BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3170
         (627 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY171099_1586735 Gossypium hirsutum cysteine protease mRNA, c...   135   7e-31   
gb:AF182079_1774901 Matricaria chamomilla thiol protease (ctp) m...   100   3e-20   
gb:AY251054_1592748 Anthurium andraeanum cysteine protease mRNA,...    95   1e-18   
gb:AB098629_1526119 Daucus carota DcCysP6 mRNA for cysteine prot...    83   4e-15   
gb:OSJN00105_1694997 Oryza sativa genomic DNA, chromosome 4, BAC...    82   6e-15   
sp|P25776|ORYA_ORYSA|ORYA_ORYSA Oryzain alpha chain precursor (EC 3.4.22.-)...    82   6e-15   Oryza sativa [red rice]
gb:AF259983_1781462 Ipomoea batatas putative cysteine protease m...    82   7e-15   
gb:H0212B02_1681314 Oryza sativa genomic DNA, chromosome 4, BAC ...    82   7e-15   
gb:AB177386_1528888 Dianthus caryophyllus DC-CP2 mRNA for cystei...    81   1e-14   
gb:AB109190_1526795 Helianthus annuus scp5 mRNA for cysteine pro...    81   1e-14   
gb:AY348863_1601426 Glycine max 34 kDa maturing seed vacuolar th...    81   2e-14   
gb:AB013289_1512004 Glycine max gene for Bd 30K, complete cds.         81   2e-14   
gb:AY192361_1588666 Trifolium repens cysteine protease 14 mRNA, ...    79   5e-14   
gb:SOYP34A_1716071 Glycine max 34 kDa maturing seed vacuolar thi...    79   8e-14   
sp|P22895|P34_SOYBN|P34_SOYBN P34 probable thiol protease precursor (EC 3....    79   8e-14   Glycine max [soybeans]
gb:AP004047_1836874 Oryza sativa (japonica cultivar-group) genom...    78   1e-13   
gb:AY192360_1588665 Trifolium repens cysteine protease 14 gene, ...    78   1e-13   
gb:AB109186_1526791 Helianthus annuus scp1 mRNA for cysteine pro...    78   1e-13   
pir|T06122|T06122 cysteine proteinase (EC 3.4.22.-) F23E12.90 - ...    78   1e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB098630_1526120 Daucus carota DcCysP7 mRNA for cysteine prot...    78   1e-13   
gb:AB109189_1526794 Helianthus annuus scp4 mRNA for cysteine pro...    77   2e-13   
pir|S51817|S47312 cysteine proteinase (EC 3.4.22.-) precursor - ...    77   2e-13   
gb:AF454958_1801126 Brassica oleracea senescence-associated cyst...    77   2e-13   
pir|S24602|S24602 cysteine proteinase tpp (EC 3.4.22.-) - garden...    77   2e-13   Pisum sativum [garden pea]
pir|T12041|T12041 cysteine proteinase (EC 3.4.22.-) 3 precursor ...    77   2e-13   Phaseolus vulgaris [French bean]
sp|P00784|PAPA_CARPA|PAPA_CARPA Papain precursor (EC 3.4.22.2) (Papaya prot...    77   3e-13   Carica papaya [mamon]
gb:AJ606073_1811951 Gossypium hirsutum mRNA for cysteine protein...    76   4e-13   
gb:AY017413_1558850 Nicotiana tabacum CPR1-like cysteine protein...    75   7e-13   
gb:AB040454_1519513 Astragalus sinicus cysteine proteinase mRNA ...    75   7e-13   
sp|P05994|PAP4_CARPA|PAP4_CARPA Papaya proteinase IV precursor (EC 3.4.22.2...    75   7e-13   Carica papaya [mamon]
gb:AY192363_1588668 Trifolium repens cysteine protease 5 gene, c...    75   9e-13   
gb:AB098631_1526121 Daucus carota DcCysP8 mRNA for cysteine prot...    75   9e-13   
pir|T06416|T06416 cysteine proteinase (EC 3.4.22.-) precursor - ...    75   9e-13   Solanum lycopersicum
gb:STU245924_1723006 Solanum tuberosum mRNA for cysteine proteas...    75   1e-12   
gb:AY192366_1588671 Trifolium repens cysteine protease 12 gene, ...    74   2e-12   
gb:AB091070_1524989 Zinnia elegans ZCP4 mRNA for cysteine protei...    74   3e-12   
gb:AB020961_1514764 Zea mays mRNA for cysteine protease componen...    74   3e-12   
gb:AY336982_1600287 Medicago truncatula putative cysteine protei...    73   3e-12   
pir|JC4848|JC4848 cysteine proteinase (EC 3.4.22.-) - Douglas fi...    73   3e-12   Pseudotsuga menziesii
gb:AF388175_1794932 Arabidopsis thaliana papain-like cysteine pe...    73   4e-12   
gb:AC069251_1540748 Genomic sequence for Arabidopsis thaliana BA...    73   4e-12   
pir|G86232|G86232 cysteine proteinase (EC 3.4.22.-) [similarity]...    73   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|A86341|A86341 cysteine proteinase (EC 3.4.22.-) [similarity]...    73   4e-12   Arabidopsis thaliana [mouse-ear cress]
pir|T03941|T03941 cysteine proteinase (EC 3.4.22.-) precursor - ...    73   4e-12   Nicotiana tabacum [American tobacco]
gb:AP003277_1827059 Oryza sativa (japonica cultivar-group) genom...    72   6e-12   
gb:AF493233_1805005 Lycopersicon pennellii cysteine protease (Rc...    72   6e-12   
pir|T10501|T10501 fruit bromelain (EC 3.4.22.33) FB13 precursor ...    72   8e-12   Ananas comosus
gb:AF454957_1801125 Brassica oleracea senescence-associated cyst...    72   1e-11   
gb:DCU17135_1675750 Dianthus caryophyllus cysteine proteinase (D...    72   1e-11   
pir|S57776|S57776 cysteine proteinase (EC 3.4.22.-) - clove pink...    72   1e-11   Dianthus caryophyllus [carnation]
gb:AY192364_1588669 Trifolium repens cysteine protease 8 gene, c...    71   1e-11   
pir|T12039|T12039 cysteine proteinase (EC 3.4.22.-) 1 precursor ...    71   1e-11   Phaseolus vulgaris [French bean]
pir|S49451|S49451 cysteine proteinase (EC 3.4.22.-) - chickpea>g...    71   1e-11   Cicer arietinum [garbanzo]
gb:AF493232_1805004 Lycopersicon pimpinellifolium cysteine prote...    71   2e-11   
gb:D38533_1674560 Ananas comosus mRNA for FB22 precursor, partia...    70   2e-11   
pir|T10516|T10516 fruit bromelain (EC 3.4.22.33) FB22 precursor ...    70   2e-11   Ananas comosus
gb:AF493234_1805006 Lycopersicon esculentum cysteine protease (R...    70   3e-11   
gb:OSJN00031_1693569 Oryza sativa genomic DNA, chromosome 4, BAC...    70   3e-11   
gb:AB025624_1516468 Arabidopsis thaliana genomic DNA, chromosome...    70   3e-11   
pir|T01207|T01207 cysteine proteinase mir3 (EC 3.4.22.-) - maize...    70   3e-11   Zea mays [maize]
gb:AY867762_1631388 Pinus taeda isolate FBRC1 cysteine protease ...    70   4e-11   
gb:AB098628_1526118 Daucus carota DcCysP5 mRNA for cysteine prot...    70   4e-11   
pir|T46630|T46630 cysteine proteinase (EC 3.4.22.-) 1 precursor ...    70   4e-11   Phaseolus vulgaris [French bean]
pir|T05390|T05390 probable cysteine proteinase (EC 3.4.22.-) F16...    70   4e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AB016870_1512880 Arabidopsis thaliana genomic DNA, chromosome...    69   5e-11   
pir|T07840|T07840 ananain (EC 3.4.22.31) AN8 precursor - pineapp...    69   5e-11   Ananas comosus
gb:AY867769_1631395 Pinus taeda isolate FBRC5 cysteine protease ...    69   6e-11   
gb:AY867766_1631392 Pinus taeda isolate FBRC21 cysteine protease...    69   6e-11   
gb:AY867761_1631387 Pinus taeda isolate FBRC16 cysteine protease...    69   6e-11   
gb:AY867759_1631385 Pinus taeda isolate FBRC14 cysteine protease...    69   6e-11   
pir|T10514|T10514 probable stem bromelain (EC 3.4.22.32) precurs...    69   6e-11   Ananas comosus
gb:AF242372_1780149 Ipomoea batatas cysteine protease (SPCP1) mR...    69   8e-11   
gb:AF089849_1767323 Brassica napus senescence-specific cysteine ...    69   8e-11   
gb:CPA131996_1648455 Carica papaya mRNA for chymopapain isoform ...    69   8e-11   
gb:CPA131995_1648454 Carica papaya mRNA for chymopapain isoform II.    69   8e-11   
gb:AC079022_1541706 Oryza sativa chromosome 5 clone P0574H01, co...    69   8e-11   
pir|S71773|S71773 cysteine proteinase (EC 3.4.22.-) precursor - ...    69   8e-11   Zinnia elegans [garden zinnia]
sp|P14080|PAP2_CARPA|PAP2_CARPA Chymopapain precursor (EC 3.4.22.6) (Papaya...    69   8e-11   Carica papaya [mamon]
gb:AY604196_1617470 Gossypium hirsutum putative cysteine proteas...    68   1e-10   
gb:AY055589_1563381 Ipomoea batatas cysteine proteinase precurso...    68   1e-10   
sp|P10056|PAP3_CARPA|PAP3_CARPA Caricain precursor (EC 3.4.22.30) (Papaya p...    68   1e-10   Carica papaya [mamon]
gb:AY039606_1560319 Arabidopsis thaliana F2G19.31/F2G19.31 mRNA,...    68   1e-10   
sp|P43297|RD21_ARATH|RD21_ARATH Cysteine proteinase RD21a precursor (EC 3.4...    68   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AK118509_1816482 Arabidopsis thaliana At3g19400 mRNA for puta...    67   2e-10   
gb:AY867764_1631390 Pinus taeda isolate FBRC3 cysteine protease ...    67   2e-10   
gb:ATU37336_1556938 Arabidopsis thaliana senescence-specific pro...    67   2e-10   
pir|T06529|T06529 cysteine proteinase (EC 3.4.22.-) - garden pea...    67   2e-10   Pisum sativum [garden pea]
sp|P43156|CYSP_HEMSP|CYSP_HEMSP Thiol protease SEN102 precursor (EC 3.4.22....    67   2e-10   
sp|P80884|ANAN_ANACO|ANAN_ANACO Ananain precursor (EC 3.4.22.31).>pir|T0783...    67   2e-10   Ananas comosus
gb:OSJN00114_1695146 Oryza sativa genomic DNA, chromosome 4, BAC...    67   2e-10   
gb:AY695444_1623509 Carica papaya proteinase omega gene, partial...    67   2e-10   
gb:AY504966_1609832 Iris hollandica putative cysteine protease 1...    67   2e-10   
gb:NFU42758_1390810 Naegleria fowleri cysteine proteinase homolo...    67   2e-10   
gb:AF157961_1246018 Hypera postica cysteine proteinase mRNA, com...    67   2e-10   
pir|T10503|T10503 fruit bromelain (EC 3.4.22.33) FB18 precursor ...    67   2e-10   Ananas comosus
sp|Q9LT77|CPR1_ARATH|CPR1_ARATH Putative cysteine proteinase At3g19400 prec...    67   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AF448505_1800669 Brassica napus cysteine proteinase (CysP1) m...    67   3e-10   
gb:PSU34747_1702498 Phalaenopsis sp. 'hybrid SM9108' cysteine pr...    67   3e-10   
gb:OSJN00046_1693820 Oryza sativa genomic DNA, chromosome 4, BAC...    67   3e-10   
gb:AP003852_1834273 Oryza sativa (japonica cultivar-group) genom...    66   4e-10   
gb:SEN11_1714956 Hemerocallis hybrid cultivar cysteine proteinas...    66   4e-10   
gb:AB098627_1526117 Daucus carota DcCysP4 mRNA for cysteine prot...    66   4e-10   
pir|JN0634|JN0634 caricain (EC 3.4.22.30) II precursor - papaya>...    66   4e-10   Carica papaya [mamon]
gb:AP003852_1834274 Oryza sativa (japonica cultivar-group) genom...    66   5e-10   
gb:AF417109_1797862 Carica candamarcensis cysteine proteinase pr...    66   5e-10   
gb:AY881010_1631908 Nicotiana tabacum cysteine protease (CP2) mR...    66   5e-10   
gb:AY251055_1592749 Anthurium andraeanum senescence-associated c...    65   7e-10   
gb:AF454956_1801124 Brassica oleracea senescence-associated cyst...    65   9e-10   
gb:AY043294_1560995 Arabidopsis thaliana cysteine proteinase (GC...    65   9e-10   
gb:AJ784223_1284201 Suberites domuncula mRNA for cathepsin H (ca...    65   9e-10   
pir|T07851|T07851 ananain (EC 3.4.22.31) precursor AN11 - pineap...    65   9e-10   Ananas comosus
gb:AY700588_1623606 Zingiber officinale cysteine protease gp3b m...    65   1e-09   
gb:AY700587_1623605 Zingiber officinale cysteine protease gp3a m...    65   1e-09   
gb:AB008267_1510432 Arabidopsis thaliana genomic DNA, chromosome...    65   1e-09   
sp|Q94B08|GCP1_ARATH|GCP1_ARATH Germination-specific cysteine protease 1 pr...    65   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:D38534_1674561 Ananas comosus mRNA for FB1035 precursor, part...    64   2e-09   
gb:AF190653_1249496 Diabrotica virgifera virgifera cathepsin L-l...    64   2e-09   
pir|T10518|T10518 fruit bromelain (EC 3.4.22.33) FB1035 precurso...    64   2e-09   Ananas comosus
gb:AC092556_1735445 Oryza sativa chromosome 3 BAC OSJNBa0047E24 ...    64   2e-09   
gb:AB098624_1526115 Daucus carota DcCysP1 mRNA for cysteine prot...    64   2e-09   
pir|F84672|F84672 probable cysteine proteinase [imported] - Arab...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY504967_1609833 Iris hollandica putative cysteine protease 2...    64   3e-09   
sp|Q9SUS9|CPR4_ARATH|CPR4_ARATH Putative cysteine proteinase At4g11320 prec...    64   3e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY850168_2149903 Cloning vector pQ-CPB recombinant cysteine p...    63   4e-09   
gb:AF343446_1789638 Actinidia chinensis actinidin protease mRNA,...    63   4e-09   
gb:AY700586_1623604 Zingiber officinale cysteine protease gp2b m...    63   4e-09   
pir|S12618|TAGB actinidain (EC 3.4.22.14) precursor - kiwi fruit...    63   4e-09   
sp|P25803|CYSP_PHAVU|CYSP_PHAVU Vignain precursor (EC 3.4.22.-) (Bean endop...    63   4e-09   Phaseolus vulgaris [French bean]
gb:AF133839_1770952 Sandersonia aurantiaca papain-like cysteine ...    63   5e-09   
gb:AF083753_1766983 Arabidopsis thaliana clone sps565 unknown mRNA.    63   5e-09   
gb:AY093066_1575020 Arabidopsis thaliana drought-inducible cyste...    63   5e-09   
gb:TBR297265_1399271 Trypanosoma brucei rhodesiense partial mRNA...    63   5e-09   
sp|Q9SUT0|CPR3_ARATH|CPR3_ARATH Putative cysteine proteinase At4g11310 prec...    63   5e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP006170_1861285 Oryza sativa (japonica cultivar-group) genom...    62   6e-09   
gb:AP003724_1832447 Oryza sativa (japonica cultivar-group) genom...    62   6e-09   
gb:NTU57825_1691844 Nicotiana tabacum endopeptidase-like protein...    62   6e-09   
gb:AY700585_1623603 Zingiber officinale cysteine protease gp2a m...    62   6e-09   
gb:AY662993_1620480 Petunia x hybrida cysteine proteinase (CP7) ...    62   6e-09   
gb:AC116956_1206524 Dictyostelium discoideum chromosome 2 map 14...    62   6e-09   
pir|T02166|T02166 cysteine proteinase (EC 3.4.22.-) precursor - ...    62   6e-09   Nicotiana tabacum [American tobacco]
pir|S12099|S12099 cysteine proteinase (EC 3.4.22.-) precursor - ...    62   6e-09   Trypanosoma brucei brucei
pir|T06708|T06708 cysteine proteinase (EC 3.4.22.-) T29H11.140 -...    62   6e-09   Arabidopsis thaliana [mouse-ear cress]
sp|P54639|CYS4_DICDI|CYS4_DICDI Cysteine proteinase 4 precursor (EC 3.4.22....    62   6e-09   Dictyostelium discoideum
gb:AP006170_1861279 Oryza sativa (japonica cultivar-group) genom...    62   8e-09   
gb:PVEPC1_1702940 Phaseolus vulgaris mRNA for endopeptidase (EP-...    62   8e-09   
gb:AB109187_1526792 Helianthus annuus scp2 mRNA for cysteine pro...    62   8e-09   
pir|S22502|S22502 cysteine proteinase (EC 3.4.22.-) - kidney bean      62   8e-09   Phaseolus vulgaris [French bean]
sp|P12412|CYSP_VIGMU|CYSP_VIGMU Vignain precursor (EC 3.4.22.-) (Bean endop...    62   8e-09   Vigna mungo [urad dal]
sp|O65039|CYSP_RICCO|CYSP_RICCO Vignain precursor (EC 3.4.22.-) (Cysteine e...    62   8e-09   Ricinus communis
gb:AF194426_2479445 Myxine glutinosa clone hicl20 cysteine prote...    62   1e-08   
gb:AY563270_1615020 Bromelia fastuosa fastuosain precursor mRNA,...    62   1e-08   
gb:AB098625_1526116 Daucus carota DcCysP2 mRNA for cysteine prot...    62   1e-08   
gb:AB004819_1509189 Oryza sativa Rep1 gene for cysteine endopept...    61   1e-08   
sp|P00785|ACTN_ACTCH|ACTN_ACTCH Actinidain precursor (EC 3.4.22.14) (Actini...    61   1e-08   Actinidia chinensis
gb:VRU49445_1727379 Vigna radiata cysteinyl endopeptidase mRNA, ...    61   2e-08   
sp|P04988|CYS1_DICDI|CYS1_DICDI Cysteine proteinase 1 precursor (EC 3.4.22....    61   2e-08   Dictyostelium discoideum
sp|Q9LXW3|CPR2_ARATH|CPR2_ARATH Putative cysteine proteinase At3g43960 prec...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP006170_1861282 Oryza sativa (japonica cultivar-group) genom...    60   2e-08   
gb:AF194427_2479446 Myxine glutinosa clone hicl22 cysteine prote...    60   3e-08   
gb:AP002869_1823473 Oryza sativa (japonica cultivar-group) genom...    60   3e-08   
gb:AB024031_1515760 Arabidopsis thaliana genomic DNA, chromosome...    60   3e-08   
gb:TRBACYSPRO_1400578 Trypanosoma congolense cysteine protease m...    60   3e-08   
gb:AJ583511_1282280 Diabrotica virgifera virgifera mRNA for cath...    60   3e-08   
gb:PSA004958_1701891 Pisum sativum mRNA for TPE4A thiol-protease.      60   4e-08   
gb:AY662994_1620481 Petunia x hybrida cysteine proteinase (CP8) ...    60   4e-08   
gb:AY087918_1572943 Arabidopsis thaliana clone 39621 mRNA, compl...    60   4e-08   
gb:TCCYSPROT_1399672 T.congolense mRNA for (prepro) cysteine pro...    60   4e-08   
gb:AY336947_1320742 Anthonomus grandis cysteine proteinase (cys1...    60   4e-08   
pir|S37048|S37048 cysteine proteinase - Trypanosoma congolense         60   4e-08   Trypanosoma congolense
pir|S47434|S47434 cysteine proteinase (EC 3.4.22.-) - rice>gb:AB...    60   4e-08   Oryza sativa [red rice]
gb:AGU13940_1811059 Alnus glutinosa cysteine proteinase mRNA, co...    59   5e-08   
gb:AF089848_1767322 Brassica napus senescence-specific cysteine ...    59   5e-08   
gb:AF139913_1244281 Trypanosoma congolense cysteine protease gen...    59   5e-08   
sp|P14658|CYSP_TRYBB|CYSP_TRYBB Cysteine proteinase precursor (EC 3.4.22.-)...    59   5e-08   Trypanosoma brucei brucei
gb:D14057_1674466 Ananas comosus mRNA for bromelain, partial cds.      59   7e-08   
gb:AY345219_1321634 Acanthoscelides obtectus cathepsin L-like cy...    59   7e-08   
gb:AF016448_1232447 Caenorhabditis elegans cosmid F41E6, complet...    59   7e-08   
pir|T31871|T31871 hypothetical protein F41E6.6 - Caenorhabditis ...    59   7e-08   Caenorhabditis elegans [roundworm]
pir|B84752|B84752 probable cysteine proteinase [imported] - Arab...    59   7e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP006170_1861276 Oryza sativa (japonica cultivar-group) genom...    59   9e-08   
gb:AB092555_1525078 Glycine max CysP1 mRNA for cysteine proteina...    59   9e-08   
gb:AC117076_1207833 Dictyostelium discoideum chromosome 2 map 33...    59   9e-08   
gb:AB057372_1521685 Daucus carota CSCP gene for cysteine protein...    58   1e-07   
pir|JC7787|JC7787 carrot seed cysteine proteinase (EC 3.4.-.-), ...    58   1e-07   Daucus carota [carrots]
pir|T03694|T03694 cysteine proteinase (EC 3.4.22.-) - rice>gb:D7...    58   1e-07   Oryza sativa [red rice]
gb:AB092557_1525080 Glycine max CysP2 mRNA for cysteine proteina...    58   1e-07   
gb:BC068241_2106067 Mus musculus cathepsin 8, mRNA (cDNA clone M...    57   2e-07   
gb:AF099203_1767963 Oryza sativa cysteine endopeptidase precurso...    57   2e-07   
gb:AK049474_1168816 Mus musculus 7 days embryo whole body cDNA, ...    57   2e-07   
gb:AP006170_1861277 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:LME319727_1387710 Leishmania mexicana cpb2 gene.                    57   3e-07   
gb:AF115280_1242488 Sarcocystis muris thiolproteinase SmTP1 (smt...    57   3e-07   
pir|S29245|S29245 cysteine proteinase (EC 3.4.22.-) precursor - ...    57   3e-07   Leishmania mexicana
pir|T45839|T45839 probable cysteine proteinase (EC 3.4.22.-) [si...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P36400|LCPB_LEIME|LCPB_LEIME Cysteine proteinase B precursor (EC 3.4.22....    57   3e-07   Leishmania mexicana
sp|Q05094|CYS2_LEIPI|CYS2_LEIPI Cysteine proteinase 2 precursor (EC 3.4.22....    57   3e-07   Leishmania pifanoi
gb:OSJN00065_1694210 Oryza sativa genomic DNA, chromosome 4, BAC...    57   3e-07   
gb:AB109188_1526793 Helianthus annuus scp3 mRNA for cysteine pro...    57   3e-07   
gb:AY543010_1334466 Bigelowiella natans cysteine proteinase mRNA...    57   3e-07   
gb:AC104496_1192353 Trypanosoma cruzi strain CL Brener chromosom...    57   3e-07   
sp|P25251|CYS4_BRANA|CYS4_BRANA Cysteine proteinase COT44 precursor (EC 3.4...    57   3e-07   Brassica napus [oilseed rape]
gb:BT019598_2151441 Synthetic construct Homo sapiens cathepsin F...    56   4e-07   
gb:HSM802335_2017462 Homo sapiens mRNA; cDNA DKFZp434F0610 (from...    56   4e-07   
gb:CR541680_1993910 Homo sapiens full open reading frame cDNA cl...    56   4e-07   
gb:AF136279_1885750 Homo sapiens cathepsin F precursor (CTSF) mR...    56   4e-07   
gb:AF071748_1880833 Homo sapiens cathepsin F (CATSF) mRNA, compl...    56   4e-07   
gb:AP001633_1821394 Oryza sativa (japonica cultivar-group) genom...    56   4e-07   
gb:VSCYSPROA_1727386 V.sativa L. (PROT A) mRNA for cysteine prot...    56   4e-07   
pir|T46294|T46294 hypothetical protein DKFZp434F0610.1 - human (...    56   4e-07   Homo sapiens [man]
pir|S49166|S49166 cysteine proteinase (EC 3.4.22.-) precursor - ...    56   4e-07   Vicia sativa [spring vetch]
sp|Q9UBX1|CATF_HUMAN|CATF_HUMAN Cathepsin F precursor (EC 3.4.22.41) (CATSF...    56   4e-07   Homo sapiens [man]
gb:DRCATHEPL_2571000 D.rerio mRNA for cathepsin L.                     56   6e-07   
gb:AP003759_1833026 Oryza sativa (japonica cultivar-group) genom...    56   6e-07   
gb:AF544843_1280689 Callosobruchus maculatus putative gut cathep...    56   6e-07   
gb:AF544840_1280686 Callosobruchus maculatus putative gut cathep...    56   6e-07   
gb:AF314930_1261697 Trypanosoma cruzi strain Ynull cruzipain gen...    56   6e-07   
gb:AF314929_1261696 Trypanosoma cruzi strain Y cruzipain gene, c...    56   6e-07   
pir|T06276|T06276 benzothiadiazole-induced protein (clone WCI-4)...    56   6e-07   Triticum aestivum [Canadian hard winter wheat]
sp|P25779|CYSP_TRYCR|CYSP_TRYCR Cruzipain precursor (EC 3.4.22.51) (Major c...    56   6e-07   Trypanosoma cruzi
gb:AF544839_1280685 Callosobruchus maculatus putative gut cathep...    55   7e-07   
gb:AF544837_1280683 Callosobruchus maculatus putative gut cathep...    55   7e-07   
gb:AF228731_1252916 Stylonychia lemnae cathepsin L gene, complet...    55   7e-07   
gb:BC060335_2552818 Xenopus laevis cDNA clone MGC:68554 IMAGE:40...    55   1e-06   
gb:LMCPB18G_1387670 L.mexicana cpb18 gene.                             55   1e-06   
gb:BX538353_1359133 Cryptosporidium parvum chromosome 6, complet...    55   1e-06   
gb:AF091366_1240183 Cryptosporidium parvum cryptopain precursor,...    55   1e-06   
gb:MMU131851_2118392 Mus musculus mRNA for cathepsin F.                55   1e-06   
gb:AF456463_2066304 Mus musculus cathepsin M (CtsM) mRNA, comple...    55   1e-06   
gb:AF197480_2058786 Mus musculus strain C57BL/6 cathepsin F (Cts...    55   1e-06   
gb:AF071749_1880834 Homo sapiens cathepsin F (CATSF) mRNA, compl...    55   1e-06   
gb:AP002866_1823377 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AF019145_1761576 Zea mays cysteine protease Mir1 (mir1) mRNA,...    55   1e-06   
gb:AY660746_1344372 Toxoplasma gondii strain RH toxopain-2 mRNA,...    55   1e-06   
gb:AJ583512_1282281 Diabrotica virgifera virgifera mRNA for cath...    55   1e-06   
gb:AF544836_1280682 Callosobruchus maculatus putative gut cathep...    55   1e-06   
gb:AF544834_1280680 Callosobruchus maculatus putative gut cathep...    55   1e-06   
gb:AK005428_1153012 Mus musculus adult female placenta cDNA, RIK...    55   1e-06   
pir|T06207|T06207 cysteine proteinase (EC 3.4.22.-) - barley>gb:...    55   1e-06   Hordeum vulgare [barley]
pir|T06206|T06206 probable cysteine proteinase (EC 3.4.22.-) pre...    55   1e-06   Hordeum vulgare [barley]
sp|P54640|CYS5_DICDI|CYS5_DICDI Cysteine proteinase 5 precursor (EC 3.4.22....    55   1e-06   Dictyostelium discoideum
sp|Q9JL96|CATM_MOUSE|CATM_MOUSE Cathepsin M precursor (EC 3.4.22.-).>gb:AF2...    55   1e-06   Mus musculus [mouse]
sp|Q9R013|CATF_MOUSE|CATF_MOUSE Cathepsin F precursor (EC 3.4.22.41).>gb:AK...    55   1e-06   Mus musculus [mouse]
gb:AY014779_2073932 Mus musculus cathepsin 1 precursor (Cts1) mR...    54   2e-06   
gb:AF250837_2060587 Mus musculus EPCS24 mRNA, partial cds.             54   2e-06   
gb:AF454959_1801127 Brassica oleracea senescence-associated cyst...    54   2e-06   
gb:TRBRANGA_1400777 Trypanosoma rangeli (clone 2) rangelipain ge...    54   2e-06   
gb:AF544844_1280690 Callosobruchus maculatus putative gut cathep...    54   2e-06   
gb:AF544841_1280687 Callosobruchus maculatus putative gut cathep...    54   2e-06   
gb:AF544838_1280684 Callosobruchus maculatus putative gut cathep...    54   2e-06   
gb:AF544835_1280681 Callosobruchus maculatus putative gut cathep...    54   2e-06   
pir|T01206|T01206 cysteine proteinase mir2 (EC 3.4.22.-) - maize...    54   2e-06   Zea mays [maize]
gb:OSJN00114_1695150 Oryza sativa genomic DNA, chromosome 4, BAC...    54   2e-06   
gb:TRBTUL2TAN_1400840 Trypanosoma cruzi tandem cysteine proteina...    54   2e-06   
gb:TCU41444_1399893 Trypanosoma cruzi cysteine protease cruzipai...    54   2e-06   
gb:LMU43706_1388899 Leishmania major cathepsin L-like protease m...    54   2e-06   
gb:DDU72745_1377414 Dictyostelium discoideum cysteine proteinase...    54   2e-06   
gb:AJ583510_1282279 Diabrotica virgifera virgifera partial mRNA ...    54   2e-06   
gb:AF265226_1257249 Trypanosoma cruzi strain TUL cruzipain gene,...    54   2e-06   
pir|A45629|A45629 cysteine proteinase cruzipain (EC 3.4.22.-) - ...    54   2e-06   Trypanosoma cruzi
pir|T06707|T06707 cysteine proteinase (EC 3.4.22.-) T29H11.130 -...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
pir|S47432|S47432 cathepsin L (EC 3.4.22.15) - Norway lobster>gb...    54   2e-06   Nephrops norvegicus
pir|T06208|T06208 cysteine proteinase (EC 3.4.22.-) - barley>gb:...    54   2e-06   Hordeum vulgare [barley]
sp|P25777|ORYB_ORYSA|ORYB_ORYSA Oryzain beta chain precursor (EC 3.4.22.-)....    54   2e-06   Oryza sativa [red rice]
gb:AY229987_2313052 Cryptophlebia leucotreta granulovirus isolat...    54   3e-06   
gb:BC004054_2089564 Mus musculus cathepsin F, mRNA (cDNA clone M...    54   3e-06   
gb:OSJN00032_1693605 Oryza sativa genomic DNA, chromosome 4, BAC...    54   3e-06   
gb:HVU94591_1682853 Hordeum vulgare cysteine proteinase precurso...    54   3e-06   
gb:AY192362_1588667 Trifolium repens cysteine protease 1 gene, p...    54   3e-06   
gb:TRBRANGB_1400779 Trypanosoma rangeli (clone 3) rangelipain ge...    54   3e-06   
gb:AY528230_1333139 Leptinotarsa decemlineata clone IntB12 diges...    54   3e-06   
gb:AY159374_1305255 Leptinotarsa decemlineata clone IntB4 digest...    54   3e-06   
gb:AF039554_1235484 Acanthamoeba culbertsoni cysteine proteinase...    54   3e-06   
sp|P25782|CYS2_HOMAM|CYS2_HOMAM Digestive cysteine proteinase 2 precursor (...    54   3e-06   Homarus americanus
sp|P04989|CYS2_DICDI|CYS2_DICDI Cysteine proteinase 2 precursor (EC 3.4.22....    54   3e-06   Dictyostelium discoideum
gb:AB128161_2466293 Cyprinus carpio CTSL mRNA for cathepsin L pr...    53   4e-06   
gb:AP003928_1835387 Oryza sativa (japonica cultivar-group) genom...    53   4e-06   
gb:TCU41454_1399894 Trypanosoma cruzi cysteine protease cruzipai...    53   4e-06   
gb:AY515271_1332446 Taenia cellulosae cathepsin L-like cysteine ...    53   4e-06   
gb:AF544842_1280688 Callosobruchus maculatus putative gut cathep...    53   4e-06   
gb:AF309627_1261141 Leishmania donovani clone Ld-F cysteine prot...    53   4e-06   
gb:AF309626_1261140 Leishmania donovani clone Ld-A cysteine prot...    53   4e-06   
gb:AF217087_1251893 Leishmania chagasi cathepsin L-like cysteine...    53   4e-06   
gb:AF004592_1231110 Leishmania donovani chagasi amastigote-speci...    53   4e-06   
gb:AC117076_1207824 Dictyostelium discoideum chromosome 2 map 33...    53   4e-06   
pir|T12040|T12040 cysteine proteinase (EC 3.4.22.-) 2 precursor ...    53   4e-06   
pir|F86413|F86413 probable cysteine proteinase [imported] - Arab...    53   4e-06   
pir|T27079|T27079 hypothetical protein Y51A2D.8 - Caenorhabditis...    53   4e-06   
sp|P25250|CYS2_HORVU|CYS2_HORVU Cysteine proteinase EP-B 2 precursor (EC 3....    53   4e-06   
sp|P13277|CYS1_HOMAM|CYS1_HOMAM Digestive cysteine proteinase 1 precursor (...    53   4e-06   
sp|Q26636|CATL_SARPE|CATL_SARPE Cathepsin L precursor (EC 3.4.22.15).>pir|A...    53   4e-06   
gb:AY212286_2519529 Fundulus heteroclitus cathepsin L precursor,...    53   5e-06   
gb:AY034574_2074212 Mus musculus cathepsin-3 precursor (Cts3) mR...    53   5e-06   
gb:AF456464_2066305 Mus musculus cathepsin 3 (Cts3) mRNA, partia...    53   5e-06   
gb:BT000674_1634951 Arabidopsis thaliana clone RAFL05-19-H13 (R1...    53   5e-06   
gb:AB011483_1511491 Arabidopsis thaliana genomic DNA, chromosome...    53   5e-06   
gb:AF098670_1240857 Tethya aurantia silicatein beta mRNA, comple...    53   5e-06   
sp|P25249|CYS1_HORVU|CYS1_HORVU Cysteine proteinase EP-B 1 precursor (EC 3....    53   5e-06   
gb:BC077285_2559999 Xenopus laevis cathepsin S, mRNA (cDNA clone...    52   6e-06   
gb:NTA242994_1691277 Nicotiana tabacum mRNA for putative preproc...    52   6e-06   
gb:PWU70537_1396266 Paragonimus westermani pre-procathepsin L mR...    52   6e-06   
gb:PWU69121_1396265 Paragonimus westermani cysteine proteinase P...    52   6e-06   
gb:PWU69120_1396264 Paragonimus westermani cysteine proteinase P...    52   6e-06   
gb:AY528229_1333138 Leptinotarsa decemlineata clone IntB11 diges...    52   6e-06   
gb:AY289110_1316124 Plasmodium chabaudi chabaudi chabaupain-2 ge...    52   6e-06   
pir|D86198|D86198 cysteine proteinase (EC 3.4.22.-) [similarity]...    52   6e-06   
gb:AY373974_1603459 Ipomoea batatas cysteine proteinase precurso...    52   8e-06   
gb:AB161375_1528556 Aster tripolium CysP mRNA for cysteine prote...    52   8e-06   
gb:AY728269_1348763 Paragonimus westermani westerpain-1 gene, co...    52   8e-06   
gb:AF265227_1257250 Trypanosoma cruzi strain TCC cruzipain gene,...    52   8e-06   
pir|T12382|T12382 cysteine proteinase (EC 3.4.22.-) - common ice...    52   8e-06   
pir|A47306|A47306 cysteine proteinase - Tetrahymena thermophila>...    52   8e-06   
sp|Q94504|CYS7_DICDI|CYS7_DICDI Cysteine proteinase 7 precursor (EC 3.4.22....    52   8e-06   
gb:AF358668_2489199 Oncorhynchus mykiss procathepsin L mRNA, com...    52   1e-05   
gb:AF456460_2066301 Rattus norvegicus cathepsin Q2 (CtsQ2) mRNA,...    52   1e-05   
gb:LMCPB1_1387668 L.mexicana cpb1 gene.                                52   1e-05   
gb:AY728270_1348764 Paragonimus westermani westerpain-10 gene, c...    52   1e-05   
gb:AY528231_1333140 Leptinotarsa decemlineata clone IntC14 diges...    52   1e-05   
gb:AY231965_1177258 Drosophila yakuba clone yak-em_CG12163 mRNA ...    52   1e-05   
gb:AE014297_1137928 Drosophila melanogaster chromosome 3R, compl...    52   1e-05   
gb:AE014187_939019 Plasmodium falciparum 3D7 chromosome 14 compl...    52   1e-05   
pir|S30149|S30149 cysteine proteinase (EC 3.4.22.-) precursor (c...    52   1e-05   
pir|S30150|S30150 cysteine proteinase (EC 3.4.22.-) precursor (c...    52   1e-05   
sp|P25805|CYSP_PLAFA|CYSP_PLAFA Trophozoite cysteine proteinase precursor (...    52   1e-05   
sp|Q9VN93|CPR1_DROME|CPR1_DROME Putative cysteine proteinase CG12163 precur...    52   1e-05   
gb:BC075261_2558367 Xenopus tropicalis cathepsin S, mRNA (cDNA c...    51   1e-05   
gb:FHE279093_1385090 Fasciola hepatica partial mRNA for procathe...    51   1e-05   
gb:AY004155_1285951 Haemonchus contortus cathepsin L cysteine pr...    51   1e-05   
gb:AF320565_1262382 Rhodnius prolixus cathepsine L-like cysteine...    51   1e-05   
gb:AK005389_1152985 Mus musculus adult female placenta cDNA, RIK...    51   1e-05   
sp|Q9PYY5|CATV_GVXN|CATV_GVXN Viral cathepsin (EC 3.4.22.50) (V-cath) (Cys...    51   1e-05   
gb:BT004146_1637245 Arabidopsis thaliana clone RAFL16-01-H24 (R5...    51   2e-05   
gb:AY192365_1588670 Trifolium repens cysteine protease 10 gene, ...    51   2e-05   
gb:AJ628943_1283666 Leishmania infantum cpb gene for cathepsin L...    51   2e-05   
gb:AJ628942_1283665 Leishmania infantum hd gene for histone deac...    51   2e-05   
pir|D86413|D86413 cysteine proteinase (EC 3.4.22.-) [similarity]...    51   2e-05   
gb:BC075887_2558777 Danio rerio zgc:92089, mRNA (cDNA clone MGC:...    50   2e-05   
gb:AF454960_1801128 Brassica oleracea senescence-associated cyst...    50   2e-05   
gb:ZMSEE1_1732027 Z.mays mRNA for cysteine proteinase, See1.           50   2e-05   
gb:AB038598_1519244 Vigna mungo mRNA for cysteine protease, comp...    50   2e-05   
gb:TRBRANG_1400775 Trypanosoma rangeli (clone 1) rangelipain gen...    50   2e-05   
gb:PCO17903_1391799 Phaedon cochleariae mRNA for thiol protease.       50   2e-05   
pir|JC5443|JC5443 cathepsin L-like cysteine proteinase (EC 3.4.2...    50   2e-05   
pir|C86413|C86413 cysteine proteinase (EC 3.4.22.-) [similarity]...    50   2e-05   
sp|Q10717|CYS2_MAIZE|CYS2_MAIZE Cysteine proteinase 2 precursor (EC 3.4.22....    50   2e-05   
gb:AB099890_2464886 Oryzias latipes ctsL mRNA for cathepsin L, c...    50   3e-05   
gb:AP006170_1861281 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AY017414_1558851 Nicotiana tabacum CPR2-like cysteine protein...    50   3e-05   
gb:AB032168_1518656 Nicotiana tabacum NTCP-23 mRNA for cysteine ...    50   3e-05   
gb:AE014296_1136203 Drosophila melanogaster chromosome 3L, compl...    50   3e-05   
pir|JC5441|JC5441 cathepsin L-like cysteine proteinase (EC 3.4.2...    50   3e-05   
gb:BC074718_2558211 Xenopus tropicalis MGC69486 protein, mRNA (c...    50   4e-05   
gb:AY522332_2356051 Agrotis segetum granulovirus, complete genome.     50   4e-05   
gb:BC051665_2100812 Mus musculus cDNA sequence BC051665, mRNA (c...    50   4e-05   
gb:AP005419_1851485 Oryza sativa (japonica cultivar-group) genom...    50   4e-05   
gb:AY091771_1574731 Arabidopsis thaliana AT3g45310/F18N11_70 mRN...    50   4e-05   
gb:AY795056_1352262 Artemia parthenogenetica cathepsin L1 gene, ...    50   4e-05   
gb:AY795054_1352260 Artemia franciscana cathepsin L precursor, g...    50   4e-05   
gb:AF412313_1268926 Haemonchus contortus cathepsin L cysteine pr...    50   4e-05   
pir|T14625|T14625 hypothetical protein - Trypanosoma cruzi>gb:AC...    50   4e-05   
pir|T47471|T47471 cysteine proteinase (EC 3.4.22.-) F18N11.70 [s...    50   4e-05   
sp|P25804|CYSP_PEA|CYSP_PEA Cysteine proteinase 15A precursor (EC 3.4.22....    50   4e-05   
gb:AF082181_1766609 Solanum melongena cysteine proteinase precur...    49   5e-05   
gb:PVCATHEPL_1396092 P.vannamei mRNA for cathepsin L.                  49   5e-05   
gb:PRU33426_1395736 Plasmodium reichenowi cysteine proteinase ge...    49   5e-05   
gb:FHECATHES_1385098 Fasciola hepatica cathepsin L-like protease...    49   5e-05   
gb:AF419329_1269467 Fasciola gigantica cathepsin L mRNA, complet...    49   5e-05   
gb:AB011375_1193359 Sarcophaga peregrina mRNA for 26,29kDa prote...    49   5e-05   
gb:AE013599_1131763 Drosophila melanogaster chromosome 2R, compl...    49   5e-05   
pir|JC5442|JC5442 cathepsin L-like cysteine proteinase (EC 3.4.2...    49   5e-05   
sp|Q95029|CATL_DROME|CATL_DROME Cathepsin L precursor (EC 3.4.22.15) (Cyste...    49   5e-05   
gb:AF479267_2066775 Mesocricetus auratus cathepsin L mRNA, compl...    49   7e-05   
gb:AP003764_1833137 Oryza sativa (japonica cultivar-group) genom...    49   7e-05   
gb:AF411121_1797175 Sandersonia aurantiaca cysteine proteinase p...    49   7e-05   
gb:AY075147_1296002 Tetrahymena thermophila granule-biosynthesis...    49   7e-05   
sp|P25778|ORYC_ORYSA|ORYC_ORYSA Oryzain gamma chain precursor (EC 3.4.22.-)...    49   7e-05   
sp|Q91CL9|CATV_NPVAP|CATV_NPVAP Viral cathepsin (EC 3.4.22.50) (V-cath) (Cy...    49   7e-05   
gb:AY333300_2528357 Paralabidochromis chilotes isolate Pach-cath...    49   9e-05   
gb:AH005369S6_1906625 Human cathepsin S gene, exon 6, partial cds.     49   9e-05   
gb:AY363263_1322717 Triatoma infestans cathepsin L-like proteina...    49   9e-05   
gb:AF271385_1257585 Fasciola hepatica cathepsin L mRNA, complete...    49   9e-05   
gb:AF239265_1253907 Fasciola gigantica cathepsin L (cat-L1C) mRN...    49   9e-05   
gb:AF147207_1244945 Artemia franciscana cathepsin L-like proteas...    49   9e-05   
gb:AB010924_1193279 Fasciola gigantica FhCL(B7-3) gene for cathe...    49   9e-05   
pir|D71428|D71428 cysteine proteinase (EC 3.4.22.-) - Arabidopsi...    49   9e-05   
pir|A42482|A42482 cathepsin S (EC 3.4.22.27) precursor - human>g...    49   9e-05   
sp|Q28944|CATL_PIG|CATL_PIG Cathepsin L precursor (EC 3.4.22.15).>pir|A58...    49   9e-05   
gb:BC056059_2551642 Xenopus laevis cathepsin S, mRNA (cDNA clone...    48   1e-04   
gb:AF242373_1780150 Ipomoea batatas cysteine protease (SPCP2) mR...    48   1e-04   
gb:FHE279091_1385088 Fasciola hepatica partial mRNA for procathe...    48   1e-04   
gb:AY333298_1320334 Branchiostoma lanceolatum isolate Brla-beta1...    48   1e-04   
gb:AY208821_1309913 Rhipicephalus appendiculatus midgut cysteine...    48   1e-04   
gb:AB091669_1198742 Pandalus borealis PbCys mRNA for crustapain,...    48   1e-04   
pir|S71923|S71923 cysteine proteinase (EC 3.4.22.-) - garden pea...    48   1e-04   
sp|O41479|CATV_NPVCD|CATV_NPVCD Viral cathepsin (EC 3.4.22.50) (V-cath) (Cy...    48   1e-04   
sp|Q9QZE3|CATQ_RAT|CATQ_RAT Cathepsin Q precursor (EC 3.4.22.-).>pir|JC71...    48   1e-04   
gb:BC080004_2561441 Xenopus laevis MGC81823 protein, mRNA (cDNA ...    48   2e-04   
gb:AB081844_2463656 Engraulis japonicus aCat2 mRNA for cathepsin...    48   2e-04   
gb:AF083750_1766980 Arabidopsis thaliana clone sps530 unknown mRNA.    48   2e-04   
gb:AY087621_1572651 Arabidopsis thaliana clone 37132 mRNA, compl...    48   2e-04   
gb:TFU13153_1400104 Tritrichomonas foetus D1 putative cysteine p...    48   2e-04   
gb:AY376236_1324057 Tritrichomonas foetus strain K cysteine prot...    48   2e-04   
gb:AF004594_1231112 Trypanosoma cruzi cysteine protease (cp) gen...    48   2e-04   
pir|T09528|T09528 probable cysteine proteinase (EC 3.4.22.-) pre...    48   2e-04   
sp|P43296|RD19_ARATH|RD19_ARATH Cysteine proteinase RD19a precursor (EC 3.4...    48   2e-04   
sp|O60911|CSL2_HUMAN|CSL2_HUMAN Cathepsin L2 precursor (EC 3.4.22.43) (Cath...    48   2e-04   
gb:AB081843_2463655 Engraulis japonicus aCat1 mRNA for cathepsin...    47   2e-04   
gb:HSY14734_2028363 Homo sapiens mRNA for cathepsin L2.                47   2e-04   
gb:BC002642_1968284 Homo sapiens cathepsin S, mRNA (cDNA clone M...    47   2e-04   
gb:PSA278699_1701953 Pisum sativum mRNA for protease (elsa gene).      47   2e-04   
gb:A98645_1451469 Sequence 1 from Patent WO9910500.>gb:A98647_14...    47   2e-04   
gb:TRBCYSPRNS_1400635 Trypanosoma cruzi cysteine proteinase gene...    47   2e-04   
gb:TCU53172_1399900 Toxocara canis cathepsin L-like cysteine pro...    47   2e-04   
gb:PCU33422_1391846 Plasmodium cynomolgi cysteine proteinase gen...    47   2e-04   
gb:AY428949_1326022 Fasciola gigantica cathepsin L (cat-L1H) mRN...    47   2e-04   
gb:AY063764_1293663 Plasmodium vinckei vinckepain-2 mRNA, comple...    47   2e-04   
gb:AF495854_1277032 Psoroptes ovis Derp1 antigen mRNA, partial cds.    47   2e-04   
gb:AF258791_1256783 Plasmodium falciparum cysteine protease falc...    47   2e-04   
gb:AE014186_938125 Plasmodium falciparum 3D7 chromosome 11 compl...    47   2e-04   
gb:AF121837_2055371 Mus musculus cell-line L929 cathepsin L mRNA...    47   3e-04   
gb:HUMCATS_2029864 Homo sapiens cathepsin S (CTSS) mRNA, complet...    47   3e-04   
gb:AY156691_1937293 Saimiri boliviensis cathepsin S preproprotei...    47   3e-04   
gb:AL356292_1924398 Human DNA sequence from clone RP11-363I22 on...    47   3e-04   
gb:AL160279_1921866 Human DNA sequence from clone RP11-65B23 on ...    47   3e-04   
gb:AF138266_1771382 Ipomoea batatas papain-like cysteine protein...    47   3e-04   
gb:AF138265_1771381 Ipomoea batatas papain-like cysteine protein...    47   3e-04   
gb:LMU249847_1685158 Lolium multiflorum mRNA for cysteine protea...    47   3e-04   
gb:LECYSPRO_1684282 L.esculentum mRNA encoding pre-pro-cysteine ...    47   3e-04   
gb:SDO547635_1397450 Suberites domuncula mRNA for silicatein bet...    47   3e-04   
gb:AY333297_1320333 Branchiostoma lanceolatum isolate Brla-beta2...    47   3e-04   
gb:AY333296_1320332 Branchiostoma lanceolatum isolate Brla-beta9...    47   3e-04   
gb:AY029229_1288320 Fasciola hepatica cathepsin L-like mRNA, par...    47   3e-04   
gb:AK011589_1156491 Mus musculus 10 days embryo whole body cDNA,...    47   3e-04   
pir|S24988|S24988 cysteine proteinase (EC 3.4.22.-) precursor - ...    47   3e-04   
sp|Q40143|CYS3_LYCES|CYS3_LYCES Cysteine proteinase 3 precursor (EC 3.4.22....    47   3e-04   
sp|Q23894|CYS3_DICDI|CYS3_DICDI Cysteine proteinase 3 (EC 3.4.22.-) (Cystei...    47   3e-04   
sp|P25774|CATS_HUMAN|CATS_HUMAN Cathepsin S precursor (EC 3.4.22.27).             47   3e-04   
sp|P06797|CATL_MOUSE|CATL_MOUSE Cathepsin L precursor (EC 3.4.22.15) (Major...    47   3e-04   
sp|P07711|CATL_HUMAN|CATL_HUMAN Cathepsin L precursor (EC 3.4.22.15) (Major...    47   3e-04   
gb:BC073547_2557376 Xenopus laevis hypothetical protein LOC44366...    47   3e-04   
gb:MMCATHEPS_2114426 Mus musculus mRNA for cathepsin S.                47   3e-04   
gb:BC002125_2088888 Mus musculus cathepsin S, mRNA (cDNA clone M...    47   3e-04   
gb:AF456459_2066300 Rattus norvegicus cathepsin R (CtsR) mRNA, c...    47   3e-04   
gb:AF310623_2062410 Rattus norvegicus cathepsin P (CtsP) mRNA, c...    47   3e-04   
gb:AF038546_2051874 Mus musculus cathepsin S precursor, mRNA, co...    47   3e-04   
gb:BC012612_1973709 Homo sapiens cathepsin L, transcript variant...    47   3e-04   
gb:AY337012_1600306 Brassica rapa subsp. pekinensis clone MJ32 p...    47   3e-04   
gb:AY519971_1332767 Fasciola hepatica clone Porto 1 cathepsin L ...    47   3e-04   
gb:AF426414_1269965 Delia radicum cathepsin L-like cysteine prot...    47   3e-04   
gb:AK028366_1160949 Mus musculus 18 days pregnant adult female p...    47   3e-04   
sp|P42666|CYSP_PLAVS|CYSP_PLAVS Cysteine proteinase precursor (EC 3.4.22.-)...    47   3e-04   
sp|O70370|CATS_MOUSE|CATS_MOUSE Cathepsin S precursor (EC 3.4.22.27).>gb:MM...    47   3e-04   
gb:AY333299_2528356 Petromyzon marinus isolate Pema-cathepsin ca...    46   4e-04   
gb:AJ719318_2501505 Gallus gallus mRNA for hypothetical protein,...    46   4e-04   
gb:AP001633_1821395 Oryza sativa (japonica cultivar-group) genom...    46   4e-04   
gb:VFU59465_1727200 Vicia faba pre-pro-cysteine proteinase (VFCY...    46   4e-04   
gb:AY161277_1585741 Vicia faba pre-pro cysteine proteinase gene,...    46   4e-04   
gb:AY608441_1340449 Plasmodium vivax isolate PvKOR1 vivapain-1 m...    46   4e-04   
gb:AY333294_1320330 Branchiostoma lanceolatum isolate Brla-beta2...    46   4e-04   
gb:AY333293_1320329 Branchiostoma lanceolatum isolate Brla-beta2...    46   4e-04   
gb:AY333292_1320328 Branchiostoma lanceolatum isolate Brla-beta1...    46   4e-04   
gb:AY277910_1315306 Branchiostoma belcheri tsingtaunese cathepsi...    46   4e-04   
gb:AY273803_1315057 Clonorchis sinensis cysteine proteinase 3 mR...    46   4e-04   
gb:AY207373_1309880 Tenebrio molitor cathepsin L-like cysteine p...    46   4e-04   
gb:AF510856_1278438 Fasciola gigantica cathepsin L2 mRNA, comple...    46   4e-04   
gb:AF271091_1257580 Clonorchis sinensis cysteine protease 3 prec...    46   4e-04   
gb:AF239264_1253906 Fasciola gigantica cathepsin L (cat-L1B) mRN...    46   4e-04   
gb:AF227957_1252867 Boophilus microplus cathepsin L-like protein...    46   4e-04   
pir|S51818|S42882 cysteine proteinase (EC 3.4.22.-) precursor - ...    46   4e-04   
gb:RNCATHL_2134588 Rat mRNA for cathepsin L (EC 3.4.22.15).            46   6e-04   
gb:PHU31094_1700203 Petunia hybrida thiol protease homolog P21 (...    46   6e-04   
gb:LCO580823_1684032 Lotus corniculatus var. japonicus ORF1, ORF...    46   6e-04   
gb:LMFL4766_1388080 Leishmania major Friedlin chromosome 19 cosm...    46   6e-04   
gb:GCRNAC_1385204 G.cydonium mRNA for cathepsin.                       46   6e-04   
gb:AY333295_1320331 Branchiostoma lanceolatum isolate Brla-beta3...    46   6e-04   
sp|P07154|CATL_RAT|CATL_RAT Cathepsin L precursor (EC 3.4.22.15) (Major e...    46   6e-04   
gb:AF456462_2066303 Rattus norvegicus cathepsin M (CtsM) mRNA, c...    45   8e-04   
gb:AY017412_1558849 Nicotiana tabacum NTCP23-like cysteine prote...    45   8e-04   
gb:FHU62288_1385118 Fasciola hepatica secreted cathepsin L 1 (Fh...    45   8e-04   
gb:FHE279092_1385089 Fasciola hepatica partial mRNA for cathepsi...    45   8e-04   
gb:AY821800_1353072 Opisthorchis viverrini cysteine protease mRN...    45   8e-04   
gb:AY533163_1333677 Brugia malayi cathepsin L-like cysteine prot...    45   8e-04   
gb:AY063763_1293662 Plasmodium berghei berghepain-2 mRNA, comple...    45   8e-04   
gb:AF490984_1276287 Fasciola hepatica cathepsin L mRNA, partial ...    45   8e-04   
gb:AB163417_1201957 Brugia malayi mRNA for cahepsin L-like cyste...    45   8e-04   
pir|F84609|F84609 probable cysteine proteinase [imported] - Arab...    45   8e-04   
pir|S47433|S47433 cathepsin L (EC 3.4.22.15) - Norway lobster>gb...    45   8e-04   
pir|S43991|S43991 cathepsin L-like proteinases (EC 3.4.22.-) - l...    45   8e-04   
sp|Q10716|CYS1_MAIZE|CYS1_MAIZE Cysteine proteinase 1 precursor (EC 3.4.22....    45   8e-04   
gb:BC066490_2554378 Danio rerio cathepsin L, a, mRNA (cDNA clone...    45   0.001   
gb:CFU72030_2396822 Choristoneura fumiferana MNPV IE-2 (IE-2) ge...    45   0.001   
gb:AY327402_2328536 Choristoneura fumiferana defective nucleopol...    45   0.001   
gb:LCO580823_1684031 Lotus corniculatus var. japonicus ORF1, ORF...    45   0.001   
gb:BT021022_1436380 Bos taurus cathepsin L2 (CTSL2), mRNA, compl...    45   0.001   
gb:AB099005_1410328 Bos taurus mRNA for similar to preprocatheps...    45   0.001   
gb:AB017645S4_1407910 Bos taurus gene for preprocathepsin L, exo...    45   0.001   
gb:AY336797_1320738 Rhipicephalus haemaphysaloides haemaphysaloi...    45   0.001   
gb:AY332271_1320243 Tenebrio molitor cathepsin-L-like cysteine p...    45   0.001   
gb:AY332270_1320242 Tenebrio molitor cathepsin-L-like cysteine p...    45   0.001   
gb:AF112566_1242101 Fasciola gigantica cathepsin (cat-L1) mRNA, ...    45   0.001   
gb:AF036251_1234872 Babesia equi cysteine protease (cys1) gene, ...    45   0.001   


>gb:AY171099_1586735 Gossypium hirsutum cysteine protease mRNA,
           complete cds.
          Length = 389

 Score =  135 bits (339), Expect = 7e-31
 Identities = 72/158 (45%), Positives = 99/158 (62%)
 Frame = +1

Query: 154 GFLVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYE 333
           GFL FLI+A++     S   +           + EE+VL +F++WKE++ KVYR  EE E
Sbjct: 9   GFL-FLILASLTSLSSSLPSEYSIVEHEIDAFLSEERVLEIFQQWKEKHRKVYRHAEEAE 67

Query: 334 ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI 513
           +RF+NFKGNLKY+ E+    + ++WE  VGLNKFAD+ NEEF+  + SK+K P  K  GI
Sbjct: 68  KRFENFKGNLKYILERNAKRKANKWEHHVGLNKFADMSNEEFRKAYLSKVKKPINK--GI 125

Query: 514 QMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
            +     S   ++K  SC+AP S+DWR  G VT VKDQ
Sbjct: 126 TL-----SRNMRRKVQSCDAPSSLDWRNYGVVTAVKDQ 158



>gb:AF182079_1774901 Matricaria chamomilla thiol protease (ctp)
           mRNA, complete cds.
          Length = 501

 Score = 99.8 bits (247), Expect = 3e-20
 Identities = 57/125 (45%), Positives = 76/125 (60%), Gaps = 3/125 (2%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           KV  LF +WKE +GK Y+ EEE   R +NFK ++K+V EK    R S  +  VGLNKFAD
Sbjct: 45  KVSDLFGKWKELHGKTYQHEEEENLRLENFKKSVKFVMEKN-SERKSELDHTVGLNKFAD 103

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVS---CEAPFSVDWRKRGAVT 612
           L NEEFK+++ SK+K       G +       G ++   VS   C+AP S+DWR +G VT
Sbjct: 104 LSNEEFKEMYMSKVK-------GSRSNELKMGGVKRNMSVSSRTCDAPTSLDWRDKGVVT 156

Query: 613 RVKDQ 627
            +KDQ
Sbjct: 157 PMKDQ 161



>gb:AY251054_1592748 Anthurium andraeanum cysteine protease mRNA,
           complete cds.
          Length = 502

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 1/119 (0%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK-VGLNKFADLRN 450
           LFE W E++ KVY    E   R+ NF  NL +V+++   GR +   G+ VG+N FADL N
Sbjct: 50  LFERWMEKHRKVYAHPGEKARRYANFLSNLAFVRKRNAEGRRAPSSGQGVGMNVFADLSN 109

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EEF++V++S++     +K+  +   A +   E +    C+AP S+DWRKRGAVT VK+Q
Sbjct: 110 EEFREVYSSRVL----RKKAAEGRGARRRAGEGRVVAGCDAPASLDWRKRGAVTAVKNQ 164



>gb:AB098629_1526119 Daucus carota DcCysP6 mRNA for cysteine
           protease, complete cds.
          Length = 496

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 58/126 (46%), Positives = 74/126 (58%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKT-VGGRGSRWEGKVGLNK 432
           +++   LFE W   +GK Y    E E+RFQ FK NL+Y+ E+  V  RG     K+GLNK
Sbjct: 38  DDEATTLFESWLVTHGKSYNALGEEEKRFQIFKNNLRYIDEQNLVEDRGF----KLGLNK 93

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAV 609
           FADL NEE++  +T       RKK     VSA +SGR     +S E+ P SVDWR+ GAV
Sbjct: 94  FADLTNEEYRSKYTGIKSKDLRKK-----VSA-KSGR--YATLSGESLPESVDWRESGAV 145

Query: 610 TRVKDQ 627
             VKDQ
Sbjct: 146 ATVKDQ 151



>gb:OSJN00105_1694997 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0059K02, complete sequence.
          Length = 458

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 44/124 (35%), Positives = 63/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct: 33  EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF 92

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++D +      P R+++      A  +            P SVDWR +GAV  
Sbjct: 93  ADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNE---------ALPESVDWRTKGAVAE 143

Query: 616 VKDQ 627
           +KDQ
Sbjct: 144 IKDQ 147



>sp|P25776|ORYA_ORYSA Oryzain alpha chain precursor (EC
           3.4.22.-).>pir|JU0388|KHRZOA oryzain (EC 3.4.22.-) alpha
           precursor - rice>gb:RICOZA_1703709 Oryza sativa
           (japonica cultivar-group) mRNA for oryzain alpha,
           complete cds.
          Length = 458

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 44/124 (35%), Positives = 63/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct: 33  EEEARRLYAEWKAEHGKSYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF 92

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++D +      P R+++      A  +            P SVDWR +GAV  
Sbjct: 93  ADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNE---------ALPESVDWRTKGAVAE 143

Query: 616 VKDQ 627
           +KDQ
Sbjct: 144 IKDQ 147



>gb:AF259983_1781462 Ipomoea batatas putative cysteine protease
           mRNA, complete cds.
          Length = 462

 Score = 82.0 bits (201), Expect = 7e-15
 Identities = 47/125 (37%), Positives = 70/125 (56%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRD-EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           +E+V+ L+E W   +GK Y     E ++RF+ FK NL+Y+ E+    RG R   K+GLN+
Sbjct: 42  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQN--SRGDR-SYKLGLNR 98

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FADL NEE++  +         K    + ++  +S R    K     P S+DWR++GAV 
Sbjct: 99  FADLTNEEYRSTYLGA------KTDARRRIAKTKSDRRYAPKAGGSLPDSIDWREKGAVA 152

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 153 EVKDQ 157



>gb:H0212B02_1681314 Oryza sativa genomic DNA, chromosome 4, BAC
           clone:H0212B02, complete sequence.
          Length = 461

 Score = 82.0 bits (201), Expect = 7e-15
 Identities = 44/124 (35%), Positives = 63/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE+  RL+ EWK  +GK Y    E E R+  F+ NL+Y+ E            ++GLN+F
Sbjct: 33  EEEARRLYAEWKAEHGKNYNAVGEEERRYAAFRDNLRYIDEHNAAADAGVHSFRLGLNRF 92

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++D +      P R+++      A  +            P SVDWR +GAV  
Sbjct: 93  ADLTNEEYRDTYLGLRNKPRRERKVSDRYLAADNE---------ALPESVDWRTKGAVAE 143

Query: 616 VKDQ 627
           +KDQ
Sbjct: 144 IKDQ 147



>gb:AB177386_1528888 Dianthus caryophyllus DC-CP2 mRNA for cysteine
           proteinase, complete cds.
          Length = 459

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P++++  L+E W  ++GK Y    E + RF  FK NL++V E+           K+GLN+
Sbjct: 35  PDDEIASLYETWLVKHGKNYNGLGEKQLRFNIFKDNLRFVDER----NSENLSFKLGLNR 90

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA----PFSVDWRKR 600
           FADL NEE++ V+              + V+  +SGR K  + +  A    P SVDWRK+
Sbjct: 91  FADLTNEEYRSVYLGTRP---------RSVAVARSGRSKSDRYAFRAGDTLPESVDWRKK 141

Query: 601 GAVTRVKDQ 627
           GAV  +KDQ
Sbjct: 142 GAVAGIKDQ 150



>gb:AB109190_1526795 Helianthus annuus scp5 mRNA for cysteine
           protease-5, complete cds.
          Length = 365

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 48/127 (37%), Positives = 71/127 (55%), Gaps = 3/127 (2%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+V   +E W  R+GK Y    E E RF+ F  NLK++ E  + G  S    KVGLN+F
Sbjct: 29  DEEVRNTYELWLARHGKTYNALGEKESRFRIFADNLKFIDEHNLSGNRSY---KVGLNQF 85

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE---APFSVDWRKRGA 606
           ADL NEE++ ++      P+R+      ++ +Q G   ++    E    P  VDWR+RGA
Sbjct: 86  ADLTNEEYRSMYLGTKVDPYRR------IAKMQRGEISRRYAVQENEMFPAKVDWRERGA 139

Query: 607 VTRVKDQ 627
           V+ VK+Q
Sbjct: 140 VSPVKNQ 146



>gb:AY348863_1601426 Glycine max 34 kDa maturing seed vacuolar thiol
           protease precursor, mRNA, partial cds.
          Length = 165

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct: 37  QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G +T
Sbjct: 96  ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGVIT 148

Query: 613 RVKDQ 627
           +VK Q
Sbjct: 149 QVKYQ 153



>gb:AB013289_1512004 Glycine max gene for Bd 30K, complete cds.
          Length = 379

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 46/125 (36%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  LF+ WK  +G+VY + EE  +R + FK NL Y+++     R S    ++GLNKF
Sbjct: 37  QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNLNYIRDMN-ANRKSPHSHRLGLNKF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G +T
Sbjct: 96  ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGVIT 148

Query: 613 RVKDQ 627
           +VK Q
Sbjct: 149 QVKYQ 153



>gb:AY192361_1588666 Trifolium repens cysteine protease 14 mRNA,
           complete cds.
          Length = 351

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 48/124 (38%), Positives = 72/124 (58%), Gaps = 1/124 (0%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           +K++ LFE W  R+GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+FA
Sbjct: 41  DKLIELFESWMSRHGKIYETIEEKLLRFEVFKDNLKHIDERN-KIVSNYW---LGLNEFA 96

Query: 439 DLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           DL ++EFK+ +   K+ +  R++          S  E+      + P SVDWRK+GAVT 
Sbjct: 97  DLSHQEFKNKYLGLKVNLSQRRE---------SSNEEEFTYRDVDLPKSVDWRKKGAVTP 147

Query: 616 VKDQ 627
           VK+Q
Sbjct: 148 VKNQ 151



>gb:SOYP34A_1716071 Glycine max 34 kDa maturing seed vacuolar thiol
           protease mRNA, complete cds.
          Length = 379

 Score = 78.6 bits (192), Expect = 8e-14
 Identities = 45/125 (36%), Positives = 73/125 (58%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLNKF
Sbjct: 37  QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMN-ANRKSPHSHRLGLNKF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G +T
Sbjct: 96  ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGVIT 148

Query: 613 RVKDQ 627
           +VK Q
Sbjct: 149 QVKYQ 153



>sp|P22895|P34_SOYBN P34 probable thiol protease precursor (EC
           3.4.22.-).>pir|A37126|KHSYO4 oil bodies-associated
           protein P34 precursor - soybean
          Length = 379

 Score = 78.6 bits (192), Expect = 8e-14
 Identities = 45/125 (36%), Positives = 73/125 (58%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  LF+ WK  +G+VY + EE  +R + FK N  Y+++     R S    ++GLNKF
Sbjct: 37  QKQVSSLFQLWKSEHGRVYHNHEEEAKRLEIFKNNSNYIRDMN-ANRKSPHSHRLGLNKF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           AD+  +EF   +   ++ P    Q I+M +     + KK++ SC+  P S DWRK+G +T
Sbjct: 96  ADITPQEFSKKY---LQAPKDVSQQIKMANK----KMKKEQYSCDHPPASWDWRKKGVIT 148

Query: 613 RVKDQ 627
           +VK Q
Sbjct: 149 QVKYQ 153



>gb:AP004047_1836874 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1191_G08.
          Length = 366

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 49/157 (31%), Positives = 79/157 (50%), Gaps = 1/157 (0%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEER 339
           ++FL++  V C   + ++D               K++ LF  W  ++ K+Y   +E  +R
Sbjct: 16  MLFLLLGFVACSATASHHDPSVVGYSQEDLALPNKLVGLFTSWSVKHSKIYASPKEKVKR 75

Query: 340 FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM 519
           ++ FK NL+++ E T    GS W   +GLN FAD+ +EEFK  +          K G+  
Sbjct: 76  YEIFKRNLRHIVE-TNRRNGSYW---LGLNHFADIAHEEFKASYLG-------LKPGLAR 124

Query: 520 VSAVQSGREKKKKVSC-EAPFSVDWRKRGAVTRVKDQ 627
             A   G    +  +    P++VDWRK+GAVT VK+Q
Sbjct: 125 RDAQPHGSTTFRYANAVNLPWAVDWRKKGAVTPVKNQ 161



>gb:AY192360_1588665 Trifolium repens cysteine protease 14 gene,
           complete cds.
          Length = 351

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 49/126 (38%), Positives = 73/126 (57%), Gaps = 3/126 (2%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYV--KEKTVGGRGSRWEGKVGLNK 432
           +K++ LFE W  R+GK+Y   EE   RF+ FK NLK++  + K V    + W   +GLN+
Sbjct: 41  DKLIELFESWMSRHGKIYETIEEKLLRFEVFKDNLKHIDDRNKIV---SNYW---LGLNE 94

Query: 433 FADLRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           FADL ++EFK+ +   K+ +  R++          S  E+      + P SVDWRK+GAV
Sbjct: 95  FADLSHQEFKNKYLGLKVDLSQRRE---------SSNEEEFTYRDVDLPKSVDWRKKGAV 145

Query: 610 TRVKDQ 627
           T VK+Q
Sbjct: 146 TPVKNQ 151



>gb:AB109186_1526791 Helianthus annuus scp1 mRNA for cysteine
           protease-1, complete cds.
          Length = 461

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 48/124 (38%), Positives = 70/124 (56%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  L+E W  ++GK Y    E + RFQ FK NL+++ E   G        K+GLNKF
Sbjct: 45  DDEVNALYESWLVKHGKTYNALGEKDRRFQIFKDNLRFIDEHNSGDH----TYKLGLNKF 100

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  +T    +  +KK     +S ++S R   +      P  VDWR++GAVT 
Sbjct: 101 ADLTNEEYRMTYTGIKTIDDKKK-----LSKMKSDRYAYRS-GDSLPEYVDWREQGAVTD 154

Query: 616 VKDQ 627
           VKDQ
Sbjct: 155 VKDQ 158



>pir|T06122|T06122 cysteine proteinase (EC 3.4.22.-) F23E12.90 -
           Arabidopsis thaliana>gb:ATCHRIV83_1547496 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           83.>gb:ATF23E12_1549726 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E12 (ESSA
           project).>gb:BT005179_1638125 Arabidopsis thaliana clone
           U50467 unknown protein (At4g35350) mRNA, complete
           cds.>gb:AF191027_1775461 Arabidopsis thaliana
           papain-type cysteine endopeptidase XCP1 mRNA, complete
           cds.>gb:AK117394_1815432 Arabidopsis thaliana At4g35350
           mRNA for putative cysteine proteinase, complete cds,
           clone: RAFL16-98-B02.
          Length = 355

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 46/123 (37%), Positives = 66/123 (53%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           +K+L LFE W   + K Y+  EE   RF+ F+ NL ++ ++      S W   +GLN+FA
Sbjct: 45  DKLLELFESWMSEHSKAYKSVEEKVHRFEVFRENLMHIDQRN-NEINSYW---LGLNEFA 100

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEFK  +    K  F +K+        Q     + +   + P SVDWRK+GAV  V
Sbjct: 101 DLTHEEFKGRYLGLAKPQFSRKR--------QPSANFRYRDITDLPKSVDWRKKGAVAPV 152

Query: 619 KDQ 627
           KDQ
Sbjct: 153 KDQ 155



>gb:AB098630_1526120 Daucus carota DcCysP7 mRNA for cysteine
           protease, complete cds.
          Length = 361

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 56/167 (33%), Positives = 78/167 (46%), Gaps = 4/167 (2%)
 Frame = +1

Query: 139 SLQGCGFLVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRD 318
           S     F  F+I A +  G  +C              +PE  +    E+W  + G+VY+D
Sbjct: 19  STTNMAFKHFMIAALILLGAWACQ--------ATSRTLPEASMFERHEQWMIQYGRVYKD 70

Query: 319 EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR 498
           E E   RFQ F  N+K+++E    GR S    K+ +N+FAD  NEEF+            
Sbjct: 71  EAEKSVRFQIFMDNVKFIEEFNKDGRQSY---KLAVNEFADQTNEEFQ-----------A 116

Query: 499 KKQGIQMVSAVQSGREKKKKVSCE----APFSVDWRKRGAVTRVKDQ 627
            + G +M  AV S   +      E     P S+DWRK+GAVT VKDQ
Sbjct: 117 SRNGYKM--AVSSRPSQTTLFRYENVTAVPSSMDWRKKGAVTPVKDQ 161



>gb:AB109189_1526794 Helianthus annuus scp4 mRNA for cysteine
           protease-4, complete cds.
          Length = 352

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 55/158 (34%), Positives = 82/158 (51%), Gaps = 1/158 (0%)
 Frame = +1

Query: 157 FLVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEE 336
           FLVF+ V A  C  ++  +            +   KV+ LFE W  ++ K+Y   +E   
Sbjct: 13  FLVFVSVLA--CSALANEFSILGYAPEDLTSI--HKVIHLFESWLAKHSKIYESLDEKLH 68

Query: 337 RFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGI 513
           RF+ F  NLK++ + T     + W   +GLN+FADL +EEFK+ F   K ++P RK + I
Sbjct: 69  RFEIFMDNLKHI-DDTNKKVSNYW---LGLNEFADLTHEEFKNKFLGLKGELPERKDESI 124

Query: 514 QMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +         E   +   + P SVDWRK+GAV  VK+Q
Sbjct: 125 E---------EFSYRDFVDLPKSVDWRKKGAVAPVKNQ 153



>pir|S51817|S47312 cysteine proteinase (EC 3.4.22.-) precursor -
           spring vetch>gb:VSCYSPRO_1727385 V.sativa L. mRNA for
           cysteine protease.
          Length = 368

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 46/126 (36%), Positives = 67/126 (53%), Gaps = 3/126 (2%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++V+ ++EEW  ++ KVY    E ++RFQ FK NL ++ E         +   VGLNKFA
Sbjct: 33  DEVMTMYEEWLVKHQKVYNGLREKDQRFQIFKDNLNFIDEH----NAQNYTYIVGLNKFA 88

Query: 439 DLRNEEFKDVF---TSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           D+ NEE++D++    S IK    K +      A  SG           P  VDWR +GA+
Sbjct: 89  DMTNEEYRDMYLGTRSDIKRRIMKNKITGHRYAYNSGD--------RLPVHVDWRLKGAI 140

Query: 610 TRVKDQ 627
           T +KDQ
Sbjct: 141 THIKDQ 146



>gb:AF454958_1801126 Brassica oleracea senescence-associated
           cysteine protease (CP3) mRNA, complete cds.
          Length = 485

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 45/125 (36%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           + +V RL+EEW  ++GK      E + RF+ FK NL+++ E      G     ++GL KF
Sbjct: 41  DAEVSRLYEEWLVKHGKAQNSLTEKDRRFEIFKDNLRFIDEH----NGKNLSYRLGLTKF 96

Query: 436 ADLRNEEFKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           ADL N+E++ ++  S++K             A +S    + +V    P SVDWRK GAV 
Sbjct: 97  ADLTNDEYRSMYLGSRLKR-----------KATKSSLRYEVRVGDAIPESVDWRKEGAVA 145

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 146 EVKDQ 150



>pir|S24602|S24602 cysteine proteinase tpp (EC 3.4.22.-) - garden
           pea>gb:PSTHIOL_1702422 P.sativum mRNA for thiolprotease.
          Length = 464

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 47/123 (38%), Positives = 68/123 (55%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++VL ++EEW  ++GK Y    E E+RF+ FK NL ++ E            ++GLN+FA
Sbjct: 41  DQVLTMYEEWLVKHGKNYNALGEKEKRFEIFKDNLGFIDEH----NSKNLSFRLGLNRFA 96

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL NEE++  F      P R+ + +      Q+ R    +V  + P SVDWRK GAV  V
Sbjct: 97  DLTNEEYRTRFLGTRINPNRRNRKVNS----QTNR-YATRVGDKLPESVDWRKEGAVVGV 151

Query: 619 KDQ 627
           KDQ
Sbjct: 152 KDQ 154



>pir|T12041|T12041 cysteine proteinase (EC 3.4.22.-) 3 precursor -
           kidney bean>gb:PVZ99954_1703078 Phaseolus vulgaris
           Moldavian encoding cysteine proteinase precursor (clone
           cp71).
          Length = 455

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 48/124 (38%), Positives = 69/124 (55%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+V  L+EEW  ++GK+Y    E ++RFQ FK NL+++ ++    R      K+GLN+F
Sbjct: 33  DEEVNSLYEEWLVKHGKLYNALGEKDKRFQIFKDNLRFIDQQNAENR----TYKLGLNRF 88

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  +      P R+      +    S R    +V    P SVDWRK GAV  
Sbjct: 89  ADLTNEEYRARYLGTKIDPNRR------LGRTPSNR-YAPRVGETLPDSVDWRKEGAVVP 141

Query: 616 VKDQ 627
           VKDQ
Sbjct: 142 VKDQ 145



>sp|P00784|PAPA_CARPA Papain precursor (EC 3.4.22.2) (Papaya
           proteinase I) (PPI).>pir|A26466|PPPA papain (EC
           3.4.22.2) precursor - papaya>gb:CPAPAP_1648545 Carica
           papaya papain mRNA, complete cds.>gb:SYNPAPAIN_2153514
           Synthetic papain gene, complete cds.
          Length = 345

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 46/123 (37%), Positives = 68/123 (55%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LFE W  ++ K+Y++ +E   RF+ FK NLKY+ E T     S W   +GLN FA
Sbjct: 42  ERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDE-TNKKNNSYW---LGLNVFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           D+ N+EFK+ +T  I   +         +   S  E         P  VDWR++GAVT V
Sbjct: 98  DMSNDEFKEKYTGSIAGNY--------TTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPV 149

Query: 619 KDQ 627
           K+Q
Sbjct: 150 KNQ 152



>gb:AJ606073_1811951 Gossypium hirsutum mRNA for cysteine proteinase
           (cys1 gene), strain Xuzhou 142.
          Length = 372

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 46/124 (37%), Positives = 69/124 (55%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V+ L++ W  ++GK Y    E E+RF+ FK NL+++ E       +    K+GLNKF
Sbjct: 39  DDEVMGLYKSWVIQHGKAYNGIGEEEKRFEIFKDNLRFIDEHNSNNNTTY---KLGLNKF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL N+E++  F      P R+     M S + S R    +     P SV+WR  GAV+R
Sbjct: 96  ADLTNQEYRAKFLGTRTDPRRR----LMKSKIPSSR-YAHRAGDNLPDSVNWRDHGAVSR 150

Query: 616 VKDQ 627
           VKDQ
Sbjct: 151 VKDQ 154



>gb:AY017413_1558850 Nicotiana tabacum CPR1-like cysteine proteinase
           gene, complete cds.
          Length = 374

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 44/124 (35%), Positives = 69/124 (55%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E++V   +E W   +G+ Y    E E+RF+ FK NL++++E    G  +    KVGLN+F
Sbjct: 43  EDQVKNRYEMWLAEHGRAYNALGEKEKRFEIFKDNLRFIEEHNNSGNRTY---KVGLNQF 99

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++ ++    K   R++     V +    +    + +   P SVDWRKRGAV  
Sbjct: 100 ADLTNEEYRTMYLG-TKSDARRR----FVKSKNPSQRYASRPNELMPHSVDWRKRGAVAP 154

Query: 616 VKDQ 627
           +K+Q
Sbjct: 155 IKNQ 158



>gb:AB040454_1519513 Astragalus sinicus cysteine proteinase mRNA for
           cysteine proteinase, complete cds.
          Length = 343

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 44/116 (37%), Positives = 68/116 (58%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           ++W  +  K+Y D +E+E+RFQ FK N+ Y+  +T    G R+  K+G+N+F DL NEEF
Sbjct: 40  QQWMGQYAKIYNDHQEWEKRFQIFKENVNYI--ETSNKEGGRFY-KLGVNQFVDLTNEEF 96

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                     P  + +G    S +++   K + V+   P +VDWR++GAVT VKDQ
Sbjct: 97  --------IAPRNRFKGHMCSSIIRTNTYKYENVT-TVPSNVDWRQKGAVTPVKDQ 143



>sp|P05994|PAP4_CARPA Papaya proteinase IV precursor (EC 3.4.22.25)
           (PPIV) (Papaya peptidase B) (Glycyl
           endopeptidase).>pir|T09798|T09798 glycyl endopeptidase
           (EC 3.4.22.25) - papaya>gb:CPPIVM_1648683 C.papaya
           proteinase IV mRNA.
          Length = 348

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 51/160 (31%), Positives = 76/160 (47%), Gaps = 1/160 (0%)
 Frame = +1

Query: 151 CGFLVFLIVAAVWCGGVSCYY-DXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEE 327
           C F   L VA    G +S  Y D              E++++LF  W  ++ K Y++ +E
Sbjct: 5   CSFSKLLFVAICLFGHMSLSYCDFSIVGYSQDDLTSTERLIQLFNSWMLKHNKNYKNVDE 64

Query: 328 YEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQ 507
              RF+ FK NLKY+ E+     G  W   +GLN+F+DL N+EFK+ +   +   +  + 
Sbjct: 65  KLYRFEIFKDNLKYIDERNKMING-YW---LGLNEFSDLSNDEFKEKYVGSLPEDYTNQ- 119

Query: 508 GIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                       E   +   + P SVDWR +GAVT VK Q
Sbjct: 120 --------PYDEEFVNEDIVDLPESVDWRAKGAVTPVKHQ 151



>gb:AY192363_1588668 Trifolium repens cysteine protease 5 gene,
           complete cds.
          Length = 343

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 45/124 (36%), Positives = 69/124 (55%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ +    E+W    GKVY++ +E E+R + F  NLKY++     G    +  K+G+N+F
Sbjct: 32  DDSIFERHEQWMTHYGKVYKNPQEREKRLRIFTENLKYIEASNNAGNNKPY--KLGINQF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEEF     S+      K +G    S +++   K +  S   P +VDWRK+GAVT 
Sbjct: 90  ADLTNEEF---IASR-----NKFKGHMCSSIIRTTTFKYENTS--VPSTVDWRKKGAVTP 139

Query: 616 VKDQ 627
           VK+Q
Sbjct: 140 VKNQ 143



>gb:AB098631_1526121 Daucus carota DcCysP8 mRNA for cysteine
           protease, complete cds.
          Length = 460

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 46/125 (36%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++  +E W  ++GK Y    E E+RFQ FK N  Y+ E+      S    K+GLN+F
Sbjct: 37  DDVIMAAYESWLVKHGKSYNALGEKEQRFQIFKDNFLYIDEQNAAKDRS---FKLGLNRF 93

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVT 612
           ADL NEE++  +T       RKK        V    ++   ++ E+ P SVDWR+ GAV 
Sbjct: 94  ADLTNEEYRSKYTGIRTKDSRKK--------VSGKSQRYASLAGESLPESVDWREHGAVA 145

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 146 SVKDQ 150



>pir|T06416|T06416 cysteine proteinase (EC 3.4.22.-) precursor -
           tomato>gb:LEAJ3137_1684222 Lycopersicon esculentum mRNA
           for cysteine protease CYP1, complete
           CDS.>gb:AF172856_1774434 Lycopersicon esculentum
           cysteine protease TDI-65 (tdi-65) mRNA, complete cds.
          Length = 466

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 47/124 (37%), Positives = 68/124 (54%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  L+E W   +GK Y    E ++RFQ FK NL+Y+ E+      S    K+GL KF
Sbjct: 42  DDEVSALYESWLIEHGKSYNALGEKDKRFQIFKDNLRYIDEQNSVPNQSY---KLGLTKF 98

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++ ++        RKK     +S  +S R    KV    P S+DWR++G +  
Sbjct: 99  ADLTNEEYRSIYLGTKSSGDRKK-----LSKNKSDR-YLPKVGDSLPESIDWREKGVLVG 152

Query: 616 VKDQ 627
           VKDQ
Sbjct: 153 VKDQ 156



>gb:STU245924_1723006 Solanum tuberosum mRNA for cysteine protease
           (cyp gene).
          Length = 466

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 48/124 (38%), Positives = 67/124 (54%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V  L+E W   +GK Y    E ++RFQ FK NLKY+ E+      S    K+GL KF
Sbjct: 42  DDEVSALYESWLIEHGKSYNALGEKDKRFQIFKDNLKYIDEQNSVPNQSY---KLGLTKF 98

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++ ++        R+K     +S  +S R    KV    P SVDWR +G +  
Sbjct: 99  ADLTNEEYRSIYLGTKSSGDRRK-----LSKNKSDR-YLPKVGDSLPESVDWRDKGVLVG 152

Query: 616 VKDQ 627
           VKDQ
Sbjct: 153 VKDQ 156



>gb:AY192366_1588671 Trifolium repens cysteine protease 12 gene,
           complete cds.
          Length = 343

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 45/124 (36%), Positives = 70/124 (56%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ +    E+W    GKVY++ +E E+R + F  NLKY++       G++   K+G+N+F
Sbjct: 32  DDSIFERHEQWMTHYGKVYKNPQEREKRLRIFTENLKYIEAS--NNAGNKKPYKLGINQF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEEF     S+      K +G    S +++   K +  S   P +VDWRK+GAVT 
Sbjct: 90  ADLTNEEF---IASR-----NKFKGHMCSSIIRTTTFKYENTS--VPSTVDWRKKGAVTP 139

Query: 616 VKDQ 627
           VK+Q
Sbjct: 140 VKNQ 143



>gb:AB091070_1524989 Zinnia elegans ZCP4 mRNA for cysteine
           proteinase, complete cds.
          Length = 352

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 53/157 (33%), Positives = 79/157 (50%), Gaps = 1/157 (0%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEER 339
           L+FL V+ + C  ++  +            +   KV+ LFE W  ++ K Y   +E   R
Sbjct: 12  LLFLFVSILACSALAHEFSILGYAPEDLTSI--HKVIHLFESWLVKHSKFYESLDEKLHR 69

Query: 340 FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTS-KIKMPFRKKQGIQ 516
           F+ F  NLK++ E T     + W   +GLN+FADL +EEFK  F   K ++  RK     
Sbjct: 70  FEIFMDNLKHIDE-TNKKVSNYW---LGLNEFADLTHEEFKHKFLGFKGELAERKD---- 121

Query: 517 MVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                +S +E   +   + P SVDWRK+GAV  VK+Q
Sbjct: 122 -----ESSKEFGYRDFVDLPKSVDWRKKGAVAPVKNQ 153



>gb:AB020961_1514764 Zea mays mRNA for cysteine protease component
           of protease-inhibitor complex, complete cds.
          Length = 465

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+  R++ EW   +G+ Y    E E R+Q F+ NL+Y+              ++GLN+F
Sbjct: 37  DEEARRMYAEWMAAHGRTYNAVGEEERRYQVFRDNLRYIDAHNAAADAGVHSFRLGLNRF 96

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL N+E++  +      P R++         + G       + + P SVDWR +GAV  
Sbjct: 97  ADLTNDEYRATYLGARTRPQRER---------KLGARYHAADNEDLPESVDWRAKGAVAE 147

Query: 616 VKDQ 627
           VKDQ
Sbjct: 148 VKDQ 151



>gb:AY336982_1600287 Medicago truncatula putative cysteine
           proteinase mRNA, complete cds.
          Length = 345

 Score = 73.2 bits (178), Expect = 3e-12
 Identities = 44/116 (37%), Positives = 63/116 (54%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E+W    GKVY+D +E E R + FK N+ Y++     G    +  K+G+N+FADL NEEF
Sbjct: 42  EQWMVHYGKVYKDLQERENRLKIFKENVNYIEASNNAGNNKLY--KLGINQFADLTNEEF 99

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                    +  R K    M S++      K + +   P +VDWRK+GAVT VK+Q
Sbjct: 100 ---------IASRNKFKGHMCSSITKTSTFKYE-NASVPSTVDWRKKGAVTPVKNQ 145



>pir|JC4848|JC4848 cysteine proteinase (EC 3.4.22.-) - Douglas
           fir>gb:PMU41902_1700823 Pseudosuga menziesii cysteine
           protease pseudotzain (PM33cysP) mRNA, complete cds.
          Length = 454

 Score = 73.2 bits (178), Expect = 3e-12
 Identities = 48/156 (30%), Positives = 80/156 (51%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEER 339
           L+F ++A     G +   D           + ++ ++ L+E W  ++ K Y   +E +++
Sbjct: 5   LLFAVLALSAMAGSASRADFSIISYDSQDLIGDDAIMELYELWLAQHKKAYNGLDEKQKK 64

Query: 340 FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM 519
           F  FK N  Y+ +    G  S    K+GLN+FADL +EEFK  +    K+  +K+     
Sbjct: 65  FSVFKDNFLYIHQHNNQGNPSY---KLGLNQFADLSHEEFKAAYLG-TKLDAKKR----- 115

Query: 520 VSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +S   S R  +  V  + P S+DWR++GAVT VK+Q
Sbjct: 116 LSRSPSPR-YQYSVGEDLPESIDWREKGAVTAVKNQ 150



>gb:AF388175_1794932 Arabidopsis thaliana papain-like cysteine
           peptidase XBCP3 mRNA, complete cds.
          Length = 437

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 42/123 (34%), Positives = 67/123 (54%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           + +  LF++W +++GK Y  EEE ++R Q FK N  +V +  +    +     + LN FA
Sbjct: 26  DDISELFDDWCQKHGKTYGSEEERQQRIQIFKDNHDFVTQHNLITNATY---SLSLNAFA 82

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL + EFK    S++ +       +   S + + + +    S + P SVDWRK+GAVT V
Sbjct: 83  DLTHHEFK---ASRLGL------SVSAPSVIMASKGQSLGGSVKVPDSVDWRKKGAVTNV 133

Query: 619 KDQ 627
           KDQ
Sbjct: 134 KDQ 136



>gb:AC069251_1540748 Genomic sequence for Arabidopsis thaliana BAC
           F2D10 from chromosome I, complete sequence.
          Length = 315

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 50/123 (40%), Positives = 64/123 (52%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           +K++ LFE W     K Y   EE   RF+ FK NLK++ E    G+ S W   +GLN+FA
Sbjct: 45  DKLIELFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDETNKKGK-SYW---LGLNEFA 100

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEFK       KM    K  I      +S  E   +     P SVDWRK+GAV  V
Sbjct: 101 DLSHEEFK-------KMYLGLKTDIVRRDEERSYAEFAYRDVEAVPKSVDWRKKGAVAEV 153

Query: 619 KDQ 627
           K+Q
Sbjct: 154 KNQ 156



>pir|G86232|G86232 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_889990 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F21M12_1677863 Sequence of BAC F21M12 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 416

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 42/123 (34%), Positives = 67/123 (54%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           + +  LF++W +++GK Y  EEE ++R Q FK N  +V +  +    +     + LN FA
Sbjct: 24  DDISELFDDWCQKHGKTYGSEEERQQRIQIFKDNHDFVTQHNLITNATY---SLSLNAFA 80

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL + EFK    S++ +       +   S + + + +    S + P SVDWRK+GAVT V
Sbjct: 81  DLTHHEFK---ASRLGL------SVSAPSVIMASKGQSLGGSVKVPDSVDWRKKGAVTNV 131

Query: 619 KDQ 627
           KDQ
Sbjct: 132 KDQ 134



>pir|A86341|A86341 cysteine proteinase (EC 3.4.22.-) [similarity] -
           Arabidopsis thaliana>gb:AE005172_891044 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC007369_1535817 Arabidopsis thaliana
           chromosome I BAC F9H16 genomic sequence, complete
           sequence.>gb:BT004822_1637856 Arabidopsis thaliana
           At1g20850 gene, complete cds.>gb:AF191028_1775462
           Arabidopsis thaliana papain-type cysteine endopeptidase
           XCP2 mRNA, complete cds.
          Length = 356

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 50/123 (40%), Positives = 64/123 (52%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           +K++ LFE W     K Y   EE   RF+ FK NLK++ E    G+ S W   +GLN+FA
Sbjct: 45  DKLIELFENWISNFEKAYETVEEKFLRFEVFKDNLKHIDETNKKGK-SYW---LGLNEFA 100

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEFK       KM    K  I      +S  E   +     P SVDWRK+GAV  V
Sbjct: 101 DLSHEEFK-------KMYLGLKTDIVRRDEERSYAEFAYRDVEAVPKSVDWRKKGAVAEV 153

Query: 619 KDQ 627
           K+Q
Sbjct: 154 KNQ 156



>pir|T03941|T03941 cysteine proteinase (EC 3.4.22.-) precursor -
           common tobacco>gb:NTCYSTPRO_1691532 Nicotiana tabacum
           mRNA for cysteine proteinase precursor.
          Length = 374

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 43/124 (34%), Positives = 68/124 (54%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E++V   +E W   +G+ Y    E E+RF+ FK NL++++     G  +    KVGLN+F
Sbjct: 43  EDQVKNRYEMWLAEHGRAYNALGEKEKRFEIFKDNLRFIEGHNNSGNRTY---KVGLNQF 99

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++ ++    K   R++     V +    +    + +   P SVDWRKRGAV  
Sbjct: 100 ADLTNEEYRTMYLG-TKSDARRR----FVKSKNPSQRYASRPNELMPHSVDWRKRGAVAP 154

Query: 616 VKDQ 627
           +K+Q
Sbjct: 155 IKNQ 158



>gb:AP003277_1827059 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0518C01.
          Length = 365

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 48/156 (30%), Positives = 74/156 (47%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEER 339
           LV L++    C  V+   +              E+++ LFE++  +  K Y   EE   R
Sbjct: 13  LVLLLLCGGACVAVAMPSELSIVGYSEEDLASHERLMELFEKFMAKYRKAYSSLEEKLRR 72

Query: 340 FQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQM 519
           F+ FK NL ++ E+     G  W   +GLN+FADL ++EFK  +      P R+    Q+
Sbjct: 73  FEVFKDNLNHIDEENKKITG-YW---LGLNEFADLTHDEFKAAYLGLTLTPARRNSNDQL 128

Query: 520 VSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                     ++  +   P  VDWRK+GAVT VK+Q
Sbjct: 129 F-------RYEEVEAASLPKEVDWRKKGAVTEVKNQ 157



>gb:AF493233_1805005 Lycopersicon pennellii cysteine protease (Rcr3)
           gene, complete cds.
          Length = 337

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 43/125 (34%), Positives = 67/125 (53%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct: 31  PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE 87

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FAD+ ++EF   FT           G+ + ++  S          + P ++DWR+ GAVT
Sbjct: 88  FADITSQEFLAKFT-----------GLNIPNSYLSPSPINDLSDDDMPSNLDWRESGAVT 136

Query: 613 RVKDQ 627
           +VK+Q
Sbjct: 137 QVKNQ 141



>pir|T10501|T10501 fruit bromelain (EC 3.4.22.33) FB13 precursor -
           pineapple>gb:D14058_1674467 Ananas comosus mRNA for
           bromelain, complete cds.>gb:D38531_1674558 Ananas
           comosus mRNA for FB31 precursor (FB13 precursor),
           complete cds.
          Length = 352

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 43/126 (34%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+NK
Sbjct: 29  PSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNVNHI--ETFNNRNGN-SYTLGINK 85

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+ N EF   +T  I  P   +K+ +     V      +         S+DWR  GAV
Sbjct: 86  FTDMTNNEFVAQYTGGISRPLNIEKEPVVSFDDVNISAVGQ---------SIDWRDYGAV 136

Query: 610 TRVKDQ 627
           T VKDQ
Sbjct: 137 TEVKDQ 142



>gb:AF454957_1801125 Brassica oleracea senescence-associated
           cysteine protease (CP2) mRNA, complete cds.
          Length = 460

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDE----EEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVG 423
           + +V R++E W E++GK  +      EE ++RF+ FK NL+++ E            K+G
Sbjct: 42  DAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNLRFIDEHN----NKNLSYKLG 97

Query: 424 LNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRG 603
           L +FADL NEE++ ++        + K+ +     +++    + +V    P SVDWRK G
Sbjct: 98  LTRFADLTNEEYRSIYLGA-----KSKKRV-----LKTSDRYQPRVGDAIPDSVDWRKEG 147

Query: 604 AVTRVKDQ 627
           AV  VKDQ
Sbjct: 148 AVAAVKDQ 155



>gb:DCU17135_1675750 Dianthus caryophyllus cysteine proteinase
           (DCCP1) mRNA, partial cds.
          Length = 427

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 46/119 (38%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE---KTVGGRGSRWEGKVGLNKFADLRN 450
           + W  ++ K Y    E E+RF  F+ NL+++ +      GG G  +E  +GLNKFADL N
Sbjct: 6   QSWLVKHRKNYNALGEKEKRFAIFRDNLEFIDQHNNNNNGGGGGEFE--LGLNKFADLTN 63

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +EF+ ++   +K P       +   +V+S R   K+   E P SVDWRK+GAV+ VKDQ
Sbjct: 64  DEFRRIYFG-VKRP-------EKAESVKSDRYAVKEGD-ELPESVDWRKKGAVSHVKDQ 113



>pir|S57776|S57776 cysteine proteinase (EC 3.4.22.-) - clove pink
           (fragment)
          Length = 427

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 46/119 (38%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE---KTVGGRGSRWEGKVGLNKFADLRN 450
           + W  ++ K Y    E E+RF  F+ NL+++ +      GG G  +E  +GLNKFADL N
Sbjct: 6   QSWLVKHRKNYNALGEKEKRFAIFRDNLEFIDQHNNNNNGGGGGEFE--LGLNKFADLTN 63

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +EF+ ++   +K P       +   +V+S R   K+   E P SVDWRK+GAV+ VKDQ
Sbjct: 64  DEFRRIYFG-VKRP-------EKAESVKSDRYAVKEGD-ELPESVDWRKKGAVSHVKDQ 113



>gb:AY192364_1588669 Trifolium repens cysteine protease 8 gene,
           complete cds.
          Length = 343

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 43/115 (37%), Positives = 61/115 (53%)
 Frame = +1

Query: 283 EWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFK 462
           +W  + GK+Y+D +E E RF+ F  N+ YV+        S    K+G+N+FADL NEEF 
Sbjct: 41  QWMSQYGKIYKDHQERETRFKIFTENVNYVEASNADDTKSY---KLGINQFADLTNEEF- 96

Query: 463 DVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                   +  R K    M S++      K +     P +VDWRK+GAVT VK+Q
Sbjct: 97  --------VASRNKFKGHMCSSITRTTTFKYENVSAIPSTVDWRKKGAVTPVKNQ 143



>pir|T12039|T12039 cysteine proteinase (EC 3.4.22.-) 1 precursor -
           kidney bean>gb:PVZ99952_1703076 Phaseolus vulgaris
           Moldavian encoding cysteine proteinase precursor (clone
           cp6a).
          Length = 364

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/124 (32%), Positives = 66/124 (53%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E +V+ ++EEW  ++ KVY   +E E+RFQ FK NL ++++             +GLNKF
Sbjct: 29  ENEVMDMYEEWLVKHRKVYNGLDEKEKRFQVFKDNLGFIQDHNAQNN----TYTLGLNKF 84

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ NEE++ ++     +  R     +++    +G         + P  VDWR +GAV  
Sbjct: 85  ADITNEEYRAMY-----LGTRTDAKRRVMKTQNTGHRYAYNSGDQLPVHVDWRLKGAVGP 139

Query: 616 VKDQ 627
           +KDQ
Sbjct: 140 IKDQ 143



>pir|S49451|S49451 cysteine proteinase (EC 3.4.22.-) -
           chickpea>gb:CACPMRNA_1644877 Cicer arietinum mRNA for
           cysteine proteinase.
          Length = 325

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/120 (33%), Positives = 62/120 (51%)
 Frame = +1

Query: 268 LRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLR 447
           + ++E+W  ++ K+Y    E + RFQ FK NL+++ E         +  KVGLNKFAD+ 
Sbjct: 1   MTMYEKWLVKHQKMYNGLGEKDTRFQIFKDNLRFIDEHNA----QNYSYKVGLNKFADIN 56

Query: 448 NEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           NEE++D++         K    + V   +    +    S      VDWR +GAVT +KDQ
Sbjct: 57  NEEYRDMYLG------TKSDAKRRVMKTKITGHRITYNSVIVTVKVDWRLKGAVTHIKDQ 110



>gb:AF493232_1805004 Lycopersicon pimpinellifolium cysteine protease
           (Rcr3) gene, complete cds.
          Length = 344

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 46/126 (36%), Positives = 69/126 (54%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct: 31  PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE 87

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAV 609
           FAD+ ++EF   FT  + +P          S + S   K   +S +  P ++DWR+ GAV
Sbjct: 88  FADITSQEFLAKFTG-LNIP----NSYLSPSPMSSTEFKINDLSDDYMPSNLDWRESGAV 142

Query: 610 TRVKDQ 627
           T+VK Q
Sbjct: 143 TQVKHQ 148



>gb:D38533_1674560 Ananas comosus mRNA for FB22 precursor, partial
           cds.
          Length = 340

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 5/130 (3%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+NK
Sbjct: 29  PSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNVNHI--ETFNNRNGN-SYTLGINK 85

Query: 433 FADLRNEEFKDVFTS-KIKMPFRKKQGIQM----VSAVQSGREKKKKVSCEAPFSVDWRK 597
           F D+ N EF   +T   + + F+++  +      +SAV                S+DWR 
Sbjct: 86  FTDMTNNEFVTQYTGVSLPLNFKREPVVSFDDVNISAVGQ--------------SIDWRD 131

Query: 598 RGAVTRVKDQ 627
            GAVT VKDQ
Sbjct: 132 YGAVTEVKDQ 141



>pir|T10516|T10516 fruit bromelain (EC 3.4.22.33) FB22 precursor -
           pineapple  (fragment)
          Length = 340

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 5/130 (3%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+NK
Sbjct: 29  PSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNVNHI--ETFNNRNGN-SYTLGINK 85

Query: 433 FADLRNEEFKDVFTS-KIKMPFRKKQGIQM----VSAVQSGREKKKKVSCEAPFSVDWRK 597
           F D+ N EF   +T   + + F+++  +      +SAV                S+DWR 
Sbjct: 86  FTDMTNNEFVTQYTGVSLPLNFKREPVVSFDDVNISAVGQ--------------SIDWRD 131

Query: 598 RGAVTRVKDQ 627
            GAVT VKDQ
Sbjct: 132 YGAVTEVKDQ 141



>gb:AF493234_1805006 Lycopersicon esculentum cysteine protease
           (Rcr3) gene, complete cds.
          Length = 345

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 46/128 (35%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P+  V    E W  R+G+VY+DE E  ERF  FK N+K+++     G  S    K+G+N+
Sbjct: 31  PKLSVSERHELWMSRHGRVYKDEVEKGERFMIFKENMKFIESVNKAGNLSY---KLGMNE 87

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE---APFSVDWRKRG 603
           FAD+ ++EF   FT  + +P        +  +  S  E KK         P ++DWR+ G
Sbjct: 88  FADITSQEFLAKFTG-LNIP-----NSYLSPSPMSSTEFKKINDLSDDYMPSNLDWRESG 141

Query: 604 AVTRVKDQ 627
           AVT+VK Q
Sbjct: 142 AVTQVKHQ 149



>gb:OSJN00031_1693569 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0052O21, complete sequence.
          Length = 339

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 42/116 (36%), Positives = 64/116 (55%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E W  + G+VYRD+ E   RF+ FK N+ ++ E    G  + W   +G+N+FADL N+EF
Sbjct: 38  ERWMAQYGRVYRDDAEKARRFEVFKANVAFI-ESFNAGNHNFW---LGVNQFADLTNDEF 93

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           + + T+K  +P          + V +G   +       P +VDWR +GAVT +KDQ
Sbjct: 94  RWMKTNKGFIP--------STTRVPTGFRYENVNIDALPATVDWRTKGAVTPIKDQ 141



>gb:AB025624_1516468 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.>gb:AY062725_1565381 Arabidopsis
           thaliana cysteine proteinase (At3g19400; MLD14.12) mRNA,
           complete cds.>gb:AY093350_1575304 Arabidopsis thaliana
           cysteine proteinase (At3g19400) mRNA, complete cds.
          Length = 452

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-KTVGGRGSRWEGKVGLNK 432
           E +  R++E W   N K Y    E E RF+ FK NLK+V+E  ++  R      +VGL +
Sbjct: 36  EAEARRMYERWLVENRKNYNGLGEKERRFEIFKDNLKFVEEHSSIPNR----TYEVGLTR 91

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FADL N+EF+ ++          +  ++       G +   KV    P ++DWR +GAV 
Sbjct: 92  FADLTNDEFRAIYL---------RSKMERTRVPVKGEKYLYKVGDSLPDAIDWRAKGAVN 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>pir|T01207|T01207 cysteine proteinase mir3 (EC 3.4.22.-) -
           maize>gb:AF019147_1761578 Zea mays cysteine proteinase
           Mir3 (mir3) mRNA, complete cds.
          Length = 480

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 40/125 (32%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+  R++ EW   +G+ Y      E R+Q F+ NL+Y+              ++GLN+F
Sbjct: 37  DEEARRMYAEWMAAHGRTYNAVGAEERRYQVFRDNLRYIDAHNAAADAGVHSFRLGLNRF 96

Query: 436 ADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           ADL N+E+   +      P R +K G +  +A             + P SVDWR +GAV 
Sbjct: 97  ADLTNDEYPATYLGARTRPQRDRKLGARYHAADNE----------DLPESVDWRAKGAVA 146

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 147 EVKDQ 151



>gb:AY867762_1631388 Pinus taeda isolate FBRC1 cysteine protease
           gene, partial cds.
          Length = 192

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 49/159 (30%), Positives = 78/159 (49%), Gaps = 1/159 (0%)
 Frame = +1

Query: 154 GFLVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYE 333
           G L+F ++A +   G +   D             ++ ++ L+E W   + K Y   +E +
Sbjct: 2   GILLFALLAMLAMAGNASRADFSIISNKDLRE--DDAIMELYELWLAEHKKAYNGLDEKQ 59

Query: 334 ERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGI 513
           +RF  FK N  Y+ E   G R      K+GLN+FADL +EEFK  +    K+  +K+   
Sbjct: 60  KRFTVFKDNFLYIHEHNQGNRSY----KLGLNQFADLSHEEFKATYLG-AKLDTKKR--- 111

Query: 514 QMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ 627
                ++S   + +    E  P S+DWR++GAV  VKDQ
Sbjct: 112 ----LLRSPSPRYQYSDGEDLPKSIDWREKGAVAPVKDQ 146



>gb:AB098628_1526118 Daucus carota DcCysP5 mRNA for cysteine
           protease, complete cds.
          Length = 437

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 44/124 (35%), Positives = 65/124 (52%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V+ ++  W  ++GK Y    E E RFQ FK NL+Y+         S    ++GLN+F
Sbjct: 42  DDEVMTMYNSWLVKHGKSYNALGEKETRFQIFKDNLRYIDNHNADPDRSY---ELGLNRF 98

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  +        R K     +S   S R    +   E P S+DWR++GAV  
Sbjct: 99  ADLTNEEYRAKYLGTKSRESRPK-----LSKGPSDRYAPVEGE-ELPDSIDWREKGAVAA 152

Query: 616 VKDQ 627
           VKDQ
Sbjct: 153 VKDQ 156



>pir|T46630|T46630 cysteine proteinase (EC 3.4.22.-) 1 precursor
           [similarity] - kidney bean>gb:PVA224766_1702912
           Phaseolus vulgaris mRNA for cotyledon cysteine protease
           (PVCEP-1 gene).>gb:PVU52970_1703040 Phaseolus vulgaris
           cysteine endopeptidase 1 (PvCEP-1) mRNA, complete cds.
          Length = 364

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 39/124 (31%), Positives = 66/124 (53%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E +V+ ++EEW  ++ KVY   +E E+RFQ FK NL ++++             +GLNKF
Sbjct: 29  ENEVMDMYEEWLVKHRKVYNGLDEKEKRFQVFKDNLGFIQDHNAQNN----TYTLGLNKF 84

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N+E++ ++     +  R     +++    +G         + P  VDWR +GAV  
Sbjct: 85  ADITNKEYRAMY-----LGTRTDAKRRVMKTQNTGHRYAYNSGDQLPVHVDWRLKGAVGP 139

Query: 616 VKDQ 627
           +KDQ
Sbjct: 140 IKDQ 143



>pir|T05390|T05390 probable cysteine proteinase (EC 3.4.22.-)
           F16G20.220 - Arabidopsis thaliana>gb:ATCHRIV59_1546189
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 59.>gb:ATF16G20_1548791 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16G20 (ESSAII project).
          Length = 355

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 1/124 (0%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDE-EEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+V  +F+ W  ++GK Y +   E E RFQNFK NL+++ +            ++GL +F
Sbjct: 41  EEVEFIFQMWMSKHGKTYTNALGEKERRFQNFKDNLRFIDQHNA----KNLSYQLGLTRF 96

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL  +E++D+F    K   R          +++ R        + P SVDWR+ GAV+ 
Sbjct: 97  ADLTVQEYRDLFPGSPKPKQRN---------LKTSRRYVPLAGDQLPESVDWRQEGAVSE 147

Query: 616 VKDQ 627
           +KDQ
Sbjct: 148 IKDQ 151



>gb:AB016870_1512880 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15I22.>gb:AY040073_1560570 Arabidopsis
           thaliana putative senescence-specific cysteine protease
           SAG12 (At5g45890) mRNA, complete
           cds.>gb:AF370131_1792019 Arabidopsis thaliana putative
           senescence-specific cysteine protease SAG12 (At5g45890)
           mRNA, complete cds.
          Length = 346

 Score = 69.3 bits (168), Expect = 5e-11
 Identities = 40/116 (34%), Positives = 65/116 (56%), Gaps = 1/116 (0%)
 Frame = +1

Query: 283 EWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFK 462
           EW  ++G+VY D +E   R+  FK N++ ++       G  +  K+ +N+FADL N+EF+
Sbjct: 40  EWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTF--KLAVNQFADLTNDEFR 97

Query: 463 DVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ 627
            ++T      F+    +   S  +    + + VS  A P SVDWRK+GAVT +K+Q
Sbjct: 98  SMYTG-----FKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKNQ 148



>pir|T07840|T07840 ananain (EC 3.4.22.31) AN8 precursor -
           pineapple>gb:ACO9829_1745388 Ananas comosus mRNA for
           stem cysteine proteinase precursor, clone pAN8.
          Length = 356

 Score = 69.3 bits (168), Expect = 5e-11
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ +++      + S     +G+N+
Sbjct: 29  PSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFKNNVNHIETFNSRNKDSY---TLGINQ 85

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+ N EF   +T  I  P   +++ +     V              P S+DWR  GAV
Sbjct: 86  FTDMTNNEFVAQYTGGISRPLNIEREPVVSFDDVDIS---------AVPQSIDWRDYGAV 136

Query: 610 TRVKDQ 627
           T VK+Q
Sbjct: 137 TSVKNQ 142



>gb:AY867769_1631395 Pinus taeda isolate FBRC5 cysteine protease
           gene, partial cds.>gb:AY867770_1631396 Pinus taeda
           isolate FBRC18 cysteine protease gene, partial
           cds.>gb:AY867782_1631408 Pinus taeda isolate FBRC29
           cysteine protease gene, partial cds.>gb:AY867783_1631409
           Pinus taeda isolate FBRC33 cysteine protease gene,
           partial cds.>gb:AY867785_1631411 Pinus taeda isolate
           FBRC31 cysteine protease gene, partial cds.
          Length = 193

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++ L+E W   + K Y   +E ++RF  FK N  Y+ E   G R      K+GLN+F
Sbjct: 35  DDAIMELYELWVAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQGNRSY----KLGLNQF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           ADL +EEFK  +    K+  +K+        ++S   + +    E  P S+DWR++GAV 
Sbjct: 91  ADLSHEEFKATYLG-AKLDTKKR-------LLRSPSPRYQYSDGEDLPKSIDWREKGAVA 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>gb:AY867766_1631392 Pinus taeda isolate FBRC21 cysteine protease
           gene, partial cds.
          Length = 193

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++ L+E W   + K Y   +E ++RF  FK N  Y+ E   G R      K+GLN+F
Sbjct: 35  DDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQGNRSY----KLGLNQF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           ADL +EEFK  +    K+  +K+        ++S   + +    E  P S+DWR++GAV 
Sbjct: 91  ADLSHEEFKATYLG-AKLDTKKR-------LLRSPSPRYQYSDGEDLPKSIDWREKGAVV 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>gb:AY867761_1631387 Pinus taeda isolate FBRC16 cysteine protease
           gene, partial cds.>gb:AY867763_1631389 Pinus taeda
           isolate FBRC2 cysteine protease gene, partial
           cds.>gb:AY867765_1631391 Pinus taeda isolate FBRC9
           cysteine protease gene, partial cds.>gb:AY867775_1631401
           Pinus taeda isolate FBRC23 cysteine protease gene,
           partial cds.>gb:AY867781_1631407 Pinus taeda isolate
           FBRC28 cysteine protease gene, partial
           cds.>gb:AY867784_1631410 Pinus taeda isolate FBRC30
           cysteine protease gene, partial cds.>gb:AY867788_1631414
           Pinus taeda isolate FBRC32 cysteine protease gene,
           partial cds.>gb:AY867790_1631416 Pinus taeda isolate
           FBRC13 cysteine protease gene, partial cds.
          Length = 193

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++ L+E W   + K Y   +E ++RF  FK N  Y+ E   G R      K+GLN+F
Sbjct: 35  DDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQGNRSY----KLGLNQF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           ADL +EEFK  +    K+  +K+        ++S   + +    E  P S+DWR++GAV 
Sbjct: 91  ADLSHEEFKATYLG-AKLDTKKR-------LLRSPSPRYQYSDGEDLPKSIDWREKGAVA 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>gb:AY867759_1631385 Pinus taeda isolate FBRC14 cysteine protease
           gene, partial cds.>gb:AY867760_1631386 Pinus taeda
           isolate FBRC15 cysteine protease gene, partial
           cds.>gb:AY867767_1631393 Pinus taeda isolate FBRC17
           cysteine protease gene, partial cds.>gb:AY867768_1631394
           Pinus taeda isolate FBRC22 cysteine protease gene,
           partial cds.>gb:AY867771_1631397 Pinus taeda isolate
           FBRC6 cysteine protease gene, partial
           cds.>gb:AY867772_1631398 Pinus taeda isolate FBRC7
           cysteine protease gene, partial cds.>gb:AY867773_1631399
           Pinus taeda isolate FBRC20 cysteine protease gene,
           partial cds.>gb:AY867776_1631402 Pinus taeda isolate
           FBRC24 cysteine protease gene, partial
           cds.>gb:AY867777_1631403 Pinus taeda isolate FBRC25
           cysteine protease gene, partial cds.>gb:AY867778_1631404
           Pinus taeda isolate FBRC26 cysteine protease gene,
           partial cds.>gb:AY867779_1631405 Pinus taeda isolate
           FBRC27 cysteine protease gene, partial
           cds.>gb:AY867787_1631413 Pinus taeda isolate FBRC19
           cysteine protease gene, partial cds.
          Length = 193

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++ L+E W   + K Y   +E ++RF  FK N  Y+ E   G R      K+GLN+F
Sbjct: 35  DDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQGNRSY----KLGLNQF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           ADL +EEFK  +    K+  +K+        ++S   + +    E  P S+DWR++GAV 
Sbjct: 91  ADLSHEEFKATYLG-AKLDTKKR-------LLRSPSPRYQYSDGEDLPKSIDWREKGAVA 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>pir|T10514|T10514 probable stem bromelain (EC 3.4.22.32) precursor
           - pineapple>gb:D38532_1674559 Ananas comosus mRNA for
           FBSB precursor, complete cds.
          Length = 356

 Score = 68.9 bits (167), Expect = 6e-11
 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+N+
Sbjct: 29  PSDPMMKRFEEWMVEYGRVYKDNDEKMRRFQIFKNNVNHI--ETFNSRNEN-SYTLGINQ 85

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+ N EF   +T  I  P   +++ +     V              P S+DWR  GAV
Sbjct: 86  FTDMTNNEFIAQYTGGISRPLNIEREPVVSFDDVDIS---------AVPQSIDWRDYGAV 136

Query: 610 TRVKDQ 627
           T VK+Q
Sbjct: 137 TSVKNQ 142



>gb:AF242372_1780149 Ipomoea batatas cysteine protease (SPCP1) mRNA,
           complete cds.
          Length = 339

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 40/116 (34%), Positives = 59/116 (50%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E+W  + G+VY+ E E  +RF  FK N++Y++     G       K+G+N FADL N+EF
Sbjct: 38  EQWMAQYGRVYKTEAEKTKRFNIFKENVEYIESFNKAGTKPY---KLGINAFADLTNQEF 94

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           K             + G ++     S    + +     P +VDWR +GAVT VKDQ
Sbjct: 95  K-----------ASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQ 139



>gb:AF089849_1767323 Brassica napus senescence-specific cysteine
           protease (SAG12-2) gene, complete cds.
          Length = 344

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 1/116 (0%)
 Frame = +1

Query: 283 EWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFK 462
           EW   +G+VY D  E   R+  FK N++ ++       G  +  K+ +N+FADL NEEF+
Sbjct: 40  EWMTEHGRVYADANEKNNRYAVFKRNVERIERLNDVQSGLTF--KLAVNQFADLTNEEFR 97

Query: 463 DVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ 627
            ++T         K    + S  +    + + VS +A P SVDWRK+GAVT +KDQ
Sbjct: 98  SMYTGF-------KGNSVLSSRTKPTSFRYQNVSSDALPVSVDWRKKGAVTPIKDQ 146



>gb:CPA131996_1648455 Carica papaya mRNA for chymopapain isoform
           III.
          Length = 361

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 42/123 (34%), Positives = 63/123 (51%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF+ W  ++ K+Y   +E   RF+ F+ NL Y+ E T     S W   +GLN FA
Sbjct: 42  ERLIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDE-TNKKNNSYW---LGLNGFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EFK  +   +   F   +            +   K     P S+DWR +GAVT V
Sbjct: 98  DLSNDEFKKKYVGFVAEDFTGLEHF-------DNEDFTYKHVTNYPQSIDWRAKGAVTPV 150

Query: 619 KDQ 627
           K+Q
Sbjct: 151 KNQ 153



>gb:CPA131995_1648454 Carica papaya mRNA for chymopapain isoform II.
          Length = 352

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 42/123 (34%), Positives = 63/123 (51%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF+ W  ++ K+Y   +E   RF+ F+ NL Y+ E T     S W   +GLN FA
Sbjct: 42  ERLIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDE-TNKKNNSYW---LGLNGFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EFK  +   +   F   +            +   K     P S+DWR +GAVT V
Sbjct: 98  DLSNDEFKKKYVGFVAEDFTGLEHF-------DNEDFTYKHVTNYPQSIDWRAKGAVTPV 150

Query: 619 KDQ 627
           K+Q
Sbjct: 151 KNQ 153



>gb:AC079022_1541706 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.>gb:AY335487_1600217 Oryza sativa
           (japonica cultivar-group) cysteine protease CP1 mRNA,
           complete cds.>gb:AC129716_1740610 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0068N01,
           complete sequence.
          Length = 358

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 49/153 (32%), Positives = 70/153 (45%), Gaps = 7/153 (4%)
 Frame = +1

Query: 190 CGGVSCYYDXXXXXXXXXXXVPEE-----KVLRLFEEWKERNGKVYRDEEEYEERFQNFK 354
           CGG +C                E+     +++ LFE+W  +  K Y   EE   RF+ FK
Sbjct: 17  CGGAACAAGRSGGEFSIVGYSEEDLASHDRLIELFEKWVAKYRKAYASFEEKVRRFEVFK 76

Query: 355 GNLKYVKE--KTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSA 528
            NL ++ +  K V    S W   +GLN+FADL ++EFK  +      P R          
Sbjct: 77  DNLNHIDDINKKV---TSYW---LGLNEFADLTHDEFKATYLGLTPPPTRSNSKHYSSEE 130

Query: 529 VQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
            + G    K  + E P  +DWRK+ AVT VK+Q
Sbjct: 131 FRYG----KMSNGEVPKEMDWRKKNAVTEVKNQ 159



>pir|S71773|S71773 cysteine proteinase (EC 3.4.22.-) precursor -
           Zinnia elegans>gb:ZEU19267_1731385 Zinnia elegans
           cysteine proteinase mRNA, complete cds.
          Length = 342

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 46/123 (37%), Positives = 70/123 (56%), Gaps = 1/123 (0%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           KV+ LFE    ++ K+Y   +E   RF+ F  NLK++ E T     + W   +GLN+FAD
Sbjct: 44  KVIHLFESSLVKHSKIYESFDEKLHRFEIFMDNLKHIDE-TNKKVSNYW---LGLNEFAD 99

Query: 442 LRNEEFKDVFTS-KIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           L +EEFK+ F   K ++  RK + I+         + + +   + P SVDWRK+GAV+ V
Sbjct: 100 LTHEEFKNKFLGFKGELAERKDESIE---------QFRYRDFVDLPKSVDWRKKGAVSPV 150

Query: 619 KDQ 627
           K+Q
Sbjct: 151 KNQ 153



>sp|P14080|PAP2_CARPA Chymopapain precursor (EC 3.4.22.6) (Papaya
           proteinase II) (PPII).>pir|T09760|T09760 chymopapain (EC
           3.4.22.6) precursor [validated] -
           papaya>gb:CPCHYM_1648560 C.papaya mRNA for chymopapain.
          Length = 352

 Score = 68.6 bits (166), Expect = 8e-11
 Identities = 42/123 (34%), Positives = 63/123 (51%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF+ W  ++ K+Y   +E   RF+ F+ NL Y+ E T     S W   +GLN FA
Sbjct: 42  ERLIQLFDSWMLKHNKIYESIDEKIYRFEIFRDNLMYIDE-TNKKNNSYW---LGLNGFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EFK  +   +   F   +            +   K     P S+DWR +GAVT V
Sbjct: 98  DLSNDEFKKKYVGFVAEDFTGLEHF-------DNEDFTYKHVTNYPQSIDWRAKGAVTPV 150

Query: 619 KDQ 627
           K+Q
Sbjct: 151 KNQ 153



>gb:AY604196_1617470 Gossypium hirsutum putative cysteine protease
           (ccyp) mRNA, complete cds.
          Length = 344

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 45/118 (38%), Positives = 64/118 (54%), Gaps = 2/118 (1%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEE--YEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           EEW  ++G+VY DE+E    +RF  FK N++ ++E   G        K+ +N+FADL NE
Sbjct: 38  EEWMSQHGRVYADEQEDHKNKRFNVFKENVERIEEFNDGKTF-----KLAINQFADLTNE 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF+  +    K P      I   +       + + VS   P SVDWRK+GAVT VK+Q
Sbjct: 93  EFRASYNG-FKGPMVLSSQITKPTPF-----RYENVSSALPVSVDWRKKGAVTPVKNQ 144



>gb:AY055589_1563381 Ipomoea batatas cysteine proteinase precursor
           (SPG31) gene, complete cds.>gb:AF242185_1780135 Ipomoea
           batatas cysteine proteinase-like protein mRNA, complete
           cds.
          Length = 341

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 40/116 (34%), Positives = 59/116 (50%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E+W  + G+VY +E E  +RF  FK N++Y++     G       K+G+N FADL N+EF
Sbjct: 40  EQWMAQYGRVYENEVEKTKRFNIFKENVEYIESFNKAGTKPY---KLGINAFADLTNQEF 96

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           K             + G ++     S    + +     P +VDWR +GAVT VKDQ
Sbjct: 97  K-----------ASRNGYKLPHDCSSNTPFRYENVSSVPTTVDWRTKGAVTPVKDQ 141



>sp|P10056|PAP3_CARPA Caricain precursor (EC 3.4.22.30) (Papaya
           proteinase omega) (Papaya proteinase III) (PPIII)
           (Papaya peptidase A).>pir|JN0633|JN0633 caricain (EC
           3.4.22.30) I precursor - papaya>gb:CPPROO_1648688
           C.papaya mRNA for proteinase omega.
          Length = 348

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 42/123 (34%), Positives = 62/123 (50%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF  W   + K Y + +E   RF+ FK NL Y+ E T     S W   +GLN+FA
Sbjct: 42  ERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDE-TNKKNNSYW---LGLNEFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EF + +   +         I          E   + +   P +VDWRK+GAVT V
Sbjct: 98  DLSNDEFNEKYVGSL---------IDATIEQSYDEEFINEDTVNLPENVDWRKKGAVTPV 148

Query: 619 KDQ 627
           + Q
Sbjct: 149 RHQ 151



>gb:AY039606_1560319 Arabidopsis thaliana F2G19.31/F2G19.31 mRNA,
           complete cds.>gb:AY081730_1568990 Arabidopsis thaliana
           F2G19.31/F2G19.31 mRNA, complete cds.
          Length = 462

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 45/126 (35%), Positives = 66/126 (52%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEE--EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN 429
           E +V+ ++E W  ++GK        E + RF+ FK NL++V E        R    +GL 
Sbjct: 43  EAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYR----LGLT 98

Query: 430 KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           +FADL N+E++  +    KM   +K+G +  S     R     V  E P S+DWRK+GAV
Sbjct: 99  RFADLTNDEYRSKYLGA-KM---EKKGERRTSLRYEAR-----VGDELPESIDWRKKGAV 149

Query: 610 TRVKDQ 627
             VKDQ
Sbjct: 150 AEVKDQ 155



>sp|P43297|RD21_ARATH Cysteine proteinase RD21a precursor (EC
           3.4.22.-) (RD21).>pir|JN0719|JN0719 drought-inducible
           cysteine proteinase (EC 3.4.22.-) RD21A precursor -
           Arabidopsis thaliana>gb:AE005173_892683 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:ATHRD21A_1553342 Arabidopsis thaliana rd21A
           gene for thiol protease, complete
           cds.>gb:AY072130_1567024 Arabidopsis thaliana putative
           cysteine proteinase RD21A (At1g47128) mRNA, complete
           cds.>gb:AY133781_1581601 Arabidopsis thaliana clone
           U11707 putative cysteine proteinase RD21A (At1g47128)
           mRNA, complete cds.>gb:AC083835_1733197 Arabidopsis
           thaliana chromosome 1 BAC F2G19 genomic sequence,
           complete sequence.
          Length = 462

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 45/126 (35%), Positives = 66/126 (52%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEE--EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN 429
           E +V+ ++E W  ++GK        E + RF+ FK NL++V E        R    +GL 
Sbjct: 43  EAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYR----LGLT 98

Query: 430 KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           +FADL N+E++  +    KM   +K+G +  S     R     V  E P S+DWRK+GAV
Sbjct: 99  RFADLTNDEYRSKYLGA-KM---EKKGERRTSLRYEAR-----VGDELPESIDWRKKGAV 149

Query: 610 TRVKDQ 627
             VKDQ
Sbjct: 150 AEVKDQ 155



>gb:AK118509_1816482 Arabidopsis thaliana At3g19400 mRNA for
           putative cysteine proteinase RD21A precursor, complete
           cds, clone: RAFL19-74-E13.
          Length = 362

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 50/125 (40%), Positives = 66/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-KTVGGRGSRWEGKVGLNK 432
           E +V  ++E+W   N K Y    E E RF+ FK NLK+V E  +V  R      +VGL +
Sbjct: 37  ETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDR----TFEVGLTR 92

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FADL NEEF+ ++  K KM   K        +V++ R   K+     P  VDWR  GAV 
Sbjct: 93  FADLTNEEFRAIYLRK-KMERNK-------DSVKTERYLYKEGDV-LPDEVDWRANGAVV 143

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 144 SVKDQ 148



>gb:AY867764_1631390 Pinus taeda isolate FBRC3 cysteine protease
           gene, partial cds.>gb:AY867774_1631400 Pinus taeda
           isolate FBRC12 cysteine protease gene, partial
           cds.>gb:AY867780_1631406 Pinus taeda isolate FBRC10
           cysteine protease gene, partial cds.>gb:AY867786_1631412
           Pinus taeda isolate FBRC11 cysteine protease gene,
           partial cds.>gb:AY867789_1631415 Pinus taeda isolate
           FBRC4 cysteine protease gene, partial cds.
          Length = 193

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           ++ ++ L+E W   + K Y   +E ++RF  FK N  Y+ E   G +      K+GLN+F
Sbjct: 35  DDAIMELYELWLAEHKKAYNGLDEKQKRFTVFKDNFLYIHEHNQGNQSY----KLGLNQF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           ADL +EEFK  +    K+  +K+        ++S   + +    E  P S+DWR++GAV 
Sbjct: 91  ADLSHEEFKATYLG-AKLDTKKR-------LLRSPSPRYQYSDGEDLPKSIDWREKGAVA 142

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 143 PVKDQ 147



>gb:ATU37336_1556938 Arabidopsis thaliana senescence-specific
           protein (SAG12) gene, promoter region and complete cds.
          Length = 346

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 1/116 (0%)
 Frame = +1

Query: 283 EWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFK 462
           EW  ++G+VY D +E   R+  FK N++ ++       G  +  K+ +N+FADL N+EF 
Sbjct: 40  EWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTF--KLAVNQFADLTNDEFC 97

Query: 463 DVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ 627
            ++T      F+    +   S  +    + + VS  A P SVDWRK+GAVT +K+Q
Sbjct: 98  SMYTG-----FKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAVTPIKNQ 148



>pir|T06529|T06529 cysteine proteinase (EC 3.4.22.-) - garden
           pea>gb:PSU44947_1702507 Pisum sativum putative cysteine
           protease NTH1 mRNA, complete cds.
          Length = 367

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 41/123 (33%), Positives = 67/123 (54%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++V+ ++E+W  ++ KVY    E  +RFQ FK NL ++ E        R    VGLN+F+
Sbjct: 29  KEVMTMYEKWLVKHQKVYYGLGEKNQRFQIFKDNLIFIDEHNAPNHSYR----VGLNEFS 84

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           D+ N+E++D + S+      K +   +  A ++G   K       P SVDW  RGA+T +
Sbjct: 85  DITNKEYRDTYLSRWSNNNIKNKITSVRYAYKAGHNNK------LPVSVDW--RGALTPI 136

Query: 619 KDQ 627
           K+Q
Sbjct: 137 KNQ 139



>sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor (EC
           3.4.22.-).>pir|S57777|S57777 cysteine proteinase (EC
           3.4.22.-) precursor - Hemerocallis x hybrida (cv. Cradle
           Song)>gb:HSPSEN102_1682140 Hemerocallis sp. mRNA for
           thiol-protease.
          Length = 360

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 42/124 (33%), Positives = 64/124 (51%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E+W+  +  V RD +E   RF  FK N+K++ E     +      K+ LNKF
Sbjct: 33  EDSLWNLYEKWRTHH-TVARDLDEKNRRFNVFKENVKFIHEFN---QKKDAPYKLALNKF 88

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+ N+EF+  +        R ++GIQ      +G    + V      S+DWR +GAVT 
Sbjct: 89  GDMTNQEFRSKYAGSKIQHHRSQRGIQK----NTGSFMYENVGSLPAASIDWRAKGAVTG 144

Query: 616 VKDQ 627
           VKDQ
Sbjct: 145 VKDQ 148



>sp|P80884|ANAN_ANACO Ananain precursor (EC
           3.4.22.31).>pir|T07839|T07839 ananain (EC 3.4.22.31)
           precursor - pineapple>gb:ACAJ2477_1745318 Ananas comosus
           mRNA for ananain precursor, complete cds.
          Length = 345

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+N+
Sbjct: 29  PSDPMMKQFEEWMAEYGRVYKDNDEKMLRFQIFKNNVNHI--ETFNNRNGN-SYTLGINQ 85

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+ N EF   +T  + +P   K++ +     V              P S+DWR  GAV
Sbjct: 86  FTDMTNNEFVAQYTG-LSLPLNIKREPVVSFDDVDIS---------SVPQSIDWRDSGAV 135

Query: 610 TRVKDQ 627
           T VK+Q
Sbjct: 136 TSVKNQ 141



>gb:OSJN00114_1695146 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0035O13, complete sequence.
          Length = 339

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 42/116 (36%), Positives = 61/116 (52%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E W E+ G+VY+D  E   RF+ FK N+ ++ E    G    W   +G+N+FADL N EF
Sbjct: 38  ERWMEQYGRVYKDATEKARRFEIFKANVAFI-ESFNAGNHKFW---LGVNQFADLTNYEF 93

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +   T+K  +P         V    + R +   +    P +VDWR +GAVT +KDQ
Sbjct: 94  RATKTNKGFIP-------STVRVPTTFRYENVSID-TLPATVDWRTKGAVTPIKDQ 141



>gb:AY695444_1623509 Carica papaya proteinase omega gene, partial
           cds.
          Length = 155

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 42/123 (34%), Positives = 61/123 (49%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF  W   + K Y + +E   RF+ FK NL Y+ E T     S W   +GLN+FA
Sbjct: 42  ERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDE-TNKKNNSYW---LGLNEFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EF + +   +         I          E   +     P +VDWRK+GAVT V
Sbjct: 98  DLSNDEFNEKYVGSL---------IDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPV 148

Query: 619 KDQ 627
           + Q
Sbjct: 149 RHQ 151



>gb:AY504966_1609832 Iris hollandica putative cysteine protease 1
           (CYS1) mRNA, complete cds.
          Length = 340

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 43/124 (34%), Positives = 65/124 (52%), Gaps = 1/124 (0%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           + +L   E+W  ++G+VY++  E   RF+ F+ N+    E+         + K+G+N+FA
Sbjct: 35  KSMLERHEQWMAQHGRVYKNAAEKAHRFEIFRANV----ERIESFNAENHKFKLGVNQFA 90

Query: 439 DLRNEEFKDVFTSK-IKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           DL NEEFK   T K  KM   K    + V+AV              P ++DWR +GAVT 
Sbjct: 91  DLTNEEFKTRNTLKPSKMASTKSFKYENVTAV--------------PATMDWRTKGAVTP 136

Query: 616 VKDQ 627
           +KDQ
Sbjct: 137 IKDQ 140



>gb:NFU42758_1390810 Naegleria fowleri cysteine proteinase homolog
           mRNA, partial cds.
          Length = 347

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 47/124 (37%), Positives = 69/124 (55%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E ++ +LF ++  +  KVY   EE+  R+Q FK N++  K +     G R     G+ KF
Sbjct: 26  ESEMKKLFIKFSRKYAKVY-GTEEHNNRYQIFKANVE--KSRYYNHVGKR--ENFGITKF 80

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           +DL  EEFK +F  K   P   K+   +++A Q     +K+V   AP S DWR+ GAVTR
Sbjct: 81  SDLTPEEFKRMFLMKTYTPEEAKK---ILAAPQHAVLSEKEVQT-APTSFDWRQHGAVTR 136

Query: 616 VKDQ 627
           VK+Q
Sbjct: 137 VKNQ 140



>gb:AF157961_1246018 Hypera postica cysteine proteinase mRNA,
           complete cds.
          Length = 324

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 40/117 (34%), Positives = 60/117 (51%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F+ +K  +GK Y ++ E  +RF  F  N++ ++         +   K G+NKF D+  EE
Sbjct: 26  FQAFKLEHGKTYLNQAEESKRFNIFTDNVRAIEAHNALYEQGKVSYKKGINKFTDMSQEE 85

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FK + T    +   +K  ++  S V++G         E P SVDWRK G VT VKDQ
Sbjct: 86  FKTMLT----LSASRKPTLETTSYVKTG--------VEIPSSVDWRKEGRVTGVKDQ 130



>pir|T10503|T10503 fruit bromelain (EC 3.4.22.33) FB18 precursor -
           pineapple>gb:D14059_1674468 Ananas comosus mRNA for
           bromelain, complete cds.
          Length = 351

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 44/156 (28%), Positives = 73/156 (46%), Gaps = 1/156 (0%)
 Frame = +1

Query: 163 VFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEERF 342
           +FL + A+W    +   D            P + +++ FEEW    G+VY+D++E   RF
Sbjct: 10  LFLFLCAMWASPSAASRDE-----------PNDPMMKRFEEWMAEYGRVYKDDDEKMRRF 58

Query: 343 QNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFR-KKQGIQM 519
           Q FK N+K++  +T   R       +G+N+F D+   EF   +T  + +P   +++ +  
Sbjct: 59  QIFKNNVKHI--ETFNSRNEN-SYTLGINQFTDMTKSEFVAQYTG-VSLPLNIEREPVVS 114

Query: 520 VSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
              V              P S+DWR  GAV  VK+Q
Sbjct: 115 FDDVNIS---------AVPQSIDWRDYGAVNEVKNQ 141



>sp|Q9LT77|CPR1_ARATH Putative cysteine proteinase At3g19400
           precursor (EC 3.4.22.-).>gb:AB025624_1516469 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone: MLD14.
          Length = 362

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 50/125 (40%), Positives = 66/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-KTVGGRGSRWEGKVGLNK 432
           E +V  ++E+W   N K Y    E E RF+ FK NLK+V E  +V  R      +VGL +
Sbjct: 37  ETEVRLMYEQWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDR----TFEVGLTR 92

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FADL NEEF+ ++  K KM   K        +V++ R   K+     P  VDWR  GAV 
Sbjct: 93  FADLTNEEFRAIYLRK-KMERTK-------DSVKTERYLYKEGDV-LPDEVDWRANGAVV 143

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 144 SVKDQ 148



>gb:AF448505_1800669 Brassica napus cysteine proteinase (CysP1)
           mRNA, complete cds.>gb:AF448506_1800670 Brassica napus
           cysteine proteinase (CysP1) gene, complete cds.
          Length = 343

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 41/115 (35%), Positives = 62/115 (53%), Gaps = 1/115 (0%)
 Frame = +1

Query: 286 WKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKD 465
           W   +G+VY D  E   R+  FK N++ ++       G  +  K+ +N+FADL NEEF+ 
Sbjct: 40  WMTEHGRVYADANEKNNRYVVFKRNVESIERLNEVQYGLTF--KLAVNQFADLTNEEFRS 97

Query: 466 VFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ 627
           ++T         K    + S  +    + + VS +A P SVDWRK+GAVT +KDQ
Sbjct: 98  MYTGY-------KGNSVLSSRTKPTSFRYQHVSSDALPISVDWRKKGAVTPIKDQ 145



>gb:PSU34747_1702498 Phalaenopsis sp. 'hybrid SM9108' cysteine
           proteinase mRNA, complete cds.
          Length = 359

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 43/124 (34%), Positives = 64/124 (51%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E W+  +  V RD +E ++RF  FK N +Y+ +     +      K+ LNKF
Sbjct: 31  EDSLWNLYERWRSHH-TVSRDLDEKQKRFNVFKENPRYIHDFN---KRKDIPYKLRLNKF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL N EF+  +        R  +G +   A  S   +    S   P S+DWR++GAVT 
Sbjct: 87  ADLTNHEFRSTYAGSRINHHRSLRGSRRGGATNSFMYQSLD-SRSLPASIDWRQKGAVTA 145

Query: 616 VKDQ 627
           VKDQ
Sbjct: 146 VKDQ 149



>gb:OSJN00046_1693820 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0005B05, complete sequence.
          Length = 323

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 38/116 (32%), Positives = 61/116 (52%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E W  + G++Y+D+ E   RF+ FK N+ ++ E    G    W   +G+N+FADL N+EF
Sbjct: 38  ERWMAQYGRMYKDDAEKARRFEVFKANVAFI-ESFNAGNHKFW---LGVNQFADLTNDEF 93

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +   T+K  +P          + V +G   +       P ++DWR +G VT +KDQ
Sbjct: 94  RSTKTNKGFIP--------STTRVPTGFRNENVNIDALPATMDWRTKGVVTPIKDQ 141



>gb:AP003852_1834273 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0440D10.
          Length = 342

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 48/160 (30%), Positives = 73/160 (45%), Gaps = 4/160 (2%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRLFEEWKERNGKVYRDEEEYEER 339
           LV   + A+   G   YY+             +   +++FEEW  + GK Y+   E E R
Sbjct: 13  LVVCTLMALQAMGADAYYNNGSD---------DGVTMQMFEEWMAKFGKTYKCHGEKEHR 63

Query: 340 FQNFKGNLKYVKEKTVGGRGSR----WEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQ 507
           F  F+ N+ ++       RG +    ++  VG+N+FADL N+EF   +T     P   K+
Sbjct: 64  FGIFRDNVHFI-------RGYKPQVTYDSAVGINQFADLTNDEFVATYTG--AKPPHPKE 114

Query: 508 GIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
             + V  + +            P  +DWR RGAVT VKDQ
Sbjct: 115 APRPVDPIWT------------PCCIDWRFRGAVTGVKDQ 142



>gb:SEN11_1714956 Hemerocallis hybrid cultivar cysteine proteinase
           (SEN11) mRNA, complete cds.
          Length = 359

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 41/124 (33%), Positives = 65/124 (52%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E+W+  +  V RD ++ ++RF  FK N+K++ E       +    K+ LNKF
Sbjct: 34  EESLWSLYEKWRAHHA-VSRDLDDTDKRFNVFKENVKFIHEFNQKKDATY---KLALNKF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+ N+EF+  +         K      +  V+   E   +   + P SVDWR++GAVT 
Sbjct: 90  GDMTNQEFRSTYAGS------KIDHHMTLRGVKDAGEFSYEKFHDLPTSVDWREKGAVTG 143

Query: 616 VKDQ 627
           VKDQ
Sbjct: 144 VKDQ 147



>gb:AB098627_1526117 Daucus carota DcCysP4 mRNA for cysteine
           protease, complete cds.
          Length = 423

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 43/99 (43%), Positives = 56/99 (56%)
 Frame = +1

Query: 331 EERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG 510
           E+RF+ FK NL+++ E     +G     K+GLNKFADL NEE+K +F     +  RK   
Sbjct: 25  EKRFEIFKDNLRFIDEHN---KGVNQSFKLGLNKFADLSNEEYKSMFLGGRMVRDRK--- 78

Query: 511 IQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                  +S R  K  V  E P SVDWR++GAV  VKDQ
Sbjct: 79  -----GFESDR-FKYGVGDELPQSVDWREKGAVAPVKDQ 111



>pir|JN0634|JN0634 caricain (EC 3.4.22.30) II precursor -
           papaya>gb:CPPPOII_1648687 C.papaya mRNA for papaya
           proteinase omega.
          Length = 367

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 40/123 (32%), Positives = 59/123 (47%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           E++++LF  W   + K Y + +E   RF+ FK NL Y+ E        R    +GLN+FA
Sbjct: 42  ERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKKNNSYR----LGLNEFA 97

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL N+EF + +   +         I          E   +     P +VDWRK+GAVT V
Sbjct: 98  DLSNDEFNEKYVGSL---------IDATIEQSYDEEFINEDIVNLPENVDWRKKGAVTPV 148

Query: 619 KDQ 627
           + Q
Sbjct: 149 RHQ 151



>gb:AP003852_1834274 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0440D10.
          Length = 335

 Score = 65.9 bits (159), Expect = 5e-10
 Identities = 42/124 (33%), Positives = 63/124 (50%), Gaps = 4/124 (3%)
 Frame = +1

Query: 268 LRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSR----WEGKVGLNKF 435
           +++FEEW  + GK Y+   E E RF  F+ N+ ++       RG +    ++  VG+N+F
Sbjct: 33  MQMFEEWMAKFGKTYKCHGEKEHRFGIFRDNVHFI-------RGYKPQVTYDSAVGINQF 85

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL N+EF   +T     P   K+  + V  + +            P  +DWR RGAVT 
Sbjct: 86  ADLTNDEFVATYTG--AKPPHPKEAPRPVDPIWT------------PCCIDWRFRGAVTG 131

Query: 616 VKDQ 627
           VKDQ
Sbjct: 132 VKDQ 135



>gb:AF417109_1797862 Carica candamarcensis cysteine proteinase
           precursor, mRNA, partial cds.
          Length = 179

 Score = 65.9 bits (159), Expect = 5e-10
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 2/121 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++V+ ++E W  ++GKVY    E E+RF  FK NL+++ E            ++GLN+F
Sbjct: 70  DDEVMAMYEAWLVKHGKVYNALGEKEKRFDIFKDNLRFIDEH----NSQNLTYRLGLNRF 125

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKK--KKVSCEAPFSVDWRKRGAV 609
           ADL NEE++  +          K G    +   SG+  +   +     P S DWR +GAV
Sbjct: 126 ADLTNEEYRSTYLG-------VKPGATRAARKVSGKSHRYAPRDGDALPDSFDWRTKGAV 178

Query: 610 T 612
           T
Sbjct: 179 T 179



>gb:AY881010_1631908 Nicotiana tabacum cysteine protease (CP2) mRNA,
           complete cds.
          Length = 361

 Score = 65.9 bits (159), Expect = 5e-10
 Identities = 48/130 (36%), Positives = 67/130 (51%), Gaps = 6/130 (4%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EEK+  L+E W+  +  V R  +E ++RF  FK N+ YV       +      K+ LNKF
Sbjct: 31  EEKLWELYERWRSHH-TVSRSLDEKDKRFNVFKANVHYVHNFNKKDKPY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFT-SKIK-----MPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRK 597
           AD+ N EF+  +  SKIK     +   +  G  M + V+           + P SVDWRK
Sbjct: 86  ADMTNHEFRHHYAGSKIKHHRSFLGASRANGTFMYANVE-----------DVPPSVDWRK 134

Query: 598 RGAVTRVKDQ 627
           +GAVT VKDQ
Sbjct: 135 KGAVTPVKDQ 144



>gb:AY251055_1592749 Anthurium andraeanum senescence-associated
           cysteine protease mRNA, complete cds.
          Length = 460

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 42/124 (33%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE+V  L+E W   NGK Y    E E RF+ F  NL+Y+ +         +   +GL +F
Sbjct: 31  EEEVRLLYEGWLVGNGKAYNLLGEKERRFEIFWDNLRYIDDHNRAENNHSY--TLGLTRF 88

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  +        R ++  +   A   GR+       + P  VDWR++GAV  
Sbjct: 89  ADLTNEEYRSTYLGVKPGQVRPRRANR---APGRGRDLSAN-GDDLPQKVDWREKGAVAP 144

Query: 616 VKDQ 627
           +KDQ
Sbjct: 145 IKDQ 148



>gb:AF454956_1801124 Brassica oleracea senescence-associated
           cysteine protease (CP1) mRNA, partial cds.
          Length = 445

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 47/125 (37%), Positives = 67/125 (53%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           PEE  +++FE W   N K Y    E ++RF+ F  NLK+V+E       S    ++GL +
Sbjct: 31  PEE--VKMFERWLVENHKNYNGLGEKDKRFEIFMDNLKFVQEHNSVPNQSY---ELGLTR 85

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           FADL NEEF+ ++  + KM   +        +V+S R     V  + P  VDWR +GAV 
Sbjct: 86  FADLTNEEFRAIYL-RSKMERTR-------DSVKSER-YLHNVGDKLPDEVDWRAKGAVV 136

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 137 PVKDQ 141



>gb:AY043294_1560995 Arabidopsis thaliana cysteine proteinase (GCP1)
           mRNA, complete cds.
          Length = 376

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 8/132 (6%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEE----EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVG 423
           +E+V  ++ +W   +GK   +      + ++RF  FK NL+++       + + +  K+G
Sbjct: 42  DEEVRSIYLQWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNENNKNATY--KLG 99

Query: 424 LNKFADLRNEEFKDVFTSKIKMPFRK----KQGIQMVSAVQSGREKKKKVSCEAPFSVDW 591
           L KF DL N+E++ ++      P R+    K   Q  SA  +G+E         P +VDW
Sbjct: 100 LTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKE--------VPETVDW 151

Query: 592 RKRGAVTRVKDQ 627
           R++GAV  +KDQ
Sbjct: 152 RQKGAVNPIKDQ 163



>gb:AJ784223_1284201 Suberites domuncula mRNA for cathepsin H (cat-H
           gene).
          Length = 335

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 40/117 (34%), Positives = 61/117 (52%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F+EW+E++GKVY  EEE + R + F  N+ Y+      G     E    +N++AD+  +E
Sbjct: 35  FKEWQEKHGKVYSTEEESQSRLKVFMKNVIYIDNHNKQGHSYELE----VNEYADMTLDE 90

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FKD +  +           Q  SA  S +    K   + P ++DWR +GAVT VK+Q
Sbjct: 91  FKDQYLME----------PQHCSATHSLKSDPPKYR-DPPKAIDWRSKGAVTPVKNQ 136



>pir|T07851|T07851 ananain (EC 3.4.22.31) precursor AN11 -
           pineapple>gb:ACO9830_1745389 Ananas comosus mRNA for
           stem cysteine proteinase precursor, clone pAN11.
          Length = 357

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 39/125 (31%), Positives = 63/125 (50%), Gaps = 1/125 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G+VY+D +E   RFQ FK N+ ++  +T   R       +G+N+
Sbjct: 29  PSDPMMKRFEEWMAEYGRVYKDNDEKMRRFQIFKNNVNHI--ETFNSRNGN-SYTLGINQ 85

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+ N EF   +T  + +P   +++ +     V              P S+DWR  GAV
Sbjct: 86  FTDMTNNEFVAQYTG-VSLPLNIEREPVVSFDDVDIS---------AVPQSIDWRNYGAV 135

Query: 610 TRVKD 624
           T VK+
Sbjct: 136 TSVKN 140



>gb:AY700588_1623606 Zingiber officinale cysteine protease gp3b
           mRNA, complete cds.
          Length = 466

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 35/124 (28%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+V  +++EW+ ++     D+   + R + FK NL++V E            ++G+N+F
Sbjct: 36  DEEVRIIYQEWRAKHRPAENDQYVGDYRLEVFKENLRFVDEHNAAADRGEHAYRLGMNRF 95

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  F   +    R   G       +   + + +     P S+DWR++GAV  
Sbjct: 96  ADLTNEEYRARFLRDLSRLGRSTSG-------EISNQYRLREGDVLPDSIDWREKGAVVA 148

Query: 616 VKDQ 627
           VK Q
Sbjct: 149 VKSQ 152



>gb:AY700587_1623605 Zingiber officinale cysteine protease gp3a
           mRNA, complete cds.
          Length = 475

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 35/124 (28%), Positives = 63/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E+V  +++EW+ ++     D+   + R + FK NL++V E            ++G+N+F
Sbjct: 45  DEEVRIIYQEWRVKHRPAENDQYVGDYRLEVFKENLRFVDEHNAAADRGEHAYRLGMNRF 104

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEE++  F   +    R   G       +   + + +     P S+DWR++GAV  
Sbjct: 105 ADLTNEEYRARFLRDLSRLGRSTSG-------EISNQYRLREGDVLPDSIDWREKGAVVA 157

Query: 616 VKDQ 627
           VK+Q
Sbjct: 158 VKNQ 161



>gb:AB008267_1510432 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMG4.>gb:AY062608_1565264 Arabidopsis thaliana
           cysteine protease component of protease-inhibitor
           complex (At5g43060; MMG4.7) mRNA, complete
           cds.>gb:AY114661_1578703 Arabidopsis thaliana cysteine
           protease component of protease-inhibitor complex
           (At5g43060) mRNA, complete cds.
          Length = 463

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEE----EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVG 423
           + +V R++E W   +GK   ++     E ++RF+ FK NL+++ E            K+G
Sbjct: 43  DSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNLRFIDEHNT----KNLSYKLG 98

Query: 424 LNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRG 603
           L +FADL NEE++ ++      P ++         +++    + +V    P SVDWRK G
Sbjct: 99  LTRFADLTNEEYRSMYLGA--KPTKR--------VLKTSDRYQARVGDALPDSVDWRKEG 148

Query: 604 AVTRVKDQ 627
           AV  VKDQ
Sbjct: 149 AVADVKDQ 156



>sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1
           precursor (EC 3.4.22.-).>pir|E85435|E85435 cysteine
           proteinase (EC 3.4.22.-) precursor [imported] -
           Arabidopsis thaliana>gb:ATAP21_1544009 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547643 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 376

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 8/132 (6%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEE----EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVG 423
           +E+V  ++ +W   +GK   +      + ++RF  FK NL+++       + + +  K+G
Sbjct: 42  DEEVRSIYLQWSAEHGKTNNNNNGIINDQDKRFNIFKDNLRFIDLHNEDNKNATY--KLG 99

Query: 424 LNKFADLRNEEFKDVFTSKIKMPFRK----KQGIQMVSAVQSGREKKKKVSCEAPFSVDW 591
           L KF DL N+E++ ++      P R+    K   Q  SA  +G+E         P +VDW
Sbjct: 100 LTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKE--------VPETVDW 151

Query: 592 RKRGAVTRVKDQ 627
           R++GAV  +KDQ
Sbjct: 152 RQKGAVNPIKDQ 163



>gb:D38534_1674561 Ananas comosus mRNA for FB1035 precursor, partial
           cds.
          Length = 324

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G++Y+D +E   RFQ FK N+K++  +T   R       +G+N+
Sbjct: 2   PNDPMMKRFEEWMAEYGRIYKDNDEKMRRFQIFKNNVKHI--ETFNSRNGN-SYTLGINQ 58

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+   EF   +T  + +P   +++ +     V              P S+DWR  GAV
Sbjct: 59  FTDMTKSEFVAQYTG-VSLPLNIEREPVVSFDDVNIS---------AVPQSIDWRDYGAV 108

Query: 610 TRVKDQ 627
             VK+Q
Sbjct: 109 NEVKNQ 114



>gb:AF190653_1249496 Diabrotica virgifera virgifera cathepsin L-like
           cysteine proteinase CAL1 (CAL1) mRNA, partial cds.
          Length = 322

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 43/118 (36%), Positives = 59/118 (50%), Gaps = 1/118 (0%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           +E +K ++GKVY++  E   RF  F+ NLK + E             + +N+FAD+  EE
Sbjct: 21  WESFKVQHGKVYKNPIEERVRFSVFQANLKTINEHNAKYEQGLVGYTMAVNQFADMTPEE 80

Query: 457 FKDVFTSKIK-MPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FK     + K MP  KK                K V+ E P SVDWR++GAV  VKDQ
Sbjct: 81  FKAKLGMQAKNMPKIKKS------------RHVKNVNAEVPDSVDWRQKGAVLGVKDQ 126



>pir|T10518|T10518 fruit bromelain (EC 3.4.22.33) FB1035 precursor -
           pineapple  (fragment)
          Length = 324

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + +++ FEEW    G++Y+D +E   RFQ FK N+K++  +T   R       +G+N+
Sbjct: 2   PNDPMMKRFEEWMAEYGRIYKDNDEKMRRFQIFKNNVKHI--ETFNSRNGN-SYTLGINQ 58

Query: 433 FADLRNEEFKDVFTSKIKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           F D+   EF   +T  + +P   +++ +     V              P S+DWR  GAV
Sbjct: 59  FTDMTKSEFVAQYTG-VSLPLNIEREPVVSFDDVNIS---------AVPQSIDWRDYGAV 108

Query: 610 TRVKDQ 627
             VK+Q
Sbjct: 109 NEVKNQ 114



>gb:AC092556_1735445 Oryza sativa chromosome 3 BAC OSJNBa0047E24
           genomic sequence, complete sequence.>gb:AC135225_1742100
           Oryza sativa chromosome 3 BAC OJ1112_G08 genomic
           sequence, complete sequence.>gb:AF377947_1793303 Oryza
           sativa (japonica cultivar-group) chromosome 3, BAC clone
           OSJNBa0032E21, complete sequence.
          Length = 350

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 42/121 (34%), Positives = 59/121 (48%), Gaps = 5/121 (4%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-----KTVGGRGSRWEGKVGLNKFADL 444
           E+W  ++GK Y+DEEE   R + F+ N K +       +  GG G R    +  N+FADL
Sbjct: 43  EKWMAKHGKTYKDEEEKARRLEVFRANAKLIDSFNAAAEKDGGGGHR----LATNRFADL 98

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            ++EF+   T   + P         V+    G   +      AP S+DWR  GAVT VKD
Sbjct: 99  TDDEFRAARTGYQRPP-------AAVAGAGGGFLYENFSLAAAPQSMDWRAMGAVTGVKD 151

Query: 625 Q 627
           Q
Sbjct: 152 Q 152



>gb:AB098624_1526115 Daucus carota DcCysP1 mRNA for cysteine
           protease, complete cds.
          Length = 474

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 45/126 (35%), Positives = 62/126 (49%), Gaps = 3/126 (2%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           +++L L+E W  ++ K Y    E E RF  FK N+ +V         S    K+GLNKFA
Sbjct: 54  DQLLSLYESWLVKHHKNYNALGEKETRFGIFKDNVGFVDRHNSMRNQSY---KLGLNKFA 110

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKV---SCEAPFSVDWRKRGAV 609
           DL N+E++ ++ S   M   +K         + G    + V       P SVDWR RGAV
Sbjct: 111 DLTNDEYRSLYLSGKMMKRERKN--------EDGFRSDRFVFEDGDHLPESVDWRDRGAV 162

Query: 610 TRVKDQ 627
             VKDQ
Sbjct: 163 APVKDQ 168



>pir|F84672|F84672 probable cysteine proteinase [imported] -
           Arabidopsis thaliana>gb:AC006232_1533749 Arabidopsis
           thaliana chromosome 2 clone F10A12 map B68, complete
           sequence.>gb:AY064033_1565971 Arabidopsis thaliana
           putative cysteine proteinase (At2g27420) mRNA, complete
           cds.>gb:AY096388_1575934 Arabidopsis thaliana putative
           cysteine proteinase (At2g27420) mRNA, complete cds.
          Length = 348

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 43/128 (33%), Positives = 65/128 (50%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E   +   E+W  R  +VY DE E   RF  FK NL++V+   +  + +    KV +N+F
Sbjct: 28  EASAIEKHEQWMARFNRVYSDETEKRNRFNIFKKNLEFVQNFNMNNKITY---KVDINEF 84

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGRE----KKKKVSCEAPFSVDWRKRG 603
           +DL +EEF+   T  +       + I  +S + SG+     +   VS     S+DWR+ G
Sbjct: 85  SDLTDEEFRATHTGLV-----VPEAITRISTLSSGKNTVPFRYGNVSDNGE-SMDWRQEG 138

Query: 604 AVTRVKDQ 627
           AVT VK Q
Sbjct: 139 AVTPVKYQ 146



>gb:AY504967_1609833 Iris hollandica putative cysteine protease 2
           (CYS2) mRNA, complete cds.
          Length = 359

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 44/124 (35%), Positives = 64/124 (51%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V RD  E  +RF  FK N K++ E     + + +  K+GLNKF
Sbjct: 33  EESLWGLYERWRSHH-TVSRDLSEKNKRFNVFKENAKFIHE--FNKKDAPY--KLGLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N+EF+  +        R ++G        +G    + V    P SVDWR +GAV  
Sbjct: 88  ADMTNQEFRSTYAGSKIHHHRTQRGTPRA----TGSFMYENVH-SIPASVDWRTQGAVAP 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>sp|Q9SUS9|CPR4_ARATH Putative cysteine proteinase At4g11320
           precursor (EC 3.4.22.-).>pir|T13023|T13023
           drought-inducible cysteine proteinase (EC 3.4.22.-)
           F8L21.110 - Arabidopsis thaliana>gb:ATCHRIV31_1544897
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 31.>gb:ATF8L21_1551243 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8L21 (ESSA
           project).>gb:AY035055_1559832 Arabidopsis thaliana
           putative cysteine proteinase (At4g11320) mRNA, complete
           cds.>gb:AY051062_1562537 Arabidopsis thaliana putative
           cysteine proteinase (At4g11320) mRNA, complete cds.
          Length = 371

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 42/118 (35%), Positives = 55/118 (46%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           +FE W  ++GKVY    E E R   F+ NL+++  +       R    +GLN+FADL   
Sbjct: 55  MFESWMVKHGKVYDSVAEKERRLTIFEDNLRFITNRNAENLSYR----LGLNRFADLSLH 110

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           E+ ++       P R       V    S R K        P SVDWR  GAVT VKDQ
Sbjct: 111 EYGEICHGADPRPPRNH-----VFMTSSNRYKTSDGDV-LPKSVDWRNEGAVTEVKDQ 162



>gb:AY850168_2149903 Cloning vector pQ-CPB recombinant cysteine
           protease mRNA, partial cds.
          Length = 335

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K+   +VY   +E ++R  NF+ NL+ ++E       +R+    G+ KF DL  E
Sbjct: 29  LFEEFKQTYQRVYATLDEEQQRLANFQRNLELMREHQANNPHARF----GITKFFDLSEE 84

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE---APFSVDWRKRGAVTRVKD 624
           EF   + S                A +   +  +KV  +   AP +VDWR++GAVT VKD
Sbjct: 85  EFATRYLSG---------ATHFAKAKKFASQYYRKVGADLSTAPAAVDWREKGAVTPVKD 135

Query: 625 Q 627
           Q
Sbjct: 136 Q 136



>gb:AF343446_1789638 Actinidia chinensis actinidin protease mRNA,
           complete cds.
          Length = 380

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 41/123 (33%), Positives = 59/123 (47%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++V  ++E W  + GK Y    E+E RF+ FK  L+++ E       S    KVGLN+FA
Sbjct: 36  DEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSY---KVGLNQFA 92

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEF+  +     + F        VS        + +V    P  VDWR  GAV  +
Sbjct: 93  DLTDEEFRSTY-----LRFTSGSNKTKVS-----NRYEPRVGQVLPSYVDWRSAGAVVDI 142

Query: 619 KDQ 627
           K Q
Sbjct: 143 KSQ 145



>gb:AY700586_1623604 Zingiber officinale cysteine protease gp2b
           mRNA, complete cds.
          Length = 379

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 42/126 (33%), Positives = 65/126 (51%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERN--GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN 429
           +E+V  L+ EW+ +N   + Y D  EY  R + FK NL++V +            ++G+N
Sbjct: 44  DEEVRMLYLEWRAKNHPAEKYLDLNEY--RLEVFKENLQFVDKHNAAADRGEHTFRLGMN 101

Query: 430 KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           +FADL NEE++  F        R   G   +S+    RE       + P S+DWR++GAV
Sbjct: 102 RFADLTNEEYRTRFLRDFSRLRRSASG--KISSRYRLRE-----GDDLPDSIDWREKGAV 154

Query: 610 TRVKDQ 627
             VK+Q
Sbjct: 155 VPVKNQ 160



>pir|S12618|TAGB actinidain (EC 3.4.22.14) precursor - kiwi
           fruit>gb:ACTACT_1745418 Actinidia deliciosa actinidin
           gene, complete cds.
          Length = 380

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 41/123 (33%), Positives = 59/123 (47%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++V  ++E W  + GK Y    E+E RF+ FK  L+++ E       S    KVGLN+FA
Sbjct: 36  DEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSY---KVGLNQFA 92

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEF+  +     + F        VS        + +V    P  VDWR  GAV  +
Sbjct: 93  DLTDEEFRSTY-----LGFTSGSNKTKVS-----NRYEPRVGQVLPSYVDWRSAGAVVDI 142

Query: 619 KDQ 627
           K Q
Sbjct: 143 KSQ 145



>sp|P25803|CYSP_PHAVU Vignain precursor (EC 3.4.22.-) (Bean
           endopeptidase) (Cysteine proteinase
           EP-C1).>gb:PVENDO_1702939 P.vulgaris gene for
           endopeptidase.
          Length = 362

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 48/125 (38%), Positives = 66/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E  +RF  FK NL +V       +      K+ LNKF
Sbjct: 33  EESLWDLYERWRSHH-TVSRSLGEKHKRFNVFKANLMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           AD+ N EF+  +  SK+  P R  +G    +  ++G    +KV    P SVDWRK+GAVT
Sbjct: 88  ADMTNHEFRSTYAGSKVNHP-RMFRG----TPHENGAFMYEKV-VSVPPSVDWRKKGAVT 141

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 142 DVKDQ 146



>gb:AF133839_1770952 Sandersonia aurantiaca papain-like cysteine
           protease (PRT5) mRNA, complete cds.
          Length = 357

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 42/124 (33%), Positives = 66/124 (53%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E W+  +  V RD ++ ++RF  FK N+K++ E     +      K+ LNKF
Sbjct: 31  EDSLWSLYERWRSHHA-VSRDLDQKQKRFNVFKENVKFIHEFN---KNKDVTFKLALNKF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+ N+EF+  +        R  +G +  S   SG  K    +  AP S+DWR+RGAV  
Sbjct: 87  GDMTNQEFRAKYAGSKVHHHRTMKGSRHGSG--SGA-KFMYENAVAPPSIDWRERGAVAA 143

Query: 616 VKDQ 627
           VK+Q
Sbjct: 144 VKNQ 147



>gb:AF083753_1766983 Arabidopsis thaliana clone sps565 unknown mRNA.
          Length = 142

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 1/110 (0%)
 Frame = +1

Query: 283 EWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFK 462
           EW  ++G+VY D +E   R+  FK N++ ++       G  +  K+ +N+FADL N+EF+
Sbjct: 40  EWMTKHGRVYADVKEENNRYVVFKNNVERIEHLNSIPAGRTF--KLAVNQFADLTNDEFR 97

Query: 463 DVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAV 609
            ++T      F+    +   S  +    + + VS  A P SVDWRK+GAV
Sbjct: 98  SMYTG-----FKGVSALSSQSQTKMSPFRYQNVSSGALPVSVDWRKKGAV 142



>gb:AY093066_1575020 Arabidopsis thaliana drought-inducible cysteine
           proteinase RD21A precursor-like protein (At4g11310)
           mRNA, complete cds.>gb:BT000099_1634377 Arabidopsis
           thaliana drought-inducible cysteine proteinase RD21A
           precursor-like protein (At4g11310) mRNA, complete cds.
          Length = 357

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 41/118 (34%), Positives = 53/118 (44%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           +FE W  ++GKVY    E E R   F+ NL+++  +       R    +GL  FADL   
Sbjct: 41  IFESWMVKHGKVYGSVAEKERRLTIFEDNLRFINNRNAENLSYR----LGLTGFADLSLH 96

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           E+K+V       P R          + S    K       P SVDWR  GAVT VKDQ
Sbjct: 97  EYKEVCHGADPRPPRNH------VFMTSSDRYKTSADDVLPKSVDWRNEGAVTEVKDQ 148



>gb:TBR297265_1399271 Trypanosoma brucei rhodesiense partial mRNA
           for cysteine protease (rhodesain gene).
          Length = 450

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 41/125 (32%), Positives = 64/125 (51%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F  +K++ GKVY+D +E   RF+ F+ N++  K +      + +    G+  F
Sbjct: 34  EESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQAKIQAAANPYATF----GVTPF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+           R + G    +A Q    K   V+   AP +VDWR++GAVT
Sbjct: 90  SDMTREEFRA----------RYRNGASYFAAAQKRLRKTVNVTTGRAPAAVDWREKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 PVKDQ 144



>sp|Q9SUT0|CPR3_ARATH Putative cysteine proteinase At4g11310
           precursor (EC 3.4.22.-).>pir|T13022|T13022
           drought-inducible cysteine proteinase (EC 3.4.22.-)
           F8L21.100 - Arabidopsis thaliana>gb:ATCHRIV31_1544896
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 31.>gb:ATF8L21_1551242 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F8L21 (ESSA project).
          Length = 364

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 41/118 (34%), Positives = 53/118 (44%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           +FE W  ++GKVY    E E R   F+ NL+++  +       R    +GL  FADL   
Sbjct: 48  IFESWMVKHGKVYGSVAEKERRLTIFEDNLRFINNRNAENLSYR----LGLTGFADLSLH 103

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           E+K+V       P R          + S    K       P SVDWR  GAVT VKDQ
Sbjct: 104 EYKEVCHGADPRPPRNH------VFMTSSDRYKTSADDVLPKSVDWRNEGAVTEVKDQ 155



>gb:AP006170_1861285 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBa0042B15.>gb:AP006171_1861292 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0070E11.
          Length = 374

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 46/128 (35%), Positives = 62/128 (48%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVY---RDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGL 426
           EE +  L++ W+   G      RD  +   RF+ FK N +Y+ +     R      K+GL
Sbjct: 36  EESMWSLYQRWRHVYGAASSSPRDLADKGSRFEVFKKNARYIHDFN---RKKGMSYKLGL 92

Query: 427 NKFADLRNEEFKDVFTSKIKMPFRK-KQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRG 603
           NKFADL  EEF   +T     P    K G        +G      V+ +AP + DWR+ G
Sbjct: 93  NKFADLTLEEFTAKYTGANPGPITGLKNG--------TGSPPLAAVAGDAPPAWDWREHG 144

Query: 604 AVTRVKDQ 627
           AVTRVKDQ
Sbjct: 145 AVTRVKDQ 152



>gb:AP003724_1832447 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0498C03.
          Length = 357

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 35/117 (29%), Positives = 57/117 (48%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           +E+W   +G+ Y+D  E   RF+ F+ N  ++   +    G +   ++  NKFADL NEE
Sbjct: 49  YEKWAADHGRTYKDSLEKARRFEVFRTNALFID--SFNAAGGKKSPRLTTNKFADLTNEE 106

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F + +      P     G    +   S          + P +++WR RGAVT+VK+Q
Sbjct: 107 FAEYYGRPFSTPVIGGSGFMYGNVRTS----------DVPANINWRDRGAVTQVKNQ 153



>gb:NTU57825_1691844 Nicotiana tabacum endopeptidase-like protein
           mRNA, partial cds.
          Length = 156

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 6/130 (4%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EEK+  L+E W+  +  V R  +E ++RF  FK N+ YV       +      K+ LNKF
Sbjct: 31  EEKLWELYERWRSHH-TVSRSLDEKDKRFNVFKANVHYVHNFNKKDKPY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFT-SKIK-----MPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRK 597
           AD+ N EF+  +  SKIK     +   +  G  M +   S            P +VDWRK
Sbjct: 86  ADMTNHEFRHHYAGSKIKHHRTFLGASRANGTFMYAHEDS-----------VPPTVDWRK 134

Query: 598 RGAVTRVKDQ 627
           +GAVT VKDQ
Sbjct: 135 KGAVTPVKDQ 144



>gb:AY700585_1623603 Zingiber officinale cysteine protease gp2a
           mRNA, complete cds.
          Length = 381

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 49/161 (30%), Positives = 73/161 (45%), Gaps = 5/161 (3%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVP---EEKVLRLFEEWKERN--GKVYRDEE 324
           L+ L+ ++      S  Y            VP   +E+V  L+ EW+ +N   + Y D  
Sbjct: 11  LLLLLSSSALAAVSSAPYQDVLTLSKQGGAVPVRSDEEVRMLYLEWRVKNHPAEKYLDLN 70

Query: 325 EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKK 504
           EY  R + FK NL++V E             +G+N+FADL NEE++  F        R  
Sbjct: 71  EY--RLEVFKENLQFVDEHNAAADRGEHTFLLGMNRFADLTNEEYRTRFLRDFSRLRRSA 128

Query: 505 QGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
            G   +S+    RE       + P S+DWR+ GAV  VK+Q
Sbjct: 129 SG--KISSRYRLRE-----GDDLPDSIDWRENGAVVPVKNQ 162



>gb:AY662993_1620480 Petunia x hybrida cysteine proteinase (CP7)
           mRNA, partial cds.
          Length = 210

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 40/111 (36%), Positives = 64/111 (57%)
 Frame = +1

Query: 295 RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFT 474
           ++GK+Y   EE   RF+ FK NLK++ E+      + W   +GLN+F+DL ++EFK ++ 
Sbjct: 3   QHGKIYESIEEKLHRFEIFKENLKHIDERNKIV-SNYW---LGLNEFSDLSHDEFKKMYL 58

Query: 475 SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                   K     + +  QS ++ + +   + P SVDWRK+GAVT VK+Q
Sbjct: 59  GL------KVDHDLLNNKKQSQQDFEYRDFVDLPKSVDWRKKGAVTPVKNQ 103



>gb:AC116956_1206524 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 358

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 6/123 (4%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F  W +++ K+Y+D  E E RF NFK N+K   E      G   + K   N F+DL  EE
Sbjct: 44  FNHWAKKHSKIYKDSIEMENRFSNFKENMKKNIELNSMHAG---KAKFESNGFSDLSEEE 100

Query: 457 FKDVFTSKI--KMPFRKKQGIQMV----SAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           F +   +K     P   +  I+       ++ +G ++ +       +S+DWRK+G VT V
Sbjct: 101 FSNFHLNKAFKGKPSHLRNSIKPQPTPHHSLINGYKEMENGDLNELYSIDWRKKGLVTPV 160

Query: 619 KDQ 627
           KDQ
Sbjct: 161 KDQ 163



>pir|T02166|T02166 cysteine proteinase (EC 3.4.22.-) precursor -
           common tobacco (fragment)
          Length = 156

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 6/130 (4%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EEK+  L+E W+  +  V R  +E ++RF  FK N+ YV       +      K+ LNKF
Sbjct: 31  EEKLWELYERWRSHH-TVSRSLDEKDKRFNVFKANVHYVHNFNKKDKPY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFT-SKIK-----MPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRK 597
           AD+ N EF+  +  SKIK     +   +  G  M +   S            P +VDWRK
Sbjct: 86  ADMTNHEFRHHYAGSKIKHHRTFLGASRANGTFMYAHEDS-----------VPPTVDWRK 134

Query: 598 RGAVTRVKDQ 627
           +GAVT VKDQ
Sbjct: 135 KGAVTPVKDQ 144



>pir|S12099|S12099 cysteine proteinase (EC 3.4.22.-) precursor -
           Trypanosoma brucei>gb:TBCSTPRO_1398998 Trypanosome mRNA
           for a cysteine protease.
          Length = 450

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 41/125 (32%), Positives = 64/125 (51%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F  +K++ GKVY+D +E   RF+ F+ N++  K +      + +    G+  F
Sbjct: 34  EESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQAKIQAAANPYATF----GVTPF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+           R + G    +A Q    K   V+   AP +VDWR++GAVT
Sbjct: 90  SDMTREEFRA----------RYRNGASYFAAAQKRVRKTVNVTTGRAPAAVDWREKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 PVKDQ 144



>pir|T06708|T06708 cysteine proteinase (EC 3.4.22.-) T29H11.140 -
           Arabidopsis thaliana>gb:ATT29H11_1555646 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T29H11.
          Length = 361

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 45/125 (36%), Positives = 62/125 (49%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L++ W+  +  V R   E E+RF  F+ N+ +V       R      K+ LNKF
Sbjct: 31  EEGLSTLYDRWRSHHS-VPRSLNEREKRFNVFRHNVMHVHNTNKKNRSY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSA-VQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           ADL   EFK+ +T       R  QG +  S       E   K+    P SVDWRK+GAVT
Sbjct: 86  ADLTINEFKNAYTGSNIKHHRMLQGPKRGSKQFMYDHENLSKL----PSSVDWRKKGAVT 141

Query: 613 RVKDQ 627
            +K+Q
Sbjct: 142 EIKNQ 146



>sp|P54639|CYS4_DICDI Cysteine proteinase 4 precursor (EC
           3.4.22.-).>gb:DDICYSPROA_1377041 Dictyostelium
           discoideum cysteine proteinase (CP4) mRNA, complete cds.
          Length = 442

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 43/118 (36%), Positives = 66/118 (55%), Gaps = 1/118 (0%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKE-KTVGGRGSRWEGKVGLNKFADLRNE 453
           F  W + + + Y   EE+  R+Q FK N+ YV +  + GG     E  +GLN FAD+ N+
Sbjct: 30  FTNWMQAHQRTY-SSEEFNARYQIFKSNMDYVHQWNSKGG-----ETVLGLNVFADITNQ 83

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           E++   T+ +  PF    G  ++     G E++K  S  AP +VDWR +GAVT +K+Q
Sbjct: 84  EYR---TTYLGTPF---DGSALI-----GTEEEKIFSTPAP-TVDWRAQGAVTPIKNQ 129



>gb:AP006170_1861279 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 416

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 45/127 (35%), Positives = 62/127 (48%), Gaps = 3/127 (2%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVY---RDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGL 426
           EE +  L+E W+     VY   RD  + E RF+ FK N +Y+ E     +G  +   +GL
Sbjct: 19  EESMWSLYERWRA----VYAPSRDLSDMESRFEVFKANARYIHEFNQKSKGMSYV--LGL 72

Query: 427 NKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGA 606
           NKF+DL  EEF   +T        K       +A  S  +++  V    P + DWR  GA
Sbjct: 73  NKFSDLTYEEFAAKYTGV------KVDASAFATATTSSPDEELPVGVP-PATWDWRLNGA 125

Query: 607 VTRVKDQ 627
           VT VKDQ
Sbjct: 126 VTDVKDQ 132



>gb:PVEPC1_1702940 Phaseolus vulgaris mRNA for endopeptidase
           (EP-C1).
          Length = 361

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 45/124 (36%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E  +RF  FK NL +V       +      K+ LNKF
Sbjct: 32  EESLWDLYERWRSHH-TVSRSLGEKHKRFNVFKANLMHVHNTNKMDKPY----KLKLNKF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        R  +G    +  ++G    +KV    P SVDWRK+GAVT 
Sbjct: 87  ADMTNHEFRSTYAGSKVNHHRMFRG----TPHENGAFMYEKV-VSVPPSVDWRKKGAVTD 141

Query: 616 VKDQ 627
           VKDQ
Sbjct: 142 VKDQ 145



>gb:AB109187_1526792 Helianthus annuus scp2 mRNA for cysteine
           protease-2, complete cds.
          Length = 362

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 47/126 (37%), Positives = 65/126 (51%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  ++E W+    KV  +  E   RF  FK N+ +V E     +      K+ LNKF
Sbjct: 33  EDNLWDMYERWRH---KVATNHGEKLRRFNVFKSNVLHVHETNKMDKPY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAV 609
           AD+ N EF+ V+  SKI    R  QG +      SG +     + E+ P SVDWRK+GAV
Sbjct: 86  ADMTNHEFRSVYAGSKIHHHDRSLQGDR------SGSKTFMYANVESVPTSVDWRKKGAV 139

Query: 610 TRVKDQ 627
             VKDQ
Sbjct: 140 APVKDQ 145



>pir|S22502|S22502 cysteine proteinase (EC 3.4.22.-) - kidney bean
          Length = 362

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 45/124 (36%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E  +RF  FK NL +V       +      K+ LNKF
Sbjct: 33  EESLWDLYERWRSHH-TVSRSLGEKHKRFNVFKANLMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        R  +G    +  ++G    +KV    P SVDWRK+GAVT 
Sbjct: 88  ADMTNHEFRSTYAGSKVNHHRMFRG----TPHENGAFMYEKV-VSVPPSVDWRKKGAVTD 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>sp|P12412|CYSP_VIGMU Vignain precursor (EC 3.4.22.-) (Bean
           endopeptidase) (Cysteine proteinase)
           (Sulfhydryl-endopeptidase) (SH-EP).>pir|S12581|S12581
           cysteine proteinase (EC 3.4.22.-) precursor - black
           gram>gb:VMSHEP_1727281 Vigna mungo mRNA for
           sulfhydryl-endopeptidase.>gb:VMSHEPG_1727282 Vigna mungo
           gene for sulfhydryl-endopeptidase.
          Length = 362

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 45/124 (36%), Positives = 61/124 (49%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E  +RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EESLWDLYERWRSHH-TVSRSLGEKHKRFNVFKANVMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        +  +G Q      SG    +KV    P SVDWRK+GAVT 
Sbjct: 88  ADMTNHEFRSTYAGSKVNHHKMFRGSQH----GSGTFMYEKVG-SVPASVDWRKKGAVTD 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>sp|O65039|CYSP_RICCO Vignain precursor (EC 3.4.22.-) (Cysteine
           endopeptidase).>pir|T08122|T08122 cysteine endopeptidase
           (EC 3.4.22.-) precursor - castor
           bean>gb:AF050756_1764184 Ricinus communis cysteine
           endopeptidase precursor (CysEP) mRNA, complete cds.
          Length = 360

 Score = 62.0 bits (149), Expect = 8e-09
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E ++RF  FK N  +V       +      K+ LNKF
Sbjct: 31  EESLWGLYERWRSHH-TVSRSLHEKQKRFNVFKHNAMHVHNANKMDKPY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           AD+ N EF++ ++ SK+K     + G +      +G    +KV    P SVDWRK+GAVT
Sbjct: 86  ADMTNHEFRNTYSGSKVKHHRMFRGGPR-----GNGTFMYEKVDT-VPASVDWRKKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 SVKDQ 144



>gb:AF194426_2479445 Myxine glutinosa clone hicl20 cysteine
           proteinase precursor, mRNA, complete cds.
          Length = 324

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/117 (34%), Positives = 56/117 (47%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           +E WK + GK Y    E   R + ++ NL+ V++  V     +   ++G+N +ADL NEE
Sbjct: 19  WESWKGKYGKSYLGRGEEVLRKRVWESNLQIVQQHNVLADQGQANYRLGMNTYADLYNEE 78

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F         M  +   GI       S +  K  V    P SVDWR +G VT VKDQ
Sbjct: 79  F---------MALKGSSGILQAKDQSSTQTFKPLVGVTLPSSVDWRNQGYVTPVKDQ 126



>gb:AY563270_1615020 Bromelia fastuosa fastuosain precursor mRNA,
           partial cds.
          Length = 324

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 6/131 (4%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           P + ++  FEEW    G+VY D  E   RFQ FK N+ ++  +T   R       +G+N+
Sbjct: 2   PSDPMMERFEEWMAEYGRVYNDNAEKMRRFQIFKNNVNHI--ETFNNRSGN-SYTLGVNQ 58

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE------APFSVDWR 594
           F D+ N EF   +T                +++    E+   VS +       P S+DWR
Sbjct: 59  FTDMTNNEFLARYTG---------------ASLPLNIERDPVVSFDDVDISAVPQSIDWR 103

Query: 595 KRGAVTRVKDQ 627
             GAVT VK+Q
Sbjct: 104 DYGAVTSVKNQ 114



>gb:AB098625_1526116 Daucus carota DcCysP2 mRNA for cysteine
           protease, complete cds.
          Length = 365

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 41/124 (33%), Positives = 64/124 (51%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E  +    ++W  R G+VY+   E   R   F+ NLKY++      + +    K+G+N+F
Sbjct: 32  EASMTETHDQWMARYGRVYKTANEKNRRSTIFQENLKYIQ---TFNKANNKPYKLGVNEF 88

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL NEEF    TS+ K           V A  +   + + V+   P ++DWRK+GAVT 
Sbjct: 89  ADLTNEEFT---TSRNKFK-------SHVCATVTNVFRYENVTA-VPATMDWRKKGAVTP 137

Query: 616 VKDQ 627
           +K+Q
Sbjct: 138 IKNQ 141



>gb:AB004819_1509189 Oryza sativa Rep1 gene for cysteine
           endopeptidase, complete cds.>gb:AP003380_1828843 Oryza
           sativa (japonica cultivar-group) genomic DNA, chromosome
           1, PAC clone:P0497A05.>gb:AP006531_1862300 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1417F08.
          Length = 371

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTV-GGRGSRWEGKVGLNK 432
           +E +  L+E W+E +  V R   E   RF  FK N++Y+ E    GGRG R    + LN+
Sbjct: 39  DEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYIHEHNKRGGRGYR----LRLNR 93

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT 612
           F D+  EEF+  F        R+  G+          E  +    + P +VDWR++GAVT
Sbjct: 94  FGDMGREEFRATFAGSHANDLRR-DGLAAPPLPGFMYEGVR----DLPRAVDWRRKGAVT 148

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 149 GVKDQ 153



>sp|P00785|ACTN_ACTCH Actinidain precursor (EC 3.4.22.14)
           (Actinidin) (Allergen Act c 1).>gb:ACTINID_1745424
           Actinidia deliciosa actinidin gene for
           actinidin/cysteine protease.
          Length = 380

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 40/123 (32%), Positives = 58/123 (47%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           ++V  ++E W  + GK Y    E+E RF+ FK  L+++ E       S    KVGLN+FA
Sbjct: 36  DEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSY---KVGLNQFA 92

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL +EEF+  +     + F        VS        + +     P  VDWR  GAV  +
Sbjct: 93  DLTDEEFRSTY-----LGFTSGSNKTKVS-----NRYEPRFGQVLPSYVDWRSAGAVVDI 142

Query: 619 KDQ 627
           K Q
Sbjct: 143 KSQ 145



>gb:VRU49445_1727379 Vigna radiata cysteinyl endopeptidase mRNA,
           complete cds.
          Length = 362

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 44/124 (35%), Positives = 61/124 (49%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   E  +RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EESLWDLYERWRSHH-TVSRSLTEKHKRFNVFKENVMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        +  +G Q      +G    +KV    P SVDWRK+GAVT 
Sbjct: 88  ADMTNHEFRSTYAGSKVNHHKMFRGTQH----GNGTFMYEKVG-SVPASVDWRKKGAVTD 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>sp|P04988|CYS1_DICDI Cysteine proteinase 1 precursor (EC
           3.4.22.-).>pir|A22827|KHDO cysteine proteinase 1 (EC
           3.4.22.-) precursor - slime mold  (Dictyostelium
           discoideum)>gb:DDCPRO1R_1376880 D.discoideum mRNA for
           cysteine proteinase 1.
          Length = 343

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 42/131 (32%), Positives = 68/131 (51%), Gaps = 6/131 (4%)
 Frame = +1

Query: 253 PEEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           PEE+    F E++++  K Y   EEY ERF+ FK NL  ++E  +     + + K G+NK
Sbjct: 23  PEEQ--SQFLEFQDKFNKKY-SHEEYLERFEIFKSNLGKIEELNLIAINHKADTKFGVNK 79

Query: 433 FADLRNEEFKDVFTSKIK------MPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWR 594
           FADL ++EFK+ + +  +      +P       + ++++              P + DWR
Sbjct: 80  FADLSSDEFKNYYLNNKEAIFTDDLPVADYLDDEFINSI--------------PTAFDWR 125

Query: 595 KRGAVTRVKDQ 627
            RGAVT VK+Q
Sbjct: 126 TRGAVTPVKNQ 136



>sp|Q9LXW3|CPR2_ARATH Putative cysteine proteinase At3g43960
           precursor (EC 3.4.22.-).>pir|T48950|T48950 cysteine
           proteinase-like protein - Arabidopsis
           thaliana>gb:ATT15B3_1554503 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T15B3.>gb:AK118634_1816600
           Arabidopsis thaliana At3g43960 mRNA for putative
           cysteine proteinase, complete cds, clone: RAFL19-90-C07.
          Length = 376

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 47/125 (37%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E +VL ++E+W   NGK Y    E E RF+ FK NLK ++E       S    + GLNKF
Sbjct: 34  EGEVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNLKRIEEHNSDPNRSY---ERGLNKF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT- 612
           +DL  +EF+    S +     KK      S        + K     P  VDWR+RGAV  
Sbjct: 91  SDLTADEFQ---ASYLGGKMEKK------SLSDVAERYQYKEGDVLPDEVDWRERGAVVP 141

Query: 613 RVKDQ 627
           RVK Q
Sbjct: 142 RVKRQ 146



>gb:AP006170_1861282 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 361

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 43/128 (33%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRD-EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNK 432
           EE +  L+E W    G   RD  E+ + RF+ FK N +++ E     +      K+GLNK
Sbjct: 30  EESMWSLYERWSHVYGVSSRDLAEDKKSRFEVFKANARHIHEFN---KKEGMSYKLGLNK 86

Query: 433 FADLRNEEFKDVFTSKIKMPFRKKQGIQM---VSAVQSGREKKKKVSCEAPFSVDWRKRG 603
           F+D+  EEF   +T           G+Q+    + V S  +++  +  +AP   DWR  G
Sbjct: 87  FSDMTVEEFAAKYT-----------GVQVDAGAAVVTSAPDEQPVLVGDAPPVWDWRDHG 135

Query: 604 AVTRVKDQ 627
           AVT VKDQ
Sbjct: 136 AVTPVKDQ 143



>gb:AF194427_2479446 Myxine glutinosa clone hicl22 cysteine
           proteinase precursor, mRNA, partial cds.
          Length = 324

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 39/117 (33%), Positives = 56/117 (47%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           +E WK + GK Y    E   R + ++ NL+ V++  V     +   ++G+N +ADL NEE
Sbjct: 19  WESWKGKYGKSYLGRGEEVLRKRVWESNLQIVQQHNVLADQGQANYRLGMNTYADLYNEE 78

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F         M  +   G+       S +  K  V    P SVDWR +G VT VKDQ
Sbjct: 79  F---------MALKGSGGLLQAKDKSSTQTFKPLVGVTLPSSVDWRNQGYVTPVKDQ 126



>gb:AP002869_1823473 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0554D10.>gb:AP003143_1824885 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0489E06.
          Length = 357

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 39/121 (32%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +1

Query: 268 LRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLR 447
           +++FEEW  + GK Y+   E E RF  F+ N+++++        + ++  V +N+FADL 
Sbjct: 41  MQMFEEWMAKFGKTYKCHGEKEHRFAVFRDNVRFIRSYR---PEATYDSAVRINQFADLT 97

Query: 448 NEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVS-CEAPFSVDWRKRGAVTRVKD 624
           N EF   +T         KQ            E  + V     P  +DWR +GAVT VKD
Sbjct: 98  NGEFVATYTG-------VKQPPPATHPHPHPEEAPRPVDPIWMPCCIDWRFKGAVTGVKD 150

Query: 625 Q 627
           Q
Sbjct: 151 Q 151



>gb:AB024031_1515760 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K6A12.>gb:AY091087_1574314 Arabidopsis
           thaliana putative cysteine proteinase (At5g50260) mRNA,
           complete cds.
          Length = 361

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 45/130 (34%), Positives = 60/130 (46%), Gaps = 6/130 (4%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E  +  L+E W+  +  V R  EE  +RF  FK N+K++ E     +      K+ LNKF
Sbjct: 31  ENSLWELYERWRSHH-TVARSLEEKAKRFNVFKHNVKHIHETNKKDKSY----KLKLNKF 85

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC------EAPFSVDWRK 597
            D+ +EEF+  +        R  QG           EKK   S         P SVDWRK
Sbjct: 86  GDMTSEEFRRTYAGSNIKHHRMFQG-----------EKKATKSFMYANVNTLPTSVDWRK 134

Query: 598 RGAVTRVKDQ 627
            GAVT VK+Q
Sbjct: 135 NGAVTPVKNQ 144



>gb:TRBACYSPRO_1400578 Trypanosoma congolense cysteine protease
           mRNA, complete cds.
          Length = 444

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ + + F  +K++  + Y+D  E   RF+ FK N++  KE+      + +    G+ +F
Sbjct: 34  EQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKEEAAANPYATF----GVTRF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+  + +          G +  +A      K   VS  +AP +VDWRK+GAVT
Sbjct: 90  SDMSPEEFRATYHN----------GAEYYAAALKRPRKVVNVSTGKAPEAVDWRKKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 PVKDQ 144



>gb:AJ583511_1282280 Diabrotica virgifera virgifera mRNA for
           cathepsin L-like proteinase, clone DvRS30.
          Length = 326

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 39/119 (32%), Positives = 59/119 (49%), Gaps = 3/119 (2%)
 Frame = +1

Query: 280 EEW---KERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRN 450
           EEW   K RN K YR+  E ++RF  F+G+L+ ++             K+G+ KFADL  
Sbjct: 21  EEWVQFKVRNNKSYRNYIEEQKRFTIFQGSLRKIENHNDKYDHGLSTFKLGVTKFADLTE 80

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +EF D+          + + I  ++ V+           + P   DWR++GAVT VKDQ
Sbjct: 81  KEFSDMLGISRSTKSSRPRVIHSLTPVK-----------DLPSKFDWREKGAVTEVKDQ 128



>gb:PSA004958_1701891 Pisum sativum mRNA for TPE4A thiol-protease.
          Length = 360

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 41/124 (33%), Positives = 62/124 (50%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E W+  +  V R  +E   RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EKSLWDLYERWRSHH-TVTRSLDEKHNRFNVFKANVMHVHNTNKLDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+ ++        R  +G+      ++G    + V    P S+DWRK+GAVT 
Sbjct: 88  ADMTNYEFRRIYADSKVSHHRMFRGMSN----ENGTFMYENVK-NVPSSIDWRKKGAVTD 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>gb:AY662994_1620481 Petunia x hybrida cysteine proteinase (CP8)
           mRNA, partial cds.
          Length = 167

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 29/72 (40%), Positives = 45/72 (62%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +++++ L+E W  ++GK Y   +E ++RFQ FK NL Y+ E+      S    K+GL KF
Sbjct: 73  DDEIMSLYEAWLVQHGKSYNGLQEKDKRFQIFKDNLNYIDEQNSVPNKSY---KLGLTKF 129

Query: 436 ADLRNEEFKDVF 471
           ADL NEE+K  +
Sbjct: 130 ADLTNEEYKSTY 141



>gb:AY087918_1572943 Arabidopsis thaliana clone 39621 mRNA, complete
           sequence.
          Length = 376

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 47/125 (37%), Positives = 60/125 (48%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E  VL ++E+W   NGK Y    E E RF+ FK NLK ++E       S    + GLNKF
Sbjct: 34  EGGVLTMYEQWLVENGKNYNGLGEKERRFKIFKDNLKRIEEHNSDPNRSY---ERGLNKF 90

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVT- 612
           +DL  +EF+    S +     KK      S        + K     P  VDWR+RGAV  
Sbjct: 91  SDLTADEFQ---ASYLGGKMEKK------SLSDVAERYQYKEGDVLPDEVDWRERGAVVP 141

Query: 613 RVKDQ 627
           RVK Q
Sbjct: 142 RVKRQ 146



>gb:TCCYSPROT_1399672 T.congolense mRNA for (prepro) cysteine
           proteinase.
          Length = 442

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ + + F  +K++  + Y+D  E   RF+ FK N++  KE+      + +    G+ +F
Sbjct: 29  EQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKEEAAANPYATF----GVTRF 84

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+  + +          G +  +A      K   VS  +AP +VDWRK+GAVT
Sbjct: 85  SDMSPEEFRATYHN----------GAEYYAAALKRPRKVVNVSTGKAPPAVDWRKKGAVT 134

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 135 PVKDQ 139



>gb:AY336947_1320742 Anthonomus grandis cysteine proteinase (cys1)
           mRNA, complete cds.
          Length = 322

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 40/123 (32%), Positives = 56/123 (45%)
 Frame = +1

Query: 259 EKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFA 438
           EK   LFE +K  NGK YR++ E  +RF  F+ N+  +++            K  +N+F 
Sbjct: 20  EKHQALFETFKVENGKSYRNQVEEVQRFNIFRANVLEIEQHNALYEQGLVSYKKAINQFT 79

Query: 439 DLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRV 618
           DL  EEFK      +K              V +   + +    E P SVDWR  G VT V
Sbjct: 80  DLTQEEFKAYLGLHVK-------------PVLNNTIQYELKGLEVPTSVDWRSAGQVTGV 126

Query: 619 KDQ 627
           K+Q
Sbjct: 127 KNQ 129



>pir|S37048|S37048 cysteine proteinase - Trypanosoma congolense
          Length = 447

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 39/125 (31%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ + + F  +K++  + Y+D  E   RF+ FK N++  KE+      + +    G+ +F
Sbjct: 34  EQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKEEAAANPYATF----GVTRF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+  + +          G +  +A      K   VS  +AP +VDWRK+GAVT
Sbjct: 90  SDMSPEEFRATYHN----------GAEYYAAALKRPRKVVNVSTGKAPPAVDWRKKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 PVKDQ 144



>pir|S47434|S47434 cysteine proteinase (EC 3.4.22.-) -
           rice>gb:AB004648_1509168 Oryza sativa (japonica
           cultivar-group) RepA gene for cysteine endopeptidase,
           complete cds.>gb:OSCYSPRO_1692985 O.sativa mRNA for
           cysteine protease.
          Length = 378

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 44/135 (32%), Positives = 65/135 (48%), Gaps = 11/135 (8%)
 Frame = +1

Query: 256 EEKVLRLFEEWKER--------NGKVYRDEEEYEERFQNFKGNLKYVKEKTV-GGRGSRW 408
           EE +  L+E W+ R        +G V  D+ E   RF  F  N +Y+ E    GGR  R 
Sbjct: 35  EESLRALYERWRSRYTVSRPAASGGVGNDDGEARRRFNVFVENARYIHEANRRGGRPFR- 93

Query: 409 EGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQ--MVSAVQSGREKKKKVSCEAPFS 582
              + LNKFAD+  +EF+  +        R   G +     + + G + +  +    P +
Sbjct: 94  ---LALNKFADMTTDEFRRTYAGSRARHHRSLSGGRGGEGGSFRYGGDDEDNL----PPA 146

Query: 583 VDWRKRGAVTRVKDQ 627
           VDWR+RGAVT +KDQ
Sbjct: 147 VDWRERGAVTGIKDQ 161



>gb:AGU13940_1811059 Alnus glutinosa cysteine proteinase mRNA,
           complete cds.
          Length = 340

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 38/116 (32%), Positives = 61/116 (52%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           EEW    G+VY+D  E ++R++ F+ N+  ++      + +    K+ +N+FADL NEEF
Sbjct: 39  EEWMASYGRVYKDINEKQKRYKIFEENVALIESSN---KDANKPYKLSVNQFADLTNEEF 95

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           K            + +    + + +S   K   VS   P ++DWR +GAVT VKDQ
Sbjct: 96  KA----------SRNRFKGHICSTKSTSFKYGNVSA-VPSAMDWRMKGAVTPVKDQ 140



>gb:AF089848_1767322 Brassica napus senescence-specific cysteine
           protease (SAG12-1) gene, complete cds.
          Length = 346

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 37/117 (31%), Positives = 63/117 (53%), Gaps = 1/117 (0%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           +EW   +G+ Y D  E   R+  FK N++ ++       G  +  K+ +N+FADL N+EF
Sbjct: 39  DEWMAEHGRTYADMNEKNNRYVVFKRNVERIERLNNVPAGRTF--KLAVNQFADLTNDEF 96

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA-PFSVDWRKRGAVTRVKDQ 627
           + ++T      ++    +   S  +S   + + V   A P +VDWRK+GAVT +K+Q
Sbjct: 97  RFMYTG-----YKGDFVLFSQSQTKSTSFRYQNVFFGALPIAVDWRKKGAVTPIKNQ 148



>gb:AF139913_1244281 Trypanosoma congolense cysteine protease gene,
           partial cds.
          Length = 440

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ + + F  +K++  + Y+D  E   RF+ FK N++  KE+      + +    G+ +F
Sbjct: 34  EQSLQQQFAAFKQKYSRSYKDATEEAFRFRVFKQNMERAKEEAAANPYATF----GVTRF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+  + +          G +  +A      K   VS  +AP ++DWRK+GAVT
Sbjct: 90  SDMSPEEFRATYHN----------GAEYYAAALKRPRKVVNVSTGKAPPAIDWRKKGAVT 139

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 140 PVKDQ 144



>sp|P14658|CYSP_TRYBB Cysteine proteinase precursor (EC
           3.4.22.-).>pir|S07051|S07051 cysteine proteinase (EC
           3.4.22.-) precursor - Trypanosoma
           brucei>gb:TBCYSPRO_1399000 Trypanosoma brucei mRNA for
           cysteine proteinase.
          Length = 450

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F  +K++ GKVY+D +E   RF+ F+ N++  K +      + +    G+  F
Sbjct: 34  EESLEMRFAAFKKKYGKVYKDAKEEAFRFRAFEENMEQAKIQAAANPYATF----GVTPF 89

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSC-EAPFSVDWRKRGAVT 612
           +D+  EEF+           R + G    +A Q    K   V+   AP +VDWR++GAVT
Sbjct: 90  SDMTREEFR----------ARYRNGASYFAAAQKRLRKTVNVTTGRAPAAVDWREKGAVT 139

Query: 613 RVKDQ 627
            VK Q
Sbjct: 140 PVKVQ 144



>gb:D14057_1674466 Ananas comosus mRNA for bromelain, partial cds.
          Length = 312

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 1/110 (0%)
 Frame = +1

Query: 301 GKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSK 480
           G+VY+D +E   RFQ FK N+ ++  +T   R       +G+NKF D+ N EF   +T  
Sbjct: 5   GRVYKDNDEKMRRFQIFKNNVNHI--ETFNNRNGN-SYTLGINKFTDMTNNEFVAQYTGG 61

Query: 481 IKMPFR-KKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           I  P   +K+ +     V      +         S+DWR  GAVT VKDQ
Sbjct: 62  ISRPLNIEKEPVVSFDDVNISAVGQ---------SIDWRDYGAVTEVKDQ 102



>gb:AY345219_1321634 Acanthoscelides obtectus cathepsin L-like
           cysteine proteinase precursor, mRNA, complete cds.
          Length = 321

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 1/118 (0%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           ++++K ++G+ YR   E + RF+ FK NL+ ++E            ++G+N+F D+  EE
Sbjct: 23  WQQFKIQHGRTYRTLLEEKRRFEIFKFNLRTIEEHNERYHNGEETFEMGINQFGDMTQEE 82

Query: 457 FKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FK +    K +MP  +            G E       + P +VDWR++GAVT VK Q
Sbjct: 83  FKRMLALQKPQMPLPR------------GDEVSFDNVNDIPKTVDWREKGAVTEVKKQ 128



>gb:AF016448_1232447 Caenorhabditis elegans cosmid F41E6, complete
           sequence.
          Length = 477

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 36/117 (30%), Positives = 62/117 (52%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F ++ +R+ K Y ++ E  +RF+ FK N K ++E     +G+      G  KF+D+   E
Sbjct: 174 FLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGT---AVYGFTKFSDMTTME 230

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FK     KI +P++ +Q +  +      +        + P S DWR++GAVT+VK+Q
Sbjct: 231 FK-----KIMLPYQWEQPVYPMEQANFEKHDVTINEEDLPESFDWREKGAVTQVKNQ 282



>pir|T31871|T31871 hypothetical protein F41E6.6 - Caenorhabditis
           elegans
          Length = 498

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 36/117 (30%), Positives = 62/117 (52%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F ++ +R+ K Y ++ E  +RF+ FK N K ++E     +G+      G  KF+D+   E
Sbjct: 174 FLDFVDRHEKKYTNKREVLKRFRVFKKNAKVIRELQKNEQGT---AVYGFTKFSDMTTME 230

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           FK     KI +P++ +Q +  +      +        + P S DWR++GAVT+VK+Q
Sbjct: 231 FK-----KIMLPYQWEQPVYPMEQANFEKHDVTINEEDLPESFDWREKGAVTQVKNQ 282



>pir|B84752|B84752 probable cysteine proteinase [imported] -
           Arabidopsis thaliana>gb:AC002341_1530549 Arabidopsis
           thaliana chromosome 2 clone T14G11 map TEn5, complete
           sequence.
          Length = 345

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 43/131 (32%), Positives = 62/131 (47%), Gaps = 7/131 (5%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ ++   E+W  R  + YRDE E   R   FK NLK+++     G  S    K+G+N+F
Sbjct: 32  EQSMVDKHEQWMARFSREYRDELEKNMRRDVFKKNLKFIENFNKKGNKSY---KLGVNEF 88

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-------APFSVDWR 594
           AD  NEEF  + T           G++ ++ V   +   K +S +          S DWR
Sbjct: 89  ADWTNEEFLAIHT-----------GLKGLTEVSPSKVVAKTISSQTWNVSDMVVESKDWR 137

Query: 595 KRGAVTRVKDQ 627
             GAVT VK Q
Sbjct: 138 AEGAVTPVKYQ 148



>gb:AP006170_1861276 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 283

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 43/129 (33%), Positives = 65/129 (50%), Gaps = 5/129 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKE--RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEG---KV 420
           EE +  L++ W+       +  D  E E RF+ FK N +YV E       ++ EG   K+
Sbjct: 37  EESMWSLYQRWRGAVHTSSLDMDVAETESRFEAFKANARYVSEF------NKKEGMTYKL 90

Query: 421 GLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKR 600
           GLNKFAD+  EEF   +T        K     M  A Q+  E++ +++ +   S DWR+ 
Sbjct: 91  GLNKFADMTLEEFVAKYTG------TKVDAAAMARAPQA--EEELELAGDVAASWDWRQH 142

Query: 601 GAVTRVKDQ 627
           GAVT  ++Q
Sbjct: 143 GAVTPAREQ 151



>gb:AB092555_1525078 Glycine max CysP1 mRNA for cysteine proteinase,
           complete cds.>gb:AB092556_1525079 Glycine max CysP1 gene
           for cysteine proteinase, complete cds.
          Length = 362

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 44/124 (35%), Positives = 58/124 (46%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE    L+E W+  +  V R   +  +RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EESFWDLYERWRSHH-TVSRSLGDKHKRFNVFKANVMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        R  QG        +G    +KV    P SVDWRK GAVT 
Sbjct: 88  ADMTNHEFRSTYAGSKVNHHRMFQGTPR----GNGTFMYEKVGSVPP-SVDWRKNGAVTG 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>gb:AC117076_1207833 Dictyostelium discoideum chromosome 2 map
           3323568-3470138 strain AX4, complete sequence.
          Length = 344

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 37/117 (31%), Positives = 59/117 (50%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F +W   + K Y  EE +  R+  FK N+ YV++    G     E  +GLN FAD+ NEE
Sbjct: 30  FTDWMITHQKSYTSEE-FGARYNIFKANMDYVQQWNSKGS----ETVLGLNNFADITNEE 84

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +++ +            G +  ++   G +++K  +  +  S DWR  GAVT VK+Q
Sbjct: 85  YRNTYL-----------GTKFDASSLIGTQEEKVFTTSSAASKDWRSEGAVTPVKNQ 130



>gb:AB057372_1521685 Daucus carota CSCP gene for cysteine
           proteinase, partial cds.
          Length = 208

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 39/124 (31%), Positives = 61/124 (49%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E +  L+E W+  +  V RD  E + RF  FK N+K++ +     +  + E    +NKF
Sbjct: 33  DESLWDLYERWRSHH-TVSRDLTEKQIRFNVFKTNVKHIHKVNQMNKPYKLE----VNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+   EF++ +       FR  +G +  +       K        P SVDWRK GAVT 
Sbjct: 88  ADMTYHEFRNSYGGSKVKHFRSLRGDRARTGFMHENTK------HLPSSVDWRKHGAVTP 141

Query: 616 VKDQ 627
           +K+Q
Sbjct: 142 IKNQ 145



>pir|JC7787|JC7787 carrot seed cysteine proteinase (EC 3.4.-.-),
           CSCP - carrot
          Length = 358

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 39/124 (31%), Positives = 61/124 (49%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E +  L+E W+  +  V RD  E + RF  FK N+K++ +     +  + E    +NKF
Sbjct: 33  DESLWDLYERWRSHH-TVSRDLTEKQIRFNVFKTNVKHIHKVNQMNKPYKLE----VNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+   EF++ +       FR  +G +  +       K        P SVDWRK GAVT 
Sbjct: 88  ADMTYHEFRNSYGGSKVKHFRSLRGDRARTGFMHENTK------HLPSSVDWRKHGAVTP 141

Query: 616 VKDQ 627
           +K+Q
Sbjct: 142 IKNQ 145



>pir|T03694|T03694 cysteine proteinase (EC 3.4.22.-) -
           rice>gb:D76415_1674750 Rice seedling mRNA for cysteine
           proteinase, complete cds.
          Length = 368

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 41/124 (33%), Positives = 59/124 (47%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E +  L+E W+E +  V R   E   RF  FK N++Y+ E        R  G   LN+F
Sbjct: 39  DEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYIHE-----HNKRAPGYAPLNRF 92

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+  EEF+  F        R+  G+          E  +    + P +VDWR++GAVT 
Sbjct: 93  GDMGREEFRATFAGSHANDLRR-DGLAAPPLPGFMYEGVR----DLPRAVDWRRKGAVTG 147

Query: 616 VKDQ 627
           VKDQ
Sbjct: 148 VKDQ 151



>gb:AB092557_1525080 Glycine max CysP2 mRNA for cysteine proteinase,
           complete cds.>gb:AB092558_1525081 Glycine max CysP2 gene
           for cysteine proteinase, complete cds.
          Length = 362

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +  L+E W+  +  V R   +  +RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EESLWDLYERWRSHH-TVSRSLGDKHKRFNVFKANMMHVHNTNKMDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           AD+ N EF+  +        R  + +       +G    +KV    P SVDWRK+GAVT 
Sbjct: 88  ADMTNHEFRSTYAGSKVNHHRMFRDMPR----GNGTFMYEKVG-SVPASVDWRKKGAVTD 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>gb:BC068241_2106067 Mus musculus cathepsin 8, mRNA (cDNA clone
           MGC:60501 IMAGE:30019120), complete cds.
          Length = 333

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 37/117 (31%), Positives = 59/117 (50%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           ++EWK +  K Y  EEE ++R   ++ N+K VK+  +     +    + +N F D+  EE
Sbjct: 29  WQEWKRKFNKNYSMEEEGQKRAV-WEENMKLVKQHNIEYDQGKKNFTMDVNAFGDMTGEE 87

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           ++ + T      FRKK+ I             + ++   P  VDWRKRG VT VK+Q
Sbjct: 88  YRKMLTDIPVPNFRKKKSIH------------QPIAGYLPKFVDWRKRGCVTPVKNQ 132



>gb:AF099203_1767963 Oryza sativa cysteine endopeptidase precursor
           (EP3A) gene, complete cds.
          Length = 368

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 41/124 (33%), Positives = 59/124 (47%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           +E +  L+E W+E +  V R   E   RF  FK N++Y+ E        R  G   LN+F
Sbjct: 39  DEALWDLYERWQEHH-HVPRHHGEKHRRFGAFKDNVRYIHE-----HNKRAPGYPPLNRF 92

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+  EEF+  F        R+  G+          E  +    + P +VDWR++GAVT 
Sbjct: 93  GDMGREEFRATFAGSHANDLRR-DGLAAPPLPGFMYEGVR----DLPRAVDWRRKGAVTG 147

Query: 616 VKDQ 627
           VKDQ
Sbjct: 148 VKDQ 151



>gb:AK049474_1168816 Mus musculus 7 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:C430015H15
           product:cathepsin 8, full insert
           sequence.>gb:AF250840_2060590 Mus musculus EPCS68 mRNA,
           complete cds.>gb:AY014780_2073933 Mus musculus cathepsin
           2 precursor (Cts2) mRNA, complete cds.
          Length = 333

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 37/117 (31%), Positives = 59/117 (50%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           ++EWK +  K Y  EEE ++R   ++ N+K VK+  +     +    + +N F D+  EE
Sbjct: 29  WQEWKRKFNKNYSMEEEGQKRAV-WEENMKLVKQHNIEYDQGKKNFTMDVNAFGDMTGEE 87

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           ++ + T      FRKK+ I             + ++   P  VDWRKRG VT VK+Q
Sbjct: 88  YRKMLTDIPVPNFRKKKSIH------------QPIAGYLPKFVDWRKRGCVTPVKNQ 132



>gb:AP006170_1861277 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0042B15.
          Length = 369

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 41/129 (31%), Positives = 62/129 (48%), Gaps = 5/129 (3%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEY-----EERFQNFKGNLKYVKEKTVGGRGSRWEGKV 420
           E+ +  L++ W+     VY     +     E RF+ FK N +YV E      G  +E  +
Sbjct: 41  EQSMWNLYDRWRA----VYASSSSHLGGDIESRFEAFKANARYVSEFNKK-EGMTYE--L 93

Query: 421 GLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKR 600
           GLNKFAD+  EEF   +             +   +A+ S  E +++V  + P + DWR+ 
Sbjct: 94  GLNKFADMTLEEFVAKYAGA---------KVDAAAALASVPEAEEEVVGDVPAAWDWRQH 144

Query: 601 GAVTRVKDQ 627
           G VT VKDQ
Sbjct: 145 GVVTPVKDQ 153



>gb:LME319727_1387710 Leishmania mexicana cpb2 gene.
          Length = 359

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 59/118 (50%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K   G+ Y    E ++R  NF+ NL+ ++E     +      + G+ KF DL   
Sbjct: 37  LFEEFKRTYGRAYETLAEEQQRLANFERNLELMREH----QARNPHAQFGITKFFDLSEA 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF   + +        K+      A Q  R+ +  +S   P +VDWR++GAVT VKDQ
Sbjct: 93  EFAARYLNGAAYFAAAKR-----HAAQHYRKARADLSA-VPDAVDWREKGAVTPVKDQ 144



>gb:AF115280_1242488 Sarcocystis muris thiolproteinase SmTP1 (smtp1)
           mRNA, complete cds.
          Length = 394

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 37/117 (31%), Positives = 59/117 (50%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F +++  + K Y  EEE  +R+  FK NL Y+    + G    +   + +NKF DL  EE
Sbjct: 89  FYQFQRDHNKFYATEEERLKRYAIFKNNLTYIHNHNMQG----YSYVLKMNKFGDLTLEE 144

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F+  +    K P  +    ++ + ++S  +       + P  VDWR+RG VT VKDQ
Sbjct: 145 FRQRYLG-YKKPDLRTPPREVDTTLESVEDN------DIPTHVDWRQRGCVTSVKDQ 194



>pir|S29245|S29245 cysteine proteinase (EC 3.4.22.-) precursor -
           Leishmania mexicana>gb:LMCPBMR_1387672 Leishmania
           mexicana mRNA for cysteine proteinase.
          Length = 443

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 59/118 (50%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K   G+ Y    E ++R  NF+ NL+ ++E     +      + G+ KF DL   
Sbjct: 37  LFEEFKRTYGRAYETLAEEQQRLANFERNLELMREH----QARNPHAQFGITKFFDLSEA 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF   + +        K+      A Q  R+ +  +S   P +VDWR++GAVT VKDQ
Sbjct: 93  EFAARYLNGAAYFAAAKR-----HAAQHYRKARADLSA-VPDAVDWREKGAVTPVKDQ 144



>pir|T45839|T45839 probable cysteine proteinase (EC 3.4.22.-)
           [similarity] - Arabidopsis thaliana>gb:AC012329_1537568
           Arabidopsis thaliana chromosome 1 BAC T1G12 genomic
           sequence, complete sequence.>gb:ATF2K15_1550540
           Arabidopsis thaliana DNA chromosome 3, BAC clone F2K15.
          Length = 341

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E   +   E+W  R  +VY D+ E   RF+ F  NLK+V+   +    +     + +N+F
Sbjct: 28  EASAVEKHEQWMSRFNRVYSDDSEKTSRFEIFTNNLKFVESINMNTNKTY---TLDVNEF 84

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVS--CEAPFSVDWRKRGAV 609
           +DL +EEFK  +T  +       +G+  +S   S      +     E   S+DW + GAV
Sbjct: 85  SDLTDEEFKARYTGLV-----VPEGMTRISTTDSHETVSFRYENVGETGESMDWIQEGAV 139

Query: 610 TRVKDQ 627
           T VK Q
Sbjct: 140 TSVKHQ 145



>sp|P36400|LCPB_LEIME Cysteine proteinase B precursor (EC
           3.4.22.-).>gb:LMCPB18_1387669 Leishmania mexicana
           lmcpb2.8 gene for cysteine proteinase.
          Length = 443

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 59/118 (50%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K   G+ Y    E ++R  NF+ NL+ ++E     +      + G+ KF DL   
Sbjct: 37  LFEEFKRTYGRAYETLAEEQQRLANFERNLELMREH----QARNPHAQFGITKFFDLSEA 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF   + +        K+      A Q  R+ +  +S   P +VDWR++GAVT VKDQ
Sbjct: 93  EFAARYLNGAAYFAAAKR-----HAAQHYRKARADLSA-VPDAVDWREKGAVTPVKDQ 144



>sp|Q05094|CYS2_LEIPI Cysteine proteinase 2 precursor (EC 3.4.22.-)
           (Amastigote cysteine proteinase A-2).>pir|A48566|A48566
           cysteine proteinase Lpcys2 (EC 3.4.22.-) - Leishmania
           pifanoi>gb:LEICYSPNS_1387359 Leishmania pifanoi cysteine
           proteinase (cys2) gene, complete cds.
          Length = 444

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 59/118 (50%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K   G+ Y    E ++R  NF+ NL+ ++E     +      + G+ KF DL   
Sbjct: 37  LFEEFKRTYGRAYETLAEEQQRLANFERNLELMREH----QARNPHAQFGITKFFDLSEA 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF   + +        K+      A Q  R+ +  +S   P +VDWR++GAVT VKDQ
Sbjct: 93  EFAARYLNGAAYFAAAKR-----HAAQHYRKARADLSA-VPDAVDWREKGAVTPVKDQ 144



>gb:OSJN00065_1694210 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0085F13, complete sequence.
          Length = 383

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 18/174 (10%)
 Frame = +1

Query: 160 LVFLIVAAVWCGGVSCYYDXXXXXXXXXXXVPEEKVLRL---FEEWKERNGKVYRDEEEY 330
           ++ L +  V     SC+ D              + ++ +   F  W   + + Y   +E 
Sbjct: 14  VLLLAIICVLLASPSCHADDLTATMTNEHEKEHQLMMMMMDRFHRWMATHNRSYASADEK 73

Query: 331 EERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQG 510
             RF+ ++ N+++++      R      K+G   F DL +EEF   +T  +++P  +++G
Sbjct: 74  LRRFEVYRSNMEFIEATN---RNGSLTFKLGETPFTDLTHEEFLATYTGDVRLP-PERRG 129

Query: 511 IQ---------------MVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +Q                V+   +GR      +   P SVDWRK GAVT  K Q
Sbjct: 130 MQDDSDEEDAVITTSAGYVAGAGAGRR-----TVAVPESVDWRKEGAVTPAKHQ 178



>gb:AB109188_1526793 Helianthus annuus scp3 mRNA for cysteine
           protease-3, complete cds.
          Length = 348

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 39/118 (33%), Positives = 62/118 (52%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           L+E W  ++  V R  +E ++RF  FK N+ ++      G+      K+ LN+FAD+ N 
Sbjct: 39  LYERWGSQH-MVSRAPDEKKKRFNVFKYNVNHINRVNQLGKPY----KLKLNEFADMTNH 93

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EFK  F SKI + FR  +G +  +     +      + + P S+DWR  GAV  +K+Q
Sbjct: 94  EFKAGFDSKI-LHFRMLKGKRRQTPFTHAK------TTDPPPSIDWRTNGAVNPIKNQ 144



>gb:AY543010_1334466 Bigelowiella natans cysteine proteinase mRNA,
           partial cds.
          Length = 140

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 38/124 (30%), Positives = 59/124 (47%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE+    F  W  +  K Y +  ++ +R+  FKGN+ +V    VGG    +   V LN+F
Sbjct: 22  EEEYQGSFRNWTSKFEKRY-EVADFFKRYNAFKGNMDFVTRHNVGG----YSYTVELNEF 76

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           ADL N EF+ ++                +     G  +   +S ++  SVDW  +GAVT 
Sbjct: 77  ADLTNAEFRSLYHG--------------LKPNAQGPRRTANLSTKSADSVDWVSKGAVTP 122

Query: 616 VKDQ 627
           VK+Q
Sbjct: 123 VKNQ 126



>gb:AC104496_1192353 Trypanosoma cruzi strain CL Brener chromosome 3
           clone cosmid Tcc1l8, *** SEQUENCING IN PROGRESS ***.
          Length = 500

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 38/124 (30%), Positives = 57/124 (45%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F E+K+++G+VY    E   R   F+ NL   +        + +    G+  F
Sbjct: 64  EETLTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATF----GVTPF 119

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           +DL  EEF+  + +           +   +A +  R   K     AP +VDWR RGAVT 
Sbjct: 120 SDLTREEFRSRYHNG---------AVHFAAAQERARVPVKVEVVGAPAAVDWRARGAVTA 170

Query: 616 VKDQ 627
           VKDQ
Sbjct: 171 VKDQ 174



>sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precursor (EC
           3.4.22.-) (Fragment).>pir|JQ1121|JQ1121 cysteine
           proteinase (EC 3.4.22.-) COT44 [similarity] - rape
          Length = 328

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 4/124 (3%)
 Frame = +1

Query: 268 LRLFEEWKERNGKVYRDEE----EYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           + ++  W   +GK   +      + +ERF  FK NL+++       + + +  K+GL  F
Sbjct: 1   MSIYLRWSLEHGKSNSNSNGIINQQDERFNIFKDNLRFIDLHNENNKNATY--KLGLTIF 58

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
           A+L N+E++ ++      P R+    + V+   S      +V    P +VDWR++GAV  
Sbjct: 59  ANLTNDEYRSLYLGARTEPVRRITKAKNVNMKYSAAVNVDEV----PVTVDWRQKGAVNA 114

Query: 616 VKDQ 627
           +KDQ
Sbjct: 115 IKDQ 118



>gb:BT019598_2151441 Synthetic construct Homo sapiens cathepsin F
           mRNA, partial cds.
          Length = 485

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 182 KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 238

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 239 LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 287

Query: 622 DQ 627
           DQ
Sbjct: 288 DQ 289



>gb:HSM802335_2017462 Homo sapiens mRNA; cDNA DKFZp434F0610 (from
           clone DKFZp434F0610); partial cds.
          Length = 308

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 22  KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 78

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 79  LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 127

Query: 622 DQ 627
           DQ
Sbjct: 128 DQ 129



>gb:CR541680_1993910 Homo sapiens full open reading frame cDNA clone
           RZPDo834C0528D for gene CTSF, cathepsin F; complete cds,
           without stopcodon.
          Length = 338

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 36  KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 92

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 93  LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 141

Query: 622 DQ 627
           DQ
Sbjct: 142 DQ 143



>gb:AF136279_1885750 Homo sapiens cathepsin F precursor (CTSF) mRNA,
           complete cds.
          Length = 484

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 182 KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 238

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 239 LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 287

Query: 622 DQ 627
           DQ
Sbjct: 288 DQ 289



>gb:AF071748_1880833 Homo sapiens cathepsin F (CATSF) mRNA, complete
           cds.
          Length = 338

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 36  KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 92

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 93  LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 141

Query: 622 DQ 627
           DQ
Sbjct: 142 DQ 143



>gb:AP001633_1821394 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0515G01.>gb:AP002861_1823230 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0665D10.
          Length = 349

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 37/120 (30%), Positives = 58/120 (48%), Gaps = 1/120 (0%)
 Frame = +1

Query: 271 RLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRN 450
           ++FEEW  + GK Y    E E RF  F+ N+++++        + +   + +N+FADL N
Sbjct: 39  QMFEEWMAKFGKKYPCHGEKEYRFGVFRDNVRFIRSYR---PPAGYNSALRVNQFADLTN 95

Query: 451 EEFKDVFT-SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +EF    T +K   P    +G+  +                 P  +DWR +GAVT VKDQ
Sbjct: 96  DEFVSTHTGAKPPCPKDAPRGVDPI---------------WLPCCIDWRYKGAVTDVKDQ 140



>gb:VSCYSPROA_1727386 V.sativa L. (PROT A) mRNA for cysteine
           proteinase.
          Length = 359

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 37/124 (29%), Positives = 59/124 (47%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E W+  +  V R+ +E   RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EKSLWNLYERWRSHH-TVTRNLDEKHNRFNVFKANVMHVHNTNKLDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+ N EF+ ++        R  +G+   +            + + P S+DWR +GAVT 
Sbjct: 88  GDMTNYEFRRIYADSKISHHRMFRGMSHENGTFMYEN-----AVDVPSSIDWRNKGAVTG 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>pir|T46294|T46294 hypothetical protein DKFZp434F0610.1 - human
           (fragment)
          Length = 308

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 22  KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 78

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 79  LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 127

Query: 622 DQ 627
           DQ
Sbjct: 128 DQ 129



>pir|S49166|S49166 cysteine proteinase (EC 3.4.22.-) precursor -
           spring vetch
          Length = 357

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 37/124 (29%), Positives = 59/124 (47%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           E+ +  L+E W+  +  V R+ +E   RF  FK N+ +V       +      K+ LNKF
Sbjct: 33  EKSLWNLYERWRSHH-TVTRNLDEKHNRFNVFKANVMHVHNTNKLDKPY----KLKLNKF 87

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTR 615
            D+ N EF+ ++        R  +G+   +            + + P S+DWR +GAVT 
Sbjct: 88  GDMTNYEFRRIYADSKISHHRMFRGMSHENGTFMYEN-----AVDVPSSIDWRNKGAVTG 142

Query: 616 VKDQ 627
           VKDQ
Sbjct: 143 VKDQ 146



>sp|Q9UBX1|CATF_HUMAN Cathepsin F precursor (EC 3.4.22.41)
           (CATSF).>gb:AF088886_1882366 Homo sapiens cathepsin F
           precursor, mRNA, complete cds.>gb:AF132894_1885522 Homo
           sapiens cathepsin F (CTSF) gene, complete
           cds.>gb:BC011682_1973127 Homo sapiens cathepsin F, mRNA
           (cDNA clone MGC:19716 IMAGE:3535532), complete
           cds.>gb:BC036451_1981933 Homo sapiens cathepsin F, mRNA
           (cDNA clone MGC:33063 IMAGE:4830274), complete
           cds.>gb:HSA7331_2009873 Homo sapiens cathepsin F gene.
          Length = 484

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 182 KMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSD 238

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VK
Sbjct: 239 LTEEEFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVK 287

Query: 622 DQ 627
           DQ
Sbjct: 288 DQ 289



>gb:DRCATHEPL_2571000 D.rerio mRNA for cathepsin L.
          Length = 336

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 35/117 (29%), Positives = 55/117 (47%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           +  WK ++GK Y ++ E   R   ++ NL+ +++            K+G+N+F D+ NEE
Sbjct: 28  WNSWKSQHGKSYHEDVEVGRRMI-WEENLRKIEQHNFEYSYGNHTFKMGMNQFGDMTNEE 86

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F+         P +  QG   +          +     AP  VDWR+RG VT VKDQ
Sbjct: 87  FRQAMNGYTHDPNQTSQGPLFM----------EPSFFAAPQQVDWRQRGYVTPVKDQ 133



>gb:AP003759_1833026 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1567_G09.>gb:AP004342_1840518 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0585H11.
          Length = 352

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 3/119 (2%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           ++W   +G+ Y+D  E   RF+ FK N+  +      G   R+  ++  N+F DL + EF
Sbjct: 43  DKWMAEHGRTYKDAAEKARRFRVFKANVDLIDRSNAAGN-KRY--RLATNRFTDLTDAEF 99

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE---APFSVDWRKRGAVTRVKDQ 627
             ++T           G    + + +      ++S E    P  VDWR++GAVT VK+Q
Sbjct: 100 AAMYT-----------GYNPANTMYAAANATTRLSSEDDQQPAEVDWRQQGAVTGVKNQ 147



>gb:AF544843_1280689 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA27) mRNA, complete cds.
          Length = 326

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLVDIQEHNKKYERGEESFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  + +  E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDIDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF544840_1280686 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA21) mRNA, complete cds.
          Length = 326

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLVDIQEHNKKYERGEESFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  + +  E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDIDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF314930_1261697 Trypanosoma cruzi strain Ynull cruzipain gene,
           complete cds.
          Length = 467

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 41/125 (32%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F E+K+++G+VY    E   R   F+ NL   +        + +    G+  F
Sbjct: 31  EETLTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATF----GVTPF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           +DL  EEF+           R   G    +A Q       KV    AP +VDWR RGAVT
Sbjct: 87  SDLTREEFRS----------RYHNGAAHFAAAQERARVPVKVEVVGAPAAVDWRARGAVT 136

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 137 AVKDQ 141



>gb:AF314929_1261696 Trypanosoma cruzi strain Y cruzipain gene,
           complete cds.
          Length = 467

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 41/125 (32%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F E+K+++G+VY    E   R   F+ NL   +        + +    G+  F
Sbjct: 31  EETLTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATF----GVTPF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           +DL  EEF+           R   G    +A Q       KV    AP +VDWR RGAVT
Sbjct: 87  SDLTREEFRS----------RYHNGAAHFAAAQERARVPVKVEVVGAPAAVDWRARGAVT 136

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 137 AVKDQ 141



>pir|T06276|T06276 benzothiadiazole-induced protein (clone WCI-4) -
           wheat>gb:TAU32430_1724704 Triticum aestivum thiol
           protease mRNA, complete cds.
          Length = 374

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 35/121 (28%), Positives = 58/121 (47%)
 Frame = +1

Query: 265 VLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++  F  W  ++GK Y   EE   RF  F+ N+++++      R  R    +G+N+FADL
Sbjct: 46  MMERFHGWMAKHGKSYAGVEEKLRRFDIFRRNVEFIE---AANRDGRLSYTLGVNQFADL 102

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF    TS+  +P  +         V  G   +   +   P S++W  +  VT VK+
Sbjct: 103 THEEFLATHTSRRVVPSEEMVITTRAGVVVEGANCQPAPNA-VPRSINWVNQSKVTPVKN 161

Query: 625 Q 627
           Q
Sbjct: 162 Q 162



>sp|P25779|CYSP_TRYCR Cruzipain precursor (EC 3.4.22.51) (Major
           cysteine proteinase) (Cruzaine).>pir|A60667|A60667
           cysteine proteinase cruzain (EC 3.4.22.-) precursor -
           Trypanosoma cruzi>gb:AY099317_1298681 Trypanosoma cruzi
           clone CL Brener cysteine proteinase precursor, gene,
           complete cds.>gb:TRBCYSPROA_1400636 Trypanosoma cruzi
           cruzain protein gene, complete cds.
          Length = 467

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 41/125 (32%), Positives = 56/125 (44%), Gaps = 1/125 (0%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F E+K+++G+VY    E   R   F+ NL   +        + +    G+  F
Sbjct: 31  EETLTSQFAEFKQKHGRVYESAAEEAFRLSVFRENLFLARLHAAANPHATF----GVTPF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVT 612
           +DL  EEF+           R   G    +A Q       KV    AP +VDWR RGAVT
Sbjct: 87  SDLTREEFRS----------RYHNGAAHFAAAQERARVPVKVEVVGAPAAVDWRARGAVT 136

Query: 613 RVKDQ 627
            VKDQ
Sbjct: 137 AVKDQ 141



>gb:AF544839_1280685 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA16) mRNA, complete cds.
          Length = 326

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLVDIQEHNKKYERGEESFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  + +  E   ++DWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDIDMEEKDAIDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF544837_1280683 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA13) mRNA, complete cds.
          Length = 326

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLVDIQEHNKKYERGEESFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  + +  E   +VDWR+ GAVT  KD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNSEDIDMEEKDAVDWREEGAVTPAKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF228731_1252916 Stylonychia lemnae cathepsin L gene, complete
           cds.
          Length = 340

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 35/117 (29%), Positives = 56/117 (47%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F  +  R  K Y+ +EE+E R Q +K N+ ++        G+ +   +G N  AD  ++E
Sbjct: 42  FVHFMSRFSKAYKSKEEFEMRLQQYKSNIAFINNHNSQNDGTSFT--LGPNHLADYTHDE 99

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +K +   K     R K G ++ S              + P S+DWR++GAV  VKDQ
Sbjct: 100 YKKMLGYKP----RNKTGKEVYSTPNLK---------DIPESIDWREKGAVNAVKDQ 143



>gb:BC060335_2552818 Xenopus laevis cDNA clone MGC:68554
           IMAGE:4031347, complete cds.
          Length = 335

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 37/114 (32%), Positives = 59/114 (51%)
 Frame = +1

Query: 286 WKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEFKD 465
           WK+ + K Y  +EE   R   ++ NLK ++   +     +   ++G+N+F D+ NEEFK 
Sbjct: 32  WKDWHKKTYAPKEEGWRRVL-WEKNLKMIEFHNLDHSLGKHSYRLGMNQFGDMTNEEFKQ 90

Query: 466 VFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +        ++ ++ I+       G       + EAP SVDWRK+G VT VKDQ
Sbjct: 91  LMNG-----YKNQKMIR-------GSTFLAPNNFEAPKSVDWRKKGYVTPVKDQ 132



>gb:LMCPB18G_1387670 L.mexicana cpb18 gene.
          Length = 443

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 38/118 (32%), Positives = 59/118 (50%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           LFEE+K   G+ Y    E ++R  NF+ NL+ ++E     +      + G+ KF DL   
Sbjct: 37  LFEEFKRTYGRAYETLAEEQQRLANFERNLELMREH----QARNPHAQFGITKFFDLSEA 92

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF   + +        K+      A Q  R+ +  +S   P +VDWR++GAVT VK+Q
Sbjct: 93  EFAARYLNGAAYFAAAKR-----HAAQHYRKARADLSA-VPDAVDWREKGAVTPVKNQ 144



>gb:BX538353_1359133 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 4/4.
          Length = 401

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/117 (30%), Positives = 63/117 (53%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           FEE+K++  KVY   EE  +RF+ +K N+ ++  KT   +G  +   + +N+F DL  EE
Sbjct: 86  FEEFKKKYHKVYSSMEEENQRFEIYKQNMNFI--KTTNSQGFSY--VLEMNEFGDLSKEE 141

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F   FT  IK   +  + +   S V +   +++ V    P S++W + G V  +++Q
Sbjct: 142 FMARFTGYIK-DSKDDERVFKSSRVSASESEEEFV---PPNSINWVEAGCVNPIRNQ 194



>gb:AF091366_1240183 Cryptosporidium parvum cryptopain precursor,
           gene, complete cds.
          Length = 401

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/117 (30%), Positives = 63/117 (53%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           FEE+K++  KVY   EE  +RF+ +K N+ ++  KT   +G  +   + +N+F DL  EE
Sbjct: 86  FEEFKKKYHKVYSSMEEENQRFEIYKQNMNFI--KTTNSQGFSY--VLEMNEFGDLSKEE 141

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F   FT  IK   +  + +   S V +   +++ V    P S++W + G V  +++Q
Sbjct: 142 FMARFTGYIK-DSKDDERVFKSSRVSASESEEEFV---PPNSINWVEAGCVNPIRNQ 194



>gb:MMU131851_2118392 Mus musculus mRNA for cathepsin F.
          Length = 462

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/122 (30%), Positives = 61/122 (50%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  LF+++     + Y   EE + R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 160 KMAPLFKDFMTTYNRTYESREEAQWRLTVFARNMIRAQKIQALDRGT---AQYGITKFSD 216

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF  ++ + +    +K+ G +M  A        K ++  AP   DWRK+GAVT VK
Sbjct: 217 LTEEEFHTIYLNPL---LQKESGRKMSPA--------KSINDLAPPEWDWRKKGAVTEVK 265

Query: 622 DQ 627
           +Q
Sbjct: 266 NQ 267



>gb:AF456463_2066304 Mus musculus cathepsin M (CtsM) mRNA, complete
           cds.>gb:AY057446_2074630 Mus musculus cathepsin M (Ctsm)
           gene, complete cds, alternatively spliced.
          Length = 333

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVK----EKTVGGRGSRWEGKVGLNKFADL 444
           +++WK + GK Y  EEE ++R   ++ N+K +K    E  +G  G   E    +N F D+
Sbjct: 29  WQKWKIKYGKAYSLEEEGQKRAV-WEENMKKIKLHNGENGLGKHGFTME----MNAFGDM 83

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
             EEF+ V    I++P         V  V+ G+  +K++S   P  ++W+KRG VT V+ 
Sbjct: 84  TLEEFRKVM---IEIP---------VPTVKKGKSVQKRLSVNLPKFINWKKRGYVTPVRT 131

Query: 625 Q 627
           Q
Sbjct: 132 Q 132



>gb:AF197480_2058786 Mus musculus strain C57BL/6 cathepsin F (Ctsf)
           mRNA, complete cds.
          Length = 462

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/122 (30%), Positives = 61/122 (50%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  LF+++     + Y   EE + R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 160 KMAPLFKDFMTTYNRTYESREEAQWRLTVFARNMIRAQKIQALDRGT---AQYGITKFSD 216

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF  ++ + +    +K+ G +M  A        K ++  AP   DWRK+GAVT VK
Sbjct: 217 LTEEEFHTIYLNPL---LQKESGRKMSPA--------KSINDLAPPEWDWRKKGAVTEVK 265

Query: 622 DQ 627
           +Q
Sbjct: 266 NQ 267



>gb:AF071749_1880834 Homo sapiens cathepsin F (CATSF) mRNA, complete
           cds.
          Length = 302

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/118 (31%), Positives = 58/118 (49%)
 Frame = +1

Query: 274 LFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNE 453
           +F+ +     + Y  +EE   R   F  N+   ++     RG+    + G+ KF+DL  E
Sbjct: 4   IFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGT---AQYGVTKFSDLTEE 60

Query: 454 EFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EF+ ++ + +    RK+ G +M  A        K V   AP   DWR +GAVT+VKDQ
Sbjct: 61  EFRTIYLNTL---LRKEPGNKMKQA--------KSVGDLAPPEWDWRSKGAVTKVKDQ 107



>gb:AP002866_1823377 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0410E01.
          Length = 360

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 38/118 (32%), Positives = 53/118 (44%), Gaps = 2/118 (1%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E W  R G+ Y D  E   R + F  N + V      G    +   +GLN+F+DL ++EF
Sbjct: 44  ERWMARFGRAYADAAEKARRMEVFAANAERVDAANRAGGDRTYT--LGLNQFSDLTDDEF 101

Query: 460 KDVFT--SKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
                  S    P   + G +     ++G         + P SVDWR RGAVT VK+Q
Sbjct: 102 AQTHLGYSWAPPPPSHRHGHR----AENGTAAAAADDTDVPDSVDWRARGAVTEVKNQ 155



>gb:AF019145_1761576 Zea mays cysteine protease Mir1 (mir1) mRNA,
           complete cds.
          Length = 398

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 41/138 (29%), Positives = 67/138 (48%), Gaps = 14/138 (10%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGK----------VYRDEEEYEE----RFQNFKGNLKYVKEKTVGG 393
           +E+V R++E WK ++G+             D+E+ EE    R + F+ NL+Y+       
Sbjct: 47  DEEVRRMYEAWKSKHGRGGSSNDDCDMAPGDDEQEEEDRRLRLEVFRDNLRYIDAHNAEA 106

Query: 394 RGSRWEGKVGLNKFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEA 573
                  ++GL  FADL  EE++        + FR + G +  +   SG   +     + 
Sbjct: 107 DAGLHTFRLGLTPFADLTLEEYRGRV-----LGFRAR-GRRSGARYGSGYSVR---GGDL 157

Query: 574 PFSVDWRKRGAVTRVKDQ 627
           P ++DWR+ GAVT VKDQ
Sbjct: 158 PDAIDWRQLGAVTEVKDQ 175



>gb:AY660746_1344372 Toxoplasma gondii strain RH toxopain-2 mRNA,
           complete cds.
          Length = 422

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 36/117 (30%), Positives = 54/117 (46%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F  ++    K Y  EEE + R+  FK NL Y+      G    +   + +N F DL  +E
Sbjct: 117 FSSFQAMYAKSYATEEEKQRRYAIFKNNLVYIHTHNQQG----YSYSLKMNHFGDLSRDE 172

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           F+  +     + F+K + ++    +    E    +  E P  VDWR RG VT VKDQ
Sbjct: 173 FRRKY-----LGFKKSRNLKS-HHLGVATELLNVLPSELPAGVDWRSRGCVTPVKDQ 223



>gb:AJ583512_1282281 Diabrotica virgifera virgifera mRNA for
           cathepsin L-like proteinase, clone DvRS33.
          Length = 325

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 3/119 (2%)
 Frame = +1

Query: 280 EEW---KERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRN 450
           EEW   K +N K Y+   E + RF+ F+ NL+ ++             K G+ KF DL  
Sbjct: 21  EEWVQFKVKNNKSYKSYVEEQTRFRIFQENLRKIENHNEKYNNGESTFKFGVTKFTDLTE 80

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +EF D+          +     +++ ++           + P + DWR +GAVT VKDQ
Sbjct: 81  KEFLDLLVLSKNARPNRTHATHLLAPLR-----------DLPSAFDWRDKGAVTEVKDQ 128



>gb:AF544836_1280682 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA11) mRNA, complete cds.
          Length = 326

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSVVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  +    E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDTDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF544834_1280680 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA1) mRNA, complete cds.
          Length = 326

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSVVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  +    E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDTDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AK005428_1153012 Mus musculus adult female placenta cDNA, RIKEN
           full-length enriched library, clone:1600012H22
           product:cathepsin M, full insert
           sequence.>gb:AK005550_1153099 Mus musculus adult female
           placenta cDNA, RIKEN full-length enriched library,
           clone:1600027J17 product:cathepsin M, full insert
           sequence.>gb:AY014777_2073930 Mus musculus cathepsin M
           precursor (Ctsm) mRNA, complete cds.
          Length = 333

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVK----EKTVGGRGSRWEGKVGLNKFADL 444
           +++WK + GK Y  EEE ++R   ++ N+K +K    E  +G  G   E    +N F D+
Sbjct: 29  WQKWKIKYGKAYSLEEEGQKRAV-WEDNMKKIKLHNGENGLGKHGFTME----MNAFGDM 83

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
             EEF+ V    I++P         V  V+ G+  +K++S   P  ++W+KRG VT V+ 
Sbjct: 84  TLEEFRKVM---IEIP---------VPTVKKGKSVQKRLSVNLPKFINWKKRGYVTPVQT 131

Query: 625 Q 627
           Q
Sbjct: 132 Q 132



>pir|T06207|T06207 cysteine proteinase (EC 3.4.22.-) -
           barley>gb:HVZ97022_1682877 Hordeum vulgare gene encoding
           cysteine proteinase.
          Length = 349

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 36/116 (31%), Positives = 55/116 (47%)
 Frame = +1

Query: 280 EEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEEF 459
           E+W   +G+ Y +EEE   R + F+ N K +         +    ++  N+FADL +EEF
Sbjct: 45  EKWMAEHGRTYANEEEKARRLEVFRANAKLIDSFNSAEDSTH---RLATNRFADLTDEEF 101

Query: 460 KDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +   T  ++ P     G     +   G   +     +A  S+DWR  GAVT VKDQ
Sbjct: 102 RAARTG-LRRPPAAAAG---AGSGAGGFRYENFSLADAAGSMDWRAMGAVTGVKDQ 153



>pir|T06206|T06206 probable cysteine proteinase (EC 3.4.22.-)
           precursor - barley>gb:HVZ97021_1682876 Hordeum vulgare
           gene encoding cysteine endopeptidase EP-A.
          Length = 365

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 2/126 (1%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRD--EEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLN 429
           EE +  L+E W+       R    +  E RF  FK N +YV E     R  R    + LN
Sbjct: 34  EESLRGLYERWRSHYTVSRRGLGADAEERRFNVFKENARYVHEGNKRDRPFR----LALN 89

Query: 430 KFADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAV 609
           KFAD+  +EF+  +        R +  + +    +     +   +   P +VDWR++GAV
Sbjct: 90  KFADMTTDEFRRTYAGS-----RVRHHLSLSGGRRGDGGFRYADADNLPPAVDWRQKGAV 144

Query: 610 TRVKDQ 627
           T +KDQ
Sbjct: 145 TAIKDQ 150



>sp|P54640|CYS5_DICDI Cysteine proteinase 5 precursor (EC
           3.4.22.-).>gb:DDICYSPROB_1377042 Dictyostelium
           discoideum cysteine proteinase CP5 mRNA, complete cds.
          Length = 344

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 36/117 (30%), Positives = 58/117 (49%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F +W   + K Y  EE +  R+  F  N+ YV++    G     E  +GLN FAD+ NEE
Sbjct: 30  FTDWMITHQKSYTSEE-FGARYNIFTANMDYVQQWNSKGS----ETVLGLNNFADITNEE 84

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           +++ +            G +  ++   G +++K  +  +  S DWR  GAVT VK+Q
Sbjct: 85  YRNTYL-----------GTKFDASSLIGTQEEKVHTNSSAASKDWRSEGAVTPVKNQ 130



>sp|Q9JL96|CATM_MOUSE Cathepsin M precursor (EC
           3.4.22.-).>gb:AF202528_2058902 Mus musculus cathepsin M
           (Catm) mRNA, complete cds.
          Length = 333

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 4/121 (3%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVK----EKTVGGRGSRWEGKVGLNKFADL 444
           +++WK + GK Y  EEE ++R   ++ N+K +K    E  +G  G   E    +N F D+
Sbjct: 29  WQKWKIKYGKAYSLEEEGQKRAV-WEDNMKKIKLHNGENGLGKHGFTME----MNAFGDM 83

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
             EEF+ V    I++P         V  V+ G+  +K++S   P  ++W+KRG VT V+ 
Sbjct: 84  TLEEFRKVM---IEIP---------VPTVKKGKSVQKRLSVNLPKFINWKKRGYVTPVQT 131

Query: 625 Q 627
           Q
Sbjct: 132 Q 132



>sp|Q9R013|CATF_MOUSE Cathepsin F precursor (EC
           3.4.22.41).>gb:AK075862_1171062 Mus musculus adult male
           tongue cDNA, RIKEN full-length enriched library,
           clone:2310004H08 product:cathepsin F, full insert
           sequence.>gb:AF136280_2055940 Mus musculus cathepsin F
           precursor (CTSF) mRNA, complete cds.>gb:AF217224_2059407
           Mus musculus cathepsin F (Ctsf) gene, complete
           cds.>gb:BC058758_2103474 Mus musculus cathepsin F, mRNA
           (cDNA clone MGC:65237 IMAGE:6492834), complete cds.
          Length = 462

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 37/122 (30%), Positives = 61/122 (50%)
 Frame = +1

Query: 262 KVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFAD 441
           K+  LF+++     + Y   EE + R   F  N+   ++     RG+    + G+ KF+D
Sbjct: 160 KMAPLFKDFMTTYNRTYESREEAQWRLTVFARNMIRAQKIQALDRGT---AQYGITKFSD 216

Query: 442 LRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVK 621
           L  EEF  ++ + +    +K+ G +M  A        K ++  AP   DWRK+GAVT VK
Sbjct: 217 LTEEEFHTIYLNPL---LQKESGRKMSPA--------KSINDLAPPEWDWRKKGAVTEVK 265

Query: 622 DQ 627
           +Q
Sbjct: 266 NQ 267



>gb:AY014779_2073932 Mus musculus cathepsin 1 precursor (Cts1) mRNA,
           complete cds.>gb:BC064740_2105411 Mus musculus cathepsin
           7, mRNA (cDNA clone MGC:76497 IMAGE:30018572), complete
           cds.
          Length = 331

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 2/119 (1%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK--VGLNKFADLRN 450
           +EEWK  N + Y  EEE ++R   ++GN+K++K+  +      W     + +N+F D+  
Sbjct: 29  WEEWKRSNDRTYSPEEE-KQRRAVWEGNVKWIKQHIM--ENGLWMNNFTIEMNEFGDMTG 85

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EE K + T     P R  + IQ             K + + P ++DWRK G VT V+ Q
Sbjct: 86  EEMK-MLTESSSYPLRNGKHIQ-------------KRNPKIPPTLDWRKEGYVTPVRRQ 130



>gb:AF250837_2060587 Mus musculus EPCS24 mRNA, partial cds.
          Length = 329

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 2/119 (1%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGK--VGLNKFADLRN 450
           +EEWK  N + Y  EEE ++R   ++GN+K++K+  +      W     + +N+F D+  
Sbjct: 29  WEEWKRSNDRTYSPEEE-KQRRAVWEGNVKWIKQHIM--ENGLWMNNFTIEMNEFGDMTG 85

Query: 451 EEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKDQ 627
           EE K + T     P R  + IQ             K + + P ++DWRK G VT V+ Q
Sbjct: 86  EEMK-MLTESSSYPLRNGKHIQ-------------KRNPKIPPTLDWRKEGYVTPVRRQ 130



>gb:AF454959_1801127 Brassica oleracea senescence-associated
           cysteine protease (CP4) mRNA, complete cds.
          Length = 368

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 39/118 (33%), Positives = 56/118 (47%), Gaps = 1/118 (0%)
 Frame = +1

Query: 277 FEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADLRNEE 456
           F  +K++ GKVY   EE++ RF  FK NL+  +        +R     G+ +F+DL   E
Sbjct: 51  FSLFKKKFGKVYASREEHDYRFSVFKSNLRRARRHQKLDPSARH----GVTQFSDLTRSE 106

Query: 457 FKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-APFSVDWRKRGAVTRVKDQ 627
           FK           RK  G++    +     K   +  E  P   DWR+RGAVT VK+Q
Sbjct: 107 FK-----------RKHLGVKGGFKLPKDANKAPILPTENLPEEFDWRERGAVTPVKNQ 153



>gb:TRBRANGA_1400777 Trypanosoma rangeli (clone 2) rangelipain gene,
           3' end of cds and 5' end of cds.
          Length = 263

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 40/131 (30%), Positives = 60/131 (45%), Gaps = 7/131 (5%)
 Frame = +1

Query: 256 EEKVLRLFEEWKERNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKF 435
           EE +   F  +K+R+GKVY    E   R   FK NL + +        + +    G+  F
Sbjct: 31  EETLASQFAAFKQRHGKVYGSAAEEAFRLGVFKENLLFARLHAAANPHASF----GVTPF 86

Query: 436 ADLRNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCE-------APFSVDWR 594
           +DL  EEF+  + +               +A  +  +K+ +V  E       AP +VDWR
Sbjct: 87  SDLTREEFRSRYHN--------------AAAHFAAAQKRVRVPVEVEVEVGGAPAAVDWR 132

Query: 595 KRGAVTRVKDQ 627
            RGAVT +KDQ
Sbjct: 133 ARGAVTAIKDQ 143



>gb:AF544844_1280690 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPB1) mRNA, complete cds.
          Length = 323

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSVVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+              +Q V A+ S     ++   E   +VDWRK GAVT VK+
Sbjct: 79  THEEFLDLLK------------LQGVPALPSDAVYFEETDIEEKDAVDWRKEGAVTPVKN 126

Query: 625 Q 627
           Q
Sbjct: 127 Q 127



>gb:AF544841_1280687 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA23) mRNA, complete cds.
          Length = 326

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  +    E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDTDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF544838_1280684 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA15) mRNA, complete cds.
          Length = 326

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  +    E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDTDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130



>gb:AF544835_1280681 Callosobruchus maculatus putative gut cathepsin
           L-like cysteine protease (CPA9) mRNA, complete cds.
          Length = 326

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 3/121 (2%)
 Frame = +1

Query: 274 LFEEWKE---RNGKVYRDEEEYEERFQNFKGNLKYVKEKTVGGRGSRWEGKVGLNKFADL 444
           ++EEW++    +GK YR   E + RF  F+ NL  ++E               + +FAD+
Sbjct: 19  VYEEWQQFKLDHGKTYRSLVEEKRRFSVFQKNLIDIQEHNKKYERGEVSFAKKVTQFADM 78

Query: 445 RNEEFKDVFTSKIKMPFRKKQGIQMVSAVQSGREKKKKVSCEAPFSVDWRKRGAVTRVKD 624
            +EEF D+          K QG+  + +     +  +    E   +VDWR+ GAVT VKD
Sbjct: 79  THEEFLDLL---------KLQGVPALPSNAVHFDNFEDTDMEEKDAVDWREEGAVTPVKD 129

Query: 625 Q 627
           Q
Sbjct: 130 Q 130


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 580,176,508
Number of Sequences: 1806583
Number of extensions: 11293738
Number of successful extensions: 38780
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 36541
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37904
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 32657179222
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)