQADTTL---------AKENEALRSELMKMKMYVSDMQKNKN 527

Query: 478 GDTTKTVASSDKAAAISKMK 419
           G      +SS+ ++ +S  K
Sbjct: 528 G---AGASSSNSSSLVSSKK 544



>gb:AY035063_1559836 Arabidopsis thaliana unknown protein
           (At2g30520) mRNA, complete cds.>gb:AY056359_1563667
           Arabidopsis thaliana unknown protein (At2g30520) mRNA,
           complete cds.>gb:BT000675_1634952 Arabidopsis thaliana
           clone RAFL09-15-A18 (R09304) unknown protein (At2g30520)
           mRNA, complete cds.
          Length = 593

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 4/140 (2%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS----ST 659
           + + ER+++C  MD  KLS DA +HA QN+RLP+ +V+  L+++Q++  +        + 
Sbjct: 423 LDEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAV 482

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN 479
             LP+A+K        S   A TT          A E  AL+ EL  +++  + M    N
Sbjct: 483 VVLPEALKT------RSQLQADTTL---------AKENEALRSELMKMKMYVSDMQKNKN 527

Query: 478 GDTTKTVASSDKAAAISKMK 419
           G      +SS+ ++ +S  K
Sbjct: 528 G---AGASSSNSSSLVSSKK 544



>pir|C84709|C84709 hypothetical protein At2g30510 [imported] -
           Arabidopsis thaliana>gb:U93215_1726554 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 415

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 41/140 (29%), Positives = 70/140 (50%), Gaps = 4/140 (2%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGS----ST 659
           + + ER+++C  MD  KLS DA +HA QN+RLP+ +V+  L+++Q++  +        + 
Sbjct: 245 LDEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAV 304

Query: 658 PDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGNAGMADRAN 479
             LP+A+K        S   A TT          A E  AL+ EL  +++  + M    N
Sbjct: 305 VVLPEALKT------RSQLQADTTL---------AKENEALRSELMKMKMYVSDMQKNKN 349

Query: 478 GDTTKTVASSDKAAAISKMK 419
           G      +SS+ ++ +S  K
Sbjct: 350 G---AGASSSNSSSLVSSKK 366



>gb:AP003747_1832804 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1127_E01.
          Length = 547

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 22/49 (44%), Positives = 37/49 (75%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRAN 680
           +S  E+  +C  ++C+KLS +AC+ AVQN+R+PLR++VQ LF +Q+  +
Sbjct: 449 LSGDEKASLCGHLECRKLSHEACIQAVQNDRMPLRLIVQALFVQQLHTH 497



>gb:AC119291_1739678 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0052K01, complete sequence.
          Length = 166

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 25/40 (62%), Positives = 31/40 (77%)
 Frame = -3

Query: 790 MDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASS 671
           MDC+KLS +AC HA QN+RLP++ VVQVL+ EQ R  A S
Sbjct: 1   MDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPS 40



>gb:AE016959_1022020 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092749_1735608
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBb0023M11,
           from chromosome 10, complete
           sequence.>gb:AE017081_1751839 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 35 of 77 of the
           complete sequence.
          Length = 77

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 24/40 (60%), Positives = 30/40 (75%)
 Frame = -3

Query: 802 ICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRA 683
           +  +++C+KLS  AC H  QNE +PLRVVVQVLFFE  RA
Sbjct: 24  LASVLNCRKLSDKACAHEAQNELIPLRVVVQVLFFEHARA 63



>gb:AB023039_1515419 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIF21.
          Length = 625

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           IS+ E+  IC  ++C+KLS +A +  V+NE++PLR+VVQ LF +Q+  +     +  D  
Sbjct: 423 ISQEEKGSICSYLNCQKLSQEASLELVKNEKMPLRLVVQALFIQQLNTH----QAFKDCS 478

Query: 646 KAIKDLNCASYGSS 605
            + +  N A +  S
Sbjct: 479 DSFRFTNSADFSGS 492



>gb:AP003985_1835948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1047_C01.
          Length = 258

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 23/51 (45%), Positives = 34/51 (66%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +++ E+ R+C  ++C KLS    MH VQN RLPLR VVQ +  EQ+ ++ S
Sbjct: 27  LTEEEKSRVCYNVNCTKLSHHLFMHLVQNPRLPLRFVVQAMLVEQLHSHHS 77



>pir|T51462|T51462 hypothetical protein K10A8_60 - Arabidopsis
           thaliana>gb:ATK10A8_1553509 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K10A8 (ESSA project).
          Length = 548

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/108 (26%), Positives = 54/108 (50%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +++SE+  +C++++C KLS +    A +N++LPLR+VV VL   Q++   +       + 
Sbjct: 396 LTESEKMEVCKVLECGKLSQEGFERAAKNQKLPLRIVVNVLCVSQLQIRDT-------VA 448

Query: 646 KAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGELAALRLGN 503
           K IK       G         EE+ +  +  DE+  +  +L  L + N
Sbjct: 449 KEIK-------GMEEKVDEEEEEEIEVSSDEDEMEKMSNKLLGLEIEN 489



>pir|T46056|T46056 hypothetical protein T16K5.250 - Arabidopsis
           thaliana>gb:ATT16K5_1554603 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T16K5.
          Length = 517

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANAS 674
           +++ E+ +IC  +DC KLS    +HAVQN ++PLR +V+ +  EQ+    S
Sbjct: 261 MTEEEKVQICNSIDCDKLSPPLLLHAVQNPKMPLRFIVRAMLQEQLNTRHS 311



>pir|T45850|T45850 hypothetical protein F3A4.50 - Arabidopsis
           thaliana>gb:ATF3A4_1550551 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3A4.
          Length = 526

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 19/31 (61%), Positives = 24/31 (77%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNER 734
           IS+ E+K++C LMDCKKLS D   HA QN+R
Sbjct: 374 ISEVEKKKVCSLMDCKKLSRDVYAHAAQNDR 404



>gb:BT012660_1641730 Arabidopsis thaliana At3g19850 gene, complete
           cds.
          Length = 521

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 22/71 (30%), Positives = 37/71 (52%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +S  +R ++CR ++ KKL+ D C    +N ++P  + VQ L  +Q+ +N +   S  D  
Sbjct: 386 LSSEDRTKLCRCLNYKKLTLDTCKQLAKNPKIPPNIAVQALKSQQL-SNETRPHSREDKN 444

Query: 646 KAIKDLNCASY 614
           K  K  N   Y
Sbjct: 445 KVNKIWNSRKY 455



>gb:AB025631_1516560 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.>gb:AK175315_1817303 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL21-75-H23.>gb:AK176753_1818741 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL25-29-E14.>gb:AK176817_1818805 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL25-37-F21.
          Length = 554

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 22/71 (30%), Positives = 37/71 (52%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           +S  +R ++CR ++ KKL+ D C    +N ++P  + VQ L  +Q+ +N +   S  D  
Sbjct: 419 LSSEDRTKLCRCLNYKKLTLDTCKQLAKNPKIPPNIAVQALKSQQL-SNETRPHSREDKN 477

Query: 646 KAIKDLNCASY 614
           K  K  N   Y
Sbjct: 478 KVNKIWNSRKY 488



>gb:AP004031_1836648 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0432C03.>gb:AP004073_1837308 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0614D08.
          Length = 152

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = -3

Query: 769 ADACMHAVQNERLPLRVVVQVLFFEQVRAN---ASSGSSTPDLPKAIKDLNCASYGSSRS 599
           A+A  HAVQN+RLP+R V+Q+LF E  + N     SG ++   P  + DL  A    S  
Sbjct: 10  AEAVAHAVQNDRLPVRSVLQMLFSEHGKLNRLAELSGGASFGAPSLVFDLPGARCPPSAR 69

Query: 598 ATTTTEEDWDGVASADELRALKGELAALRL 509
            + +T        ++    AL+ ++  L +
Sbjct: 70  CSPSTTSSAASARTSPASSALQAQVDRLSM 99



>gb:AP003960_1835723 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1612_A04.>gb:AP004235_1839102 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0006G05.
          Length = 473

 Score = 37.0 bits (84), Expect = 0.45
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVL 704
           +++ E+ RIC+ ++ +KLS + C H  +N   P R  VQ L
Sbjct: 315 LTEEEKMRICKGINYEKLSPECCKHLARNAGFPTRAAVQAL 355



>gb:OSJN00002_1693082 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0018M05, complete sequence.
          Length = 566

 Score = 36.2 bits (82), Expect = 0.77
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 4/56 (7%)
 Frame = -3

Query: 814 ERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFE----QVRANASSGSST 659
           ER  +CR ++ +KL+ +AC    +N R+P  + VQ L  +    Q+R  A++   T
Sbjct: 421 ERTTLCRCLNYEKLTLEACKDLAKNRRIPPGIAVQALASQQSKLQIRPAAAAAKGT 476



>gb:BX294142_768226 Pirellula sp. strain 1 complete genome; segment
           10/24.
          Length = 1189

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 6/83 (7%)
 Frame = -3

Query: 745 QNERLPLRVVVQVLFFEQVRAN-----ASSGSSTPDL-PKAIKDLNCASYGSSRSATTTT 584
           Q +R P + +VQV  +   +A+     A+SG  T D  PKA  DLN     ++   + T 
Sbjct: 68  QTQRSPAQTIVQVAAYTPFQADDATGTAASGGGTADAKPKATNDLNSVEAVAAEIESVTN 127

Query: 583 EEDWDGVASADELRALKGELAAL 515
           + + D +     L +LK   A L
Sbjct: 128 DANMDPMLKNRLLESLKSLQAVL 150



>gb:AY080713_1568435 Arabidopsis thaliana unknown protein
           (At1g50280) mRNA, complete cds.>gb:BT003005_1636587
           Arabidopsis thaliana clone U18076 unknown protein
           (At1g50280) mRNA, complete cds.
          Length = 525

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 16/68 (23%), Positives = 33/68 (48%)
 Frame = -3

Query: 826 ISKSERKRICRLMDCKKLSADACMHAVQNERLPLRVVVQVLFFEQVRANASSGSSTPDLP 647
           ++  +R  ICR ++ KKL+ + C    +N ++P  + ++ L         +   +T D+ 
Sbjct: 420 LTPQDRTEICRCLNYKKLTMETCKQLARNPKIPPEIAIEAL----KSRCGNQEHTTSDVK 475

Query: 646 KAIKDLNC 623
            A K  +C
Sbjct: 476 VANKSFSC 483



>gb:AY305378_607545 Ralstonia eutropha H16 megaplasmid pHG1,
           complete sequence.
          Length = 403

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 30/96 (31%), Positives = 46/96 (47%), Gaps = 4/96 (4%)
 Frame = -3

Query: 703 FFEQVRANASSGSSTPDLPKAIKDLNCASYGSSRSATTTTEEDWDGVASADELRALKGEL 524
           F++++R         PDLP+A+KD+          A    +  W    +A+E  A  GEL
Sbjct: 70  FWQELRGRTRVTIDHPDLPEALKDI----------AAGAVQTIWQ---AANE--AATGEL 114

Query: 523 AALR--LGNAGMADRANGDT--TKTVASSDKAAAIS 428
           A LR    +A  A  A  D   T+T A+ ++ AA+S
Sbjct: 115 ATLRAEARHAASAAEAERDAARTETAAAREEVAAVS 150



>sp|P94317|DNAK_BRAJA Chaperone protein dnaK (Heat shock protein 70)
           (Heat shock 70 kDa protein) (HSP70).>gb:BA000040_728939
           Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.>gb:BJDNAKJ_748827 Bradyrhizobium japonicum rph,
           hrcA, grpE, dnaK, dnaJ & pmtA genes.
          Length = 633

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 8/101 (7%)
 Frame = -3

Query: 697 EQVRANASSGSSTPDLPKAIKDLNC-ASYGSSRSATTTTEEDWDGVASADE-------LR 542
           +Q+R  AS G S  D+ K +KD    A     R    T + + DG+  + E        +
Sbjct: 492 QQIRIQASGGLSEADIEKMVKDAEANAEADKKRREAVTAKNEADGLVHSTEKALAEHGSK 551

Query: 541 ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMK 419
             + E  A+    + + +   GD  + + +  +  A + MK
Sbjct: 552 VAETERRAIEDAVSDLKEALKGDDAEAIKAKTQTLAQASMK 592



>gb:AY328383_609766 Bradyrhizobium sp. La5-8 DnaK (dnaK) gene,
           partial cds.
          Length = 201

 Score = 32.7 bits (73), Expect = 8.5
 Identities = 23/101 (22%), Positives = 41/101 (40%), Gaps = 8/101 (7%)
 Frame = -3

Query: 697 EQVRANASSGSSTPDLPKAIKDLNC-ASYGSSRSATTTTEEDWDGVASADE-------LR 542
           +Q+R  AS G S  D+ K +KD    A     R    T + + DG+  + E        +
Sbjct: 75  QQIRIQASGGLSEADIEKMVKDAEANAEADKKRREAVTAKNEADGLVHSTEKALAEHGSK 134

Query: 541 ALKGELAALRLGNAGMADRANGDTTKTVASSDKAAAISKMK 419
             + E  A+    + + +   GD  + + +     A + MK
Sbjct: 135 VAETERRAIEDAVSDLKEALKGDDAEAIKAKTNTLAQASMK 175


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 795,413,660
Number of Sequences: 1806583
Number of extensions: 15340459
Number of successful extensions: 38001
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 36748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37977
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 54675656432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)