BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3125
         (798 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T52301|T52301 GYMNOS/PICKLE protein [imported] - Arabidopsis...   229   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AP005919_1860132 Oryza sativa (japonica cultivar-group) genom...   203   3e-51   
pir|B84645|B84645 hypothetical protein At2g25170 [imported] - Ar...   198   9e-50   Arabidopsis thaliana [mouse-ear cress]
gb:AY062187S2_1565003 Oryza sativa (indica cultivar-group) chrom...   194   1e-48   
gb:AY062186_1565002 Oryza sativa chromatin-remodeling factor CHD...   194   1e-48   
pir|T06312|T06312 hypothetical protein F11C18.100 - Arabidopsis ...    86   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF119716_1242802 Drosophila melanogaster dMi-2 protein (dMi-2...    72   1e-11   
sp|O97159|CHDM_DROME|CHDM_DROME Chromodomain helicase-DNA-binding protein M...    72   1e-11   Drosophila melanogaster
gb:AY071503_1295587 Drosophila melanogaster RE55932 full length ...    70   6e-11   
gb:AF007780_1231446 Drosophila melanogaster CHD3 mRNA, partial cds.    70   6e-11   
sp|O16102|CHD3_DROME|CHD3_DROME Chromodomain helicase-DNA-binding protein 3...    70   6e-11   Drosophila melanogaster
gb:BC058578_2103332 Mus musculus chromodomain helicase DNA bindi...    67   4e-10   
gb:AK034549_1163794 Mus musculus 12 days embryo embryonic body b...    67   4e-10   
gb:BC038596_1982373 Homo sapiens chromodomain helicase DNA bindi...    66   9e-10   
gb:A56817_1449788 Sequence 1 from Patent WO9628547.                    66   9e-10   
sp|Q14839|CHD4_HUMAN|CHD4_HUMAN Chromodomain helicase-DNA-binding protein 4...    66   9e-10   Homo sapiens [man]
gb:BC046866_2549766 Xenopus laevis chromodomain helicase DNA bin...    63   6e-09   
sp|Q22516|CHD3_CAEEL|CHD3_CAEEL Chromodomain helicase-DNA-binding protein 3...    62   1e-08   Caenorhabditis elegans [roundworm]
pir|T34239|T34239 hypothetical protein F26F12.7 - Caenorhabditis...    61   3e-08   Caenorhabditis elegans [roundworm]
gb:AL596125_2070887 Mouse DNA sequence from clone RP23-5O23 on c...    58   2e-07   
gb:AK045449_1167421 Mus musculus adult male corpora quadrigemina...    58   2e-07   
gb:HSU91543_2027525 Homo sapiens zinc-finger helicase (hZFH) mRN...    58   2e-07   
gb:HSU08379_2021900 Human Mi-2 autoantigen 240 kDa protein mRNA,...    58   2e-07   
pir|I38558|I38558 Mi-2 autoantigen 240 kDa protein - human (frag...    58   2e-07   Homo sapiens [man]
sp|Q12873|CHD3_HUMAN|CHD3_HUMAN Chromodomain helicase-DNA-binding protein 3...    58   2e-07   Homo sapiens [man]
gb:HS120G22_1997029 Human DNA sequence from clone RP1-120G22 on ...    56   7e-07   
gb:AK127046_1916570 Homo sapiens cDNA FLJ45103 fis, clone BRAWH3...    56   7e-07   
gb:AF425231_1901805 Homo sapiens chromodomain helicase DNA bindi...    56   7e-07   
gb:AP005452_1852036 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:BC022167_2093774 Mus musculus ubiquitin-like, containing PHD ...    52   2e-05   
gb:AF274046_2061190 Mus musculus nuclear zinc finger protein Np9...    52   2e-05   
gb:AB066245_2047129 Mus musculus gene for Np95, partial cds.           52   2e-05   
gb:AE017347_1757652 Cryptococcus neoformans var. neoformans JEC2...    50   4e-05   
gb:BC019181_2092834 Mus musculus BRAF35/HDAC2 complex, mRNA (cDN...    50   5e-05   
gb:AB105178_2048364 Mus musculus PFTF1 mRNA, complete cds.             50   5e-05   
gb:AB051483_1867995 Homo sapiens mRNA for KIAA1696 protein, part...    50   6e-05   
gb:AX880319_1478225 Sequence 15224 from Patent EP1074617.>gb:AK0...    50   6e-05   
gb:AF208848_1150553 Homo sapiens BM-006 mRNA, complete cds.            50   6e-05   
sp|O14686|MLL2_HUMAN|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    50   6e-05   Homo sapiens [man]
gb:AK129424_2069655 Mus musculus mRNA for mKIAA1696 protein.           48   2e-04   
gb:AK037174_1164780 Mus musculus 6 days neonate skin cDNA, RIKEN...    48   2e-04   
gb:BC083281_2563158 Danio rerio zgc:101789, mRNA (cDNA clone MGC...    48   2e-04   
gb:BC015714_1975261 Homo sapiens PHD finger protein 21A, mRNA (c...    48   2e-04   
gb:HSM808384_1187991 Homo sapiens mRNA; cDNA DKFZp686D02108 (fro...    48   2e-04   
gb:AF274048_1894211 Homo sapiens nuclear zinc finger protein Np9...    47   3e-04   
gb:AB006699_1509893 Arabidopsis thaliana genomic DNA, chromosome...    47   3e-04   
gb:AF108133_2054740 Mus musculus neuro-d4 gene, exons 3 through ...    47   4e-04   
gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD a...    47   5e-04   
gb:AY391455_2531591 Danio rerio requiem, apoptosis response zinc...    47   5e-04   
gb:AB021737_2460986 Xenopus laevis mRNA for Requiem protein, com...    47   5e-04   
gb:AX063416_1458760 Sequence 1 from Patent WO0078949.>gb:AF12950...    47   5e-04   
gb:AY648713_2541541 Danio rerio NP95 mRNA, complete cds.               46   7e-04   
gb:BC052348_2101041 Mus musculus neuronal d4 domain family membe...    46   7e-04   
gb:BC021191_1977406 Homo sapiens D4, zinc and double PHD fingers...    46   7e-04   
gb:AP003227_1825671 Oryza sativa (japonica cultivar-group) genom...    46   7e-04   
gb:TAE577391_1724498 Triticum aestivum partial mRNA for hypothet...    46   7e-04   
gb:AX528700_1469909 Sequence 33 from Patent WO0246443.                 46   7e-04   
sp|Q9QX66|DPF1_MOUSE|DPF1_MOUSE Zinc-finger protein neuro-d4 (D4, zinc and ...    46   7e-04   Mus musculus [mouse]
sp|Q9W638|REQ1_XENLA|REQ1_XENLA Zinc-finger protein ubi-d4 1 (Requiem) (xRe...    46   0.001   Xenopus laevis [clawed frog]
gb:AB040975_1866904 Homo sapiens mRNA for KIAA1542 protein, part...    45   0.001   
gb:AP002031_1821474 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AY321334_1177780 Rattus norvegicus Ac2-121 mRNA, complete cds.      45   0.001   
gb:AF056116_2471084 Fugu rubripes serine/threonine kinase recept...    45   0.002   
gb:BC067021_2105913 Mus musculus RIKEN cDNA A730032D07 gene, mRN...    45   0.002   
gb:HSM801308_2017283 Homo sapiens mRNA; cDNA DKFZp434N0335 (from...    45   0.002   
gb:HSA243706_2001055 Homo sapiens mRNA for RB-binding protein (r...    45   0.002   
gb:HSA132440_2000289 Homo sapiens mRNA for PLU-1 protein.              45   0.002   
gb:AF087481_1881845 Homo sapiens retinoblastoma binding protein ...    45   0.002   
gb:AC115599_1205844 Dictyostelium discoideum chromosome 2 map 42...    45   0.002   
gb:AK042863_1166432 Mus musculus 7 days neonate cerebellum cDNA,...    45   0.002   
pir|T42697|T42697 hypothetical protein DKFZp434N0335.1 - human (...    45   0.002   Homo sapiens [man]
sp|P58268|REQU_CHICK|REQU_CHICK Zinc-finger protein ubi-d4 (Requiem) (Apopt...    45   0.002   Gallus gallus [bantam]
gb:BC070839_2555808 Xenopus laevis cDNA clone MGC:84564 IMAGE:66...    45   0.002   
gb:AB021740_2460989 Xenopus laevis mRNA for Requiem protein, par...    45   0.002   
gb:AB021738_2460987 Xenopus laevis mRNA for Requiem protein, par...    45   0.002   
gb:BC037661_2098121 Mus musculus fetal Alzheimer antigen, mRNA (...    45   0.002   
gb:AY138582_2076730 Mus musculus mixed-lineage leukemia 3 protei...    45   0.002   
gb:AY282495_1941893 Homo sapiens bromodomain PHD finger transcri...    45   0.002   
gb:AY024361_1934335 Homo sapiens MLL3 mRNA, complete cds.              45   0.002   
gb:AB032251_1866046 Homo sapiens BPTF mRNA for bromodomain PHD f...    45   0.002   
gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid c...    45   0.002   
gb:AK054270_1170760 Mus musculus 2 days pregnant adult female ov...    45   0.002   
pir|T01020|T01020 hypothetical protein YUP8H12R.3 - Arabidopsis ...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
sp|Q9W636|REQ2_XENLA|REQ2_XENLA Zinc-finger protein ubi-d4 2 (Requiem) (xRe...    45   0.002   Xenopus laevis [clawed frog]
sp|Q8BRH4|MLL3_MOUSE|MLL3_MOUSE Myeloid/lymphoid or mixed-lineage leukemia ...    45   0.002   Mus musculus [mouse]
sp|Q8NEZ4|MLL3_HUMAN|MLL3_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    45   0.002   Homo sapiens [man]
sp|Q12830|FALZ_HUMAN|FALZ_HUMAN Fetal Alzheimer antigen (Fetal Alz-50-react...    45   0.002   Homo sapiens [man]
gb:BC075306_2558411 Xenopus tropicalis D4, zinc and double PHD f...    44   0.003   
gb:AY069824_1294554 Drosophila melanogaster SD07276 full length ...    44   0.003   
gb:AE014297_1142361 Drosophila melanogaster chromosome 3R, compl...    44   0.003   
gb:AE014297_1142360 Drosophila melanogaster chromosome 3R, compl...    44   0.003   
gb:AE014297_1142359 Drosophila melanogaster chromosome 3R, compl...    44   0.003   
sp|P58267|DPF1_CHICK|DPF1_CHICK Zinc-finger protein neuro-d4 (D4, zinc and ...    44   0.003   Gallus gallus [bantam]
gb:AK039011_1165249 Mus musculus adult male hypothalamus cDNA, R...    44   0.004   
gb:BC080691_2107781 Mus musculus jumonji, AT rich interactive do...    44   0.005   
gb:BC010717_2091067 Mus musculus jumonji, AT rich interactive do...    44   0.005   
gb:HS127B20_1997060 Human DNA sequence from clone RP1-127B20 on ...    44   0.005   
gb:CR456448_1992739 Homo sapiens dJ127B20.3 full length open rea...    44   0.005   
gb:BC012187_1973508 Homo sapiens PHD finger protein 21B, mRNA (c...    44   0.005   
gb:AE013599_1130126 Drosophila melanogaster chromosome 2R, compl...    44   0.005   
gb:AE013599_1130125 Drosophila melanogaster chromosome 2R, compl...    44   0.005   
pir|T47337|T47337 nucleic acid binding protein-like - Arabidopsi...    44   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:BC072079_2556343 Xenopus laevis hypothetical protein LOC43223...    43   0.006   
gb:BC028397_1979256 Homo sapiens ubiquitin-like, containing PHD ...    43   0.006   
gb:AL133480_1918606 Human DNA sequence from clone RP11-307L3 on ...    43   0.006   
gb:AB071698_1871214 Homo sapiens NIRF mRNA for Np95-like ring fi...    43   0.006   
gb:BX908807_1644503 Neurospora crassa DNA linkage group III BAC ...    43   0.006   
pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo s...    43   0.006   Homo sapiens [man]
gb:AF362753_2489352 Gallus gallus cer-d4 mRNA, complete cds.           43   0.008   
gb:BC048180_2099574 Mus musculus jumonji, AT rich interactive do...    43   0.008   
gb:AY082429_2075966 Mus musculus PLU1 (Plu1) mRNA, complete cds....    43   0.008   
gb:BC048307_1984141 Homo sapiens Jumonji, AT rich interactive do...    43   0.008   
gb:ATAC010870_1543187 Arabidopsis thaliana chromosome III BAC T1...    43   0.008   
gb:AF417921_1269439 Drosophila melanogaster nucleosome remodelin...    43   0.008   
gb:AK041304_1165943 Mus musculus adult male aorta and vein cDNA,...    43   0.008   
gb:AE014296_1133984 Drosophila melanogaster chromosome 3L, compl...    43   0.008   
gb:AE014296_1133983 Drosophila melanogaster chromosome 3L, compl...    43   0.008   
gb:AE014296_1133982 Drosophila melanogaster chromosome 3L, compl...    43   0.008   
sp|P29375|RBB2_HUMAN|RBB2_HUMAN Retinoblastoma-binding protein 2 (RBBP-2).>...    43   0.008   Homo sapiens [man]
sp|P58270|DPF3_CHICK|DPF3_CHICK Zinc-finger protein DPF3 (cer-d4).>gb:AF362...    43   0.008   Gallus gallus [bantam]
gb:BC071280_2556026 Danio rerio zgc:85741, mRNA (cDNA clone MGC:...    42   0.010   
gb:AC124144_1740444 Oryza sativa (japonica cultivar-group) chrom...    42   0.010   
gb:AY064131_1566013 Arabidopsis thaliana AT5g09790/F17I14_20 mRN...    42   0.010   
gb:AB020752_1514691 Arabidopsis thaliana genomic DNA, chromosome...    42   0.010   
pir|T49919|T49919 hypothetical protein F17I14.20 - Arabidopsis t...    42   0.010   Arabidopsis thaliana [mouse-ear cress]
pir|A88925|A88925 protein F33E11.3 [imported] - Caenorhabditis e...    42   0.010   Caenorhabditis elegans [roundworm]
sp|P56163|DPF1_RAT|DPF1_RAT Zinc-finger protein neuro-d4 (D4, zinc and do...    42   0.010   Rattus norvegicus [brown rat]
sp|Q92782|DPF1_HUMAN|DPF1_HUMAN Zinc-finger protein neuro-d4 (D4, zinc and ...    42   0.010   Homo sapiens [man]
gb:BC086142_2564725 Xenopus laevis hypothetical LOC495762, mRNA ...    42   0.013   
gb:BT007983_2150915 Synthetic construct Homo sapiens requiem, ap...    42   0.013   
gb:BC007188_2090579 Mus musculus D4, zinc and double PHD fingers...    42   0.013   
gb:AL596125_2070891 Mouse DNA sequence from clone RP23-5O23 on c...    42   0.013   
gb:AF108134_2054741 Mus musculus ubi-d4/requiem gene, exons 2 th...    42   0.013   
gb:AY030283_1934506 Homo sapiens PHD zinc finger transcription f...    42   0.013   
gb:AY087173_1572207 Arabidopsis thaliana clone 32443 mRNA, compl...    42   0.013   
gb:ATT2L20_1555744 Arabidopsis thaliana DNA chromosome 5, BAC cl...    42   0.013   
gb:CR925955_1185487 Pongo pygmaeus mRNA; cDNA DKFZp459N0520 (fro...    42   0.013   
pir|A55302|A55302 probable transcription factor requiem - mouse>...    42   0.013   Mus musculus [mouse]
pir|T01840|T01840 hypothetical protein F9D12.13 - Arabidopsis th...    42   0.013   Arabidopsis thaliana [mouse-ear cress]
sp|Q61103|REQU_MOUSE|REQU_MOUSE Zinc-finger protein ubi-d4 (Requiem) (Apopt...    42   0.013   Mus musculus [mouse]
sp|Q92785|REQU_HUMAN|REQU_HUMAN Zinc-finger protein ubi-d4 (Requiem) (Apopt...    42   0.013   Homo sapiens [man]
gb:BC076654_2559403 Xenopus tropicalis protein kinase C binding ...    42   0.017   
gb:BC068803_2555303 Xenopus laevis hypothetical protein MGC81393...    42   0.017   
gb:HSU52365_2024740 Human SMCY mRNA, partial cds.                      42   0.017   
gb:HSU52191_2024737 Human SMCY (H-Y) mRNA, complete cds.               42   0.017   
gb:D87072_1995302 Homo sapiens mRNA for KIAA0234 gene, partial cds.    42   0.017   
gb:AK044828_1167155 Mus musculus 9.5 days embryo parthenogenote ...    42   0.017   
sp|Q9BY66|SMCY_HUMAN|SMCY_HUMAN SmcY protein (Histocompatibility Y antigen)...    42   0.017   Homo sapiens [man]
gb:AF274047_2061191 Mus musculus nuclear zinc finger protein Np9...    41   0.023   
gb:AB116653_2048588 Mus musculus NIRF mRNA for Np95-like ring fi...    41   0.023   
gb:AY736376_1960736 Pan troglodytes JARID1D mRNA, complete cds.        41   0.023   
gb:SPBP19A11_1720579 S.pombe chromosome II cosmid p19A11.              41   0.023   
gb:OSJN00088_1694673 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.023   
gb:CR382138_1671563 Debaryomyces hansenii chromosome F of strain...    41   0.023   
gb:AC116977_1206991 Dictyostelium discoideum chromosome 2 map 55...    41   0.023   
gb:CR858238_1182423 Pongo pygmaeus mRNA; cDNA DKFZp469B034 (from...    41   0.023   
gb:AK080925_1173132 Mus musculus 4 days neonate male adipose cDN...    41   0.023   
gb:HSAJ9610_2010458 Homo sapiens AIRE gene.                            41   0.030   
gb:AL390212_1926544 Human DNA sequence from clone RP1-29M10 on c...    41   0.030   
gb:AF186605_1888632 Homo sapiens MLL2 protein mRNA, partial cds.       41   0.030   
gb:AF104918_1883939 Homo sapiens myeloid/lymphoid leukemia 2 (ML...    41   0.030   
gb:AB032951_1866132 Homo sapiens mRNA for KIAA1125 protein, part...    41   0.030   
gb:AB002302_1863609 Homo sapiens mRNA for KIAA0304 protein, part...    41   0.030   
gb:BT008599_1639814 Arabidopsis thaliana clone U09668 unknown pr...    41   0.030   
gb:AY034984_1559764 Arabidopsis thaliana unknown protein (At1g05...    41   0.030   
gb:AB015475_1512585 Arabidopsis thaliana genomic DNA, chromosome...    41   0.030   
gb:AY069463_1294193 Drosophila melanogaster LD18949 full length ...    41   0.030   
gb:HSM807170_1187825 Homo sapiens mRNA; cDNA DKFZp686L09243 (fro...    41   0.030   
gb:AE014134_1127749 Drosophila melanogaster chromosome 2L, compl...    41   0.030   
gb:AE014134_1127490 Drosophila melanogaster chromosome 2L, compl...    41   0.030   
gb:AE005172_889562 Arabidopsis thaliana chromosome 1, top arm co...    41   0.030   
pir|H96684|H96684 probable RING zinc finger protein F15E12.8 [im...    41   0.030   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ULU4|PKCB_HUMAN|PKCB_HUMAN Protein kinase C binding protein 1 (Rack7) ...    41   0.030   Homo sapiens [man]
sp|Q9UMN6|MLL4_HUMAN|MLL4_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    41   0.030   Homo sapiens [man]
sp|O43918|AIRE_HUMAN|AIRE_HUMAN Autoimmune regulator (Autoimmune polyendocr...    41   0.030   Homo sapiens [man]
gb:BC087250_2565106 Xenopus laevis hypothetical LOC495907, mRNA ...    40   0.039   
gb:BC058064_2552252 Danio rerio protein kinase C binding protein...    40   0.039   
gb:BC065123_2105542 Mus musculus cDNA sequence BC065123, mRNA (c...    40   0.039   
gb:BC056344_2102322 Mus musculus cDNA clone IMAGE:5704432, parti...    40   0.039   
gb:BC048186_2099580 Mus musculus protein kinase C binding protei...    40   0.039   
gb:BC043080_2098814 Mus musculus PHD finger protein 12, mRNA (cD...    40   0.039   
gb:AL669840_2072479 Mouse DNA sequence from clone RP23-43J1 on c...    40   0.039   
gb:AL669840_2072478 Mouse DNA sequence from clone RP23-43J1 on c...    40   0.039   
gb:AB182318_2049738 Mus musculus Mll2 mRNA for mixed lineage leu...    40   0.039   
gb:AB093284_2048069 Mus musculus mRNA for mKIAA1125 protein.           40   0.039   
gb:AB093223_2048008 Mus musculus mRNA for mKIAA0304 protein.           40   0.039   
gb:AF221130_1890779 Homo sapiens chromatin remodeling factor WCR...    40   0.039   
gb:AB006684_1863865 Homo sapiens APECED gene for AIRE-1, AIRE-2,...    40   0.039   
gb:AB006683_1863862 Homo sapiens APECED mRNA for AIRE-2, complet...    40   0.039   
gb:AP003508_1830068 Oryza sativa (japonica cultivar-group) genom...    40   0.039   
gb:AB037135_1519096 Oryza sativa (japonica cultivar-group) OsORC...    40   0.039   
gb:AB016874_1512951 Arabidopsis thaliana genomic DNA, chromosome...    40   0.039   
gb:AX878499_1477459 Sequence 13404 from Patent EP1074617.              40   0.039   
gb:HSM800156_1185750 Homo sapiens mRNA; cDNA DKFZp586E0518 (from...    40   0.039   
gb:AK047427_1168102 Mus musculus 10 days neonate cerebellum cDNA...    40   0.039   
pir|T08738|T08738 hypothetical protein DKFZp586E0518.1 - human (...    40   0.039   Homo sapiens [man]
pir|E85135|E85135 hypothetical protein AT4g12620 [imported] - Ar...    40   0.039   Arabidopsis thaliana [mouse-ear cress]
sp|Q09819|YAC5_SCHPO|YAC5_SCHPO Hypothetical protein C16C9.05 in chromosome...    40   0.039   Schizosaccharomyces pombe
sp|Q9NRL2|BA1A_HUMAN|BA1A_HUMAN Bromodomain adjacent to zinc finger domain ...    40   0.039   Homo sapiens [man]
gb:BT007800_2150732 Synthetic construct Homo sapiens chromodomai...    40   0.051   
gb:MMSMCX3_2117378 M.domesticus Smcx mRNA.                             40   0.051   
gb:BC043096_2098829 Mus musculus jumonji, AT rich interactive do...    40   0.051   
gb:AY036886S1_2074338 Mus musculus MLL3-like protein mRNA, parti...    40   0.051   
gb:AK129096_2069327 Mus musculus mRNA for mKIAA0234 protein.           40   0.051   
gb:AF127245_2055525 Mus musculus Smcx (Smcx) mRNA, complete cds.       40   0.051   
gb:BC054499_1985182 Homo sapiens Smcy homolog, X-linked (mouse),...    40   0.051   
gb:BC020810_1977223 Homo sapiens chromodomain helicase DNA bindi...    40   0.051   
gb:BC007347_1970662 Homo sapiens chromodomain helicase DNA bindi...    40   0.051   
gb:AL139396_1920695 Human DNA sequence from clone RP11-258C19 on...    40   0.051   
gb:AL139396_1920694 Human DNA sequence from clone RP11-258C19 on...    40   0.051   
gb:AL139396_1920693 Human DNA sequence from clone RP11-258C19 on...    40   0.051   
gb:AF264750_1893756 Homo sapiens ALR-like protein mRNA, complete...    40   0.051   
gb:AC006474_1875155 Homo sapiens PAC clone RP4-669I17 from 7, co...    40   0.051   
gb:AB040939_1866868 Homo sapiens mRNA for KIAA1506 protein, part...    40   0.051   
gb:AB032252_1866047 Homo sapiens BAZ1A mRNA for bromodomain adja...    40   0.051   
gb:AP000366_1819727 Oryza sativa (japonica cultivar-group) genom...    40   0.051   
gb:AK175694_1817682 Arabidopsis thaliana mRNA for hypothetical p...    40   0.051   
gb:BT010568_1640514 Arabidopsis thaliana At1g66050 gene, complet...    40   0.051   
gb:AY088087_1573111 Arabidopsis thaliana clone 41104 mRNA, compl...    40   0.051   
gb:AF132069_1414620 Sus scrofa SMCX (SMCX) mRNA, partial cds.          40   0.051   
gb:AF314193_1261649 Drosophila melanogaster Toutatis (tou) gene,...    40   0.051   
gb:CR859025_1183165 Pongo pygmaeus mRNA; cDNA DKFZp468O0728 (fro...    40   0.051   
gb:CR858251_1182436 Pongo pygmaeus mRNA; cDNA DKFZp469E1718 (fro...    40   0.051   
gb:CR627422_1180791 Homo sapiens mRNA; cDNA DKFZp781D1727 (from ...    40   0.051   
gb:AE013599_1131296 Drosophila melanogaster chromosome 2R, compl...    40   0.051   
pir|A96685|A96685 probable RING zinc finger protein F15E12.5 [im...    40   0.051   Arabidopsis thaliana [mouse-ear cress]
pir|A86280|A86280 F14L17.29 protein - Arabidopsis thaliana>gb:AE...    40   0.051   Arabidopsis thaliana [mouse-ear cress]
pir|I48775|I48775 Smcx protein (escapes X-chromosome inactivatio...    40   0.051   Mus musculus [mouse]
sp|Q09698|YA27_SCHPO|YA27_SCHPO Hypothetical protein C2F7.07c in chromosome...    40   0.051   Schizosaccharomyces pombe
sp|P41230|JD1C_MOUSE|JD1C_MOUSE Jumonji/ARID domain-containing protein 1C (...    40   0.051   Mus musculus [mouse]
sp|P41229|JD1C_HUMAN|JD1C_HUMAN Jumonji/ARID domain-containing protein 1C (...    40   0.051   Homo sapiens [man]
sp|O14647|CHD2_HUMAN|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2...    40   0.051   Homo sapiens [man]
gb:AK176778_1818766 Arabidopsis thaliana mRNA for zinc finger-li...    40   0.066   
gb:AC137623_1743703 Oryza sativa (japonica cultivar-group) chrom...    40   0.066   
gb:AB012243_1511731 Arabidopsis thaliana genomic DNA, chromosome...    40   0.066   
gb:AB005241_1509494 Arabidopsis thaliana genomic DNA, chromosome...    40   0.066   
gb:AK037737_1164907 Mus musculus 16 days neonate thymus cDNA, RI...    40   0.066   
sp|Q9Z277|BA1B_MOUSE|BA1B_MOUSE Bromodomain adjacent to zinc finger domain ...    40   0.066   Mus musculus [mouse]
gb:MMSMCY4_2117379 M.musculus (BALB/C) Smcy gene.                      39   0.086   
gb:AL596125_2070890 Mouse DNA sequence from clone RP23-5O23 on c...    39   0.086   
gb:HSU26311_2023023 Human heterochromatin protein HP1Hs-alpha mR...    39   0.086   
gb:CR457418_1993625 Homo sapiens full open reading frame cDNA cl...    39   0.086   
gb:AP004885_1846609 Oryza sativa (japonica cultivar-group) genom...    39   0.086   
gb:AF417481_1798280 Zea mays origin recognition complex subunit ...    39   0.086   
gb:AE017349_1758734 Cryptococcus neoformans var. neoformans JEC2...    39   0.086   
gb:OSJN00099_1694895 Oryza sativa genomic DNA, chromosome 4, BAC...    39   0.086   
gb:ECU52364_1439782 Equus caballus SMCY mRNA, partial cds.             39   0.086   
gb:AC006661_1203584 Caenorhabditis elegans fosmid H20J04, comple...    39   0.086   
gb:AK047790_1168204 Mus musculus adult male corpus striatum cDNA...    39   0.086   
pir|D96660|D96660 protein F2K11.14 [imported] - Arabidopsis thal...    39   0.086   Arabidopsis thaliana [mouse-ear cress]
pir|G01808|G01808 HP1Hs-alpha - human (fragment)                       39   0.086   Homo sapiens [man]
pir|I48776|I48776 spermatogenesis related protein Smcy [imported...    39   0.086   Mus musculus [mouse]
sp|Q62240|SMCY_MOUSE|SMCY_MOUSE SmcY protein (Histocompatibility Y antigen)...    39   0.086   Mus musculus [mouse]
sp|P45973|CBX5_HUMAN|CBX5_HUMAN Chromobox protein homolog 5 (Heterochromati...    39   0.086   Homo sapiens [man]
gb:AY548740_2086462 Cricetulus griseus heterochromatin protein 1...    39   0.11    
gb:BC046124_1983666 Homo sapiens hepatitis B virus x associated ...    39   0.11    
gb:AF380176_1899471 Homo sapiens HBV pX associated protein 8 lar...    39   0.11    
gb:AF227948_1891564 Homo sapiens HBV pX associated protein-8 mRN...    39   0.11    
gb:AP000370_1819763 Arabidopsis thaliana genomic DNA, chromosome...    39   0.11    
gb:AF542528_1810062 Cryptococcus neoformans var. grubii strain 1...    39   0.11    
gb:AF045571_1763830 Oryza sativa nucleic acid binding protein mR...    39   0.11    
gb:AX876376_1476501 Sequence 11281 from Patent EP1074617.>gb:AK0...    39   0.11    
gb:AX150428_1462627 Sequence 19 from Patent EP1120463.                 39   0.11    
pir|T51145|T51145 nucleic acid binding protein [imported] - rice...    39   0.11    Oryza sativa [red rice]
pir|T02745|T02745 nucleic acid binding protein - rice>gb:AF04742...    39   0.11    Oryza sativa [red rice]
sp|Q61686|CBX5_MOUSE|CBX5_MOUSE Chromobox protein homolog 5 (Heterochromati...    39   0.11    Mus musculus [mouse]
gb:BC043787_2548246 Xenopus laevis PHD finger protein 12, mRNA (...    39   0.15    
gb:AJ721121_2503308 Gallus gallus mRNA for hypothetical protein,...    39   0.15    
gb:BC085127_2109078 Mus musculus hepatitis B virus x associated ...    39   0.15    
gb:AK173024_2069958 Mus musculus mRNA for mKIAA0783 protein.           39   0.15    
gb:AF542530_1810115 Cryptococcus neoformans var. neoformans stra...    39   0.15    
gb:CR380956_1652051 Candida glabrata strain CBS138 chromosome J ...    39   0.15    
gb:AY710429_1623904 Cryptococcus gattii strain E566 MATa locus, ...    39   0.15    
gb:AC073405_1541057 Oryza sativa (japonica cultivar-group) chrom...    39   0.15    
gb:BT011124_1357731 Drosophila melanogaster LD09942 full insert ...    39   0.15    
gb:AY162410_1188195 Mus musculus strain 129/SvJ chromosome 6 and...    39   0.15    
gb:AK089073_1175786 Mus musculus 2 days neonate thymus thymic ce...    39   0.15    
gb:AK003209_1151723 Mus musculus 18-day embryo whole body cDNA, ...    39   0.15    
gb:AE014297_1138009 Drosophila melanogaster chromosome 3R, compl...    39   0.15    
gb:AE013599_1133630 Drosophila melanogaster chromosome 2R, compl...    39   0.15    
gb:AE013599_1131297 Drosophila melanogaster chromosome 2R, compl...    39   0.15    
gb:AF036382_2469894 Fugu rubripes MLL (MLL) gene, complete cds.        38   0.19    
gb:AF004397_2468178 Gallus gallus chromo-helicase-DNA-binding on...    38   0.19    
gb:AF084479_1881689 Homo sapiens Williams-Beuren syndrome deleti...    38   0.19    
gb:AF072810_1880883 Homo sapiens transcription factor WSTF mRNA,...    38   0.19    
gb:AP005246_1849464 Oryza sativa (japonica cultivar-group) genom...    38   0.19    
gb:AF542531_1810159 Cryptococcus neoformans var. neoformans stra...    38   0.19    
gb:AE017344_1756529 Cryptococcus neoformans var. neoformans JEC2...    38   0.19    
gb:AC133007_1741283 Oryza sativa chromosome 3 BAC OSJNBa0094J08 ...    38   0.19    
gb:AC104433_1737619 Oryza sativa chromosome 3 BAC OJ1754_E06 gen...    38   0.19    
gb:AC087852_1734202 Oryza sativa chromosome 3 BAC OJ1124_H03 gen...    38   0.19    
gb:SCYJR120W_1712918 S.cerevisiae chromosome X reading frame ORF...    38   0.19    
gb:BX842619_1643715 Neurospora crassa DNA linkage group V cosmid...    38   0.19    
gb:AY442258_1606336 Populus alba x Populus tremula clone cET-1-p...    38   0.19    
gb:AC073395_1541025 Arabidopsis thaliana chromosome 3 BAC F11B9 ...    38   0.19    
gb:CR382400_1375067 Plasmodium falciparum chromosome 6, complete...    38   0.19    
sp|P47156|YJ89_YEAST|YJ89_YEAST Hypothetical 85.0 kDa protein in STE24-ATP2...    38   0.19    
sp|Q9UIG0|BA1B_HUMAN|BA1B_HUMAN Bromodomain adjacent to zinc finger domain ...    38   0.19    
gb:AY217131_2519725 Taeniopygia guttata chromo-helicase DNA-bind...    38   0.25    
gb:AF277982_1782793 Arabidopsis thaliana origin recognition comp...    38   0.25    
gb:OSJN00050_1693903 Oryza sativa genomic DNA, chromosome 4, BAC...    38   0.25    
gb:AY710430_1623929 Cryptococcus gattii strain WM276 MATalpha lo...    38   0.25    
gb:AY421964_1605134 Cryptococcus gattii strain ATCC 32609 MAT-al...    38   0.25    
gb:AC012561_1537693 Arabidopsis thaliana chromosome I BAC F11F12...    38   0.25    
gb:CR861442_1185437 Pongo pygmaeus mRNA; cDNA DKFZp459F162 (from...    38   0.25    
gb:AK018349_1159534 Mus musculus 12 days embryo female ovary cDN...    38   0.25    
pir|G96542|G96542 hypothetical protein F17J6.14 [imported] - Ara...    38   0.25    
gb:AB032253_1866048 Homo sapiens BAZ1B mRNA for bromodomain adja...    37   0.33    
gb:AP003561_1830801 Oryza sativa (japonica cultivar-group) genom...    37   0.33    
gb:AE017347_1757831 Cryptococcus neoformans var. neoformans JEC2...    37   0.33    
gb:BT020377_1642772 Arabidopsis thaliana At3g20280 gene, complet...    37   0.33    
gb:AB024036_1515840 Arabidopsis thaliana genomic DNA, chromosome...    37   0.33    
gb:DME238397_1378925 Drosophila melanogaster mRNA for chromatin ...    37   0.33    
gb:AF148962_1245145 Drosophila melanogaster ATP-dependent chroma...    37   0.33    
gb:AE014297_1142395 Drosophila melanogaster chromosome 3R, compl...    37   0.33    
gb:BC073196_2557051 Xenopus laevis cDNA clone MGC:80447 IMAGE:51...    37   0.43    
gb:AY168927_2516409 Xenopus laevis heterochromatin protein 1 alp...    37   0.43    
gb:AF130453_2475737 Xenopus laevis polycomblike PCL1 mRNA, compl...    37   0.43    
gb:BC083796_2108864 Rattus norvegicus protein kinase C binding p...    37   0.43    
gb:BC063267_2105226 Mus musculus protein kinase C binding protei...    37   0.43    
gb:BC040236_2098488 Mus musculus PHD finger protein 14, mRNA (cD...    37   0.43    
gb:BC023300_2094115 Mus musculus protein kinase C binding protei...    37   0.43    
gb:HS569M23_1999074 Human DNA sequence from clone RP4-569M23 on ...    37   0.43    
gb:BC030721_1979933 Homo sapiens protein kinase C binding protei...    37   0.43    
gb:AL390212_1926545 Human DNA sequence from clone RP1-29M10 on c...    37   0.43    
gb:AB018326_1864969 Homo sapiens mRNA for KIAA0783 protein, part...    37   0.43    
gb:AP006751_1862852 Oryza sativa (japonica cultivar-group) genom...    37   0.43    
gb:AE017344_1756379 Cryptococcus neoformans var. neoformans JEC2...    37   0.43    
gb:ATH421410_1552561 Arabidopsis thaliana mRNA for origin recogn...    37   0.43    
gb:AX970044_1485353 Sequence 847 from Patent EP1104808.                37   0.43    
gb:HSM802169_1186622 Homo sapiens mRNA; cDNA DKFZp564P1772 (from...    37   0.43    
pir|D96612|D96612 hypothetical protein F12K22.15 [imported] - Ar...    37   0.43    
sp|Q9D4H9|PHFE_MOUSE|PHFE_MOUSE PHD finger protein 14.>gb:AK016517_1158755 ...    37   0.43    
sp|O94880|PHFE_HUMAN|PHFE_HUMAN PHD finger protein 14.                            37   0.43    
gb:BX255881_2567144 Zebrafish DNA sequence from clone CH211-268E...    37   0.56    
gb:AF181826_2478902 Gallus gallus chromosome W chromodomain heli...    37   0.56    
gb:BX883042_2111370 Rattus norvegicus chromosome 20, major histo...    37   0.56    
gb:BC083843_2108906 Rattus norvegicus PHD finger protein 1, mRNA...    37   0.56    
gb:AF128125_2055565 Mus musculus autoimmune regulator (Aire) mRN...    37   0.56    
gb:AF128121_2055561 Mus musculus autoimmune regulator (Aire) mRN...    37   0.56    
gb:AF128117_2055557 Mus musculus autoimmune regulator (Aire) mRN...    37   0.56    
gb:HSU63420_2025376 Human Sp140 protein (Sp140) mRNA, complete cds.    37   0.56    
gb:AF330040_1896997 Homo sapiens IL-5 promoter REII-region-bindi...    37   0.56    
gb:AF071593_1880830 Homo sapiens MMSET type II (WHSC1) mRNA, com...    37   0.56    
gb:AB029013_1865869 Homo sapiens mRNA for KIAA1090 protein, part...    37   0.56    
gb:AE017344_1756545 Cryptococcus neoformans var. neoformans JEC2...    37   0.56    
gb:AE016820_1749879 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.56    
gb:AB007646_1510173 Arabidopsis thaliana genomic DNA, chromosome...    37   0.56    
pir|T24864|T24864 hypothetical protein T12D8.1 - Caenorhabditis ...    37   0.56    
sp|Q13342|LY10_HUMAN|LY10_HUMAN LYSp100 protein (Lymphoid-restricted homolo...    37   0.56    
gb:AY217129_2519723 Taeniopygia guttata chromo-helicase DNA-bind...    36   0.73    
gb:BC053454_2101522 Mus musculus Wolf-Hirschhorn syndrome candid...    36   0.73    
gb:BC046473_2099246 Mus musculus Wolf-Hirschhorn syndrome candid...    36   0.73    
gb:AK129287_2069518 Mus musculus mRNA for mKIAA1090 protein.           36   0.73    
gb:AF128124_2055564 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128123_2055563 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128122_2055562 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128120_2055560 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128119_2055559 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128118_2055558 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128116_2055556 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:AF128115_2055555 Mus musculus autoimmune regulator (Aire) mRN...    36   0.73    
gb:HSU04737_2021577 Human breakpoint cluster region 11q23 (ALL-1...    36   0.73    
gb:AP004670_1843056 Oryza sativa (japonica cultivar-group) genom...    36   0.73    
gb:AF542529_1810094 Cryptococcus neoformans var. grubii strain H...    36   0.73    
gb:AF542529_1810082 Cryptococcus neoformans var. grubii strain H...    36   0.73    
gb:BT012223_1641429 Arabidopsis thaliana At5g24330 gene, complet...    36   0.73    
gb:AB028236_1517849 Tricholoma matsutake LTR retroelement MarY1 ...    36   0.73    
gb:AK078622_1172393 Mus musculus adult male adrenal gland cDNA, ...    36   0.73    
gb:AE013599_1131298 Drosophila melanogaster chromosome 2R, compl...    36   0.73    
pir|T33152|T33152 hypothetical protein T04D1.4 - Caenorhabditis ...    36   0.73    
sp|Q04779|YMW5_YEAST|YMW5_YEAST Hypothetical 78.8 kDa protein in ABF2-CHL12...    36   0.73    
sp|Q9Z0E3|AIRE_MOUSE|AIRE_MOUSE Autoimmune regulator (Autoimmune polyendocr...    36   0.73    
gb:BC061619_2553255 Xenopus tropicalis hypothetical protein MGC7...    36   0.95    
gb:BC058999_2103566 Mus musculus zinc finger, MYND domain contai...    36   0.95    
gb:AB162618_2049381 Rattus norvegicus BS69 mRNA for BS69-beta, c...    36   0.95    
gb:AB162617_2049380 Rattus norvegicus BS69 mRNA for BS69-alpha, ...    36   0.95    
gb:BC034784_1981392 Homo sapiens zinc finger, MYND domain contai...    36   0.95    
gb:BC012586_1973690 Homo sapiens zinc finger, MYND domain contai...    36   0.95    
gb:AL589988_1929252 Human DNA sequence from clone RP11-10D13 on ...    36   0.95    
gb:AL589988_1929251 Human DNA sequence from clone RP11-10D13 on ...    36   0.95    
gb:AP005895_1859795 Oryza sativa (japonica cultivar-group) genom...    36   0.95    
gb:AP004365_1840816 Oryza sativa (japonica cultivar-group) genom...    36   0.95    
gb:AF286030_1783184 Ustilago maydis regulator Ustilago maydis 1 ...    36   0.95    
gb:AY710430_1623947 Cryptococcus gattii strain WM276 MATalpha lo...    36   0.95    
gb:AY448010S1_1606572 Ipomoea trifida haplotype S1 self-incompat...    36   0.95    
gb:AC079038_1541804 Oryza sativa chromosome 7 clone OSJNBb0024A2...    36   0.95    
gb:CR860460_1184528 Pongo pygmaeus mRNA; cDNA DKFZp459P121 (from...    36   0.95    
gb:CR860268_1184355 Pongo pygmaeus mRNA; cDNA DKFZp459I035 (from...    36   0.95    
gb:AK049686_1168920 Mus musculus 12 days embryo spinal cord cDNA...    36   0.95    
gb:AK028931_1161242 Mus musculus 10 days neonate skin cDNA, RIKE...    36   0.95    
pir|D86385|D86385 hypothetical protein F2J7.6 - Arabidopsis thal...    36   0.95    
pir|A47392|A47392 chromodomain-helicase-DNA-binding protein, CHD...    36   0.95    
sp|Q8R5C8|ZM11_MOUSE|ZM11_MOUSE Zinc finger MYND domain containing protein ...    36   0.95    
sp|Q15326|ZM11_HUMAN|ZM11_HUMAN Zinc finger MYND domain containing protein ...    36   0.95    
sp|P40201|CHD1_MOUSE|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1...    36   0.95    
sp|O14646|CHD1_HUMAN|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1...    36   0.95    
gb:BC077116_2559836 Danio rerio zgc:101049, mRNA (cDNA clone MGC...    35   1.2     
gb:MMU81490_2123608 Mus musculus polycomblike (mPcl1) mRNA, comp...    35   1.2     
gb:BC081971_2108209 Rattus norvegicus SP140 nuclear body protein...    35   1.2     
gb:BC015077_2092080 Mus musculus PHD finger protein 1, mRNA (cDN...    35   1.2     
gb:AB011550_2043668 Mus musculus Tctex-3 mRNA, complete cds.           35   1.2     
gb:HSA295991_2002906 Homo sapiens mRNA for Putative Chromatin mo...    35   1.2     
gb:AL662799_1931456 Human DNA sequence from clone XXbac-294E21 o...    35   1.2     
gb:AL662799_1931455 Human DNA sequence from clone XXbac-294E21 o...    35   1.2     
gb:AF029678_1877595 Homo sapiens PHD Finger 1 (PHF1) mRNA, compl...    35   1.2     
gb:AF528565_1808586 Zea mays cultivar BSSS53 chromosome 4 clone ...    35   1.2     
gb:AB160889_1528464 Tricholoma matsutake pol gene for polyprotei...    35   1.2     
sp|Q9Z1B8|PHF1_MOUSE|PHF1_MOUSE PHD finger protein 1 (PHF1 protein) (T-comp...    35   1.2     
sp|O43189|PHF1_HUMAN|PHF1_HUMAN PHD finger protein 1 (PHF1 protein).>gb:AF0...    35   1.2     
gb:MMU307670_2120687 Mus musculus St5 gene, L27a gene and Kiaa02...    35   1.6     
gb:BC019446_2092924 Mus musculus jumonji, AT rich interactive do...    35   1.6     
gb:AY572455_2086631 Mus musculus transcriptional intermediary fa...    35   1.6     
gb:AY572454_2086630 Mus musculus transcriptional intermediary fa...    35   1.6     
gb:AE017346_1757456 Cryptococcus neoformans var. neoformans JEC2...    35   1.6     
gb:AY553842_1613501 Lycopersicon esculentum nucleic acid-binding...    35   1.6     
gb:AB026658_1517372 Arabidopsis thaliana genomic DNA, chromosome...    35   1.6     
gb:BT011071_1357678 Drosophila melanogaster SD21488 full insert ...    35   1.6     
gb:AB164414_1202000 Hemicentrotus pulcherrimus mRNA for unichrom...    35   1.6     
gb:AE014134_1127280 Drosophila melanogaster chromosome 2L, compl...    35   1.6     
pir|T13944|T13944 chromodomain helicase - fruit fly (Drosophila ...    35   1.6     
gb:BC087529_2565365 Xenopus laevis hypothetical LOC496172, mRNA ...    35   2.1     
gb:BC068898_2555394 Xenopus laevis hypothetical protein MGC83092...    35   2.1     
gb:BC079003_2107146 Rattus norvegicus cDNA clone MGC:93912 IMAGE...    35   2.1     
gb:HSM802382_2017479 Homo sapiens mRNA; cDNA DKFZp434I2412 (from...    35   2.1     
gb:HSM801343_2017298 Homo sapiens mRNA; cDNA DKFZp434I0617 (from...    35   2.1     
gb:HSM801319_2017286 Homo sapiens mRNA; cDNA DKFZp434D0815 (from...    35   2.1     
gb:AF174482_1887899 Homo sapiens polycomb 3 mRNA, complete cds.>...    35   2.1     
gb:AB015348_1864716 Homo sapiens HRIHFB2060 mRNA, partial cds.         35   2.1     
gb:AP002029_1821448 Arabidopsis thaliana genomic DNA, chromosome...    35   2.1     
gb:AP000418_1820129 Arabidopsis thaliana genomic DNA, chromosome...    35   2.1     
gb:CR382138_1670948 Debaryomyces hansenii chromosome F of strain...    35   2.1     
gb:CR382126_1659494 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   2.1     
gb:BT015937_1642555 Arabidopsis thaliana At5g20510 mRNA, complet...    35   2.1     
gb:AY710429_1623914 Cryptococcus gattii strain E566 MATa locus, ...    35   2.1     
gb:AB160889_1528465 Tricholoma matsutake pol gene for polyprotei...    35   2.1     
gb:AX879336_1477776 Sequence 14241 from Patent EP1074617.              35   2.1     
gb:AX879260_1477740 Sequence 14165 from Patent EP1074617.              35   2.1     
gb:CEH06O01_1364971 Caenorhabditis elegans fosmid H06O01, comple...    35   2.1     
pir|T45908|T45908 hypothetical protein F4P12.380 - Arabidopsis t...    35   2.1     
pir|T23056|T23056 chromodomain helicase H06O01.2 - Caenorhabditi...    35   2.1     
sp|Q9QXV1|CBX8_MOUSE|CBX8_MOUSE Chromobox protein homolog 8 (Polycomb 3 hom...    35   2.1     
sp|Q9HC52|CBX8_HUMAN|CBX8_HUMAN Chromobox protein homolog 8 (Polycomb 3 hom...    35   2.1     
sp|Q8UVR5|BA1A_XENLA|BA1A_XENLA ATP-utilizing chromatin assembly and remode...    35   2.1     
gb:BC072759_2556688 Xenopus laevis cDNA clone IMAGE:5073138, par...    34   2.8     
gb:AF101438_2473696 Xenopus laevis Polycomb homolog Pc1 (Pc1) mR...    34   2.8     
gb:S78219_2139539 nuclear protein TIF1 [mice, mRNA, 3951 nt].          34   2.8     
gb:MMY13274_2124460 Mus musculus mRNA for M33 polycomb-like prot...    34   2.8     
gb:BC035199_2097806 Mus musculus chromobox homolog 2 (Drosophila...    34   2.8     
gb:BC025482_2095017 Mus musculus tripartite motif protein 24, mR...    34   2.8     
gb:BC004252_1969114 Homo sapiens hypothetical protein MGC10561, ...    34   2.8     
gb:AF119042_1884725 Homo sapiens transcriptional intermediary fa...    34   2.8     
gb:AF009353_1876143 Homo sapiens transcription intermediary fact...    34   2.8     
gb:AF542530_1810119 Cryptococcus neoformans var. neoformans stra...    34   2.8     
gb:AF542528_1810052 Cryptococcus neoformans var. grubii strain 1...    34   2.8     
gb:AF370586_1792369 Arabidopsis thaliana Unknown protein (At2g18...    34   2.8     
gb:AY080874_1568558 Arabidopsis thaliana putative chloroplast nu...    34   2.8     
gb:AE014298_1124516 Drosophila melanogaster chromosome X, comple...    34   2.8     
pir|B84560|B84560 hypothetical protein At2g18090 [imported] - Ar...    34   2.8     
pir|T02518|T02518 hypothetical protein At2g37520 [imported] - Ar...    34   2.8     
pir|I51693|I51693 XPolycomb - African clawed frog>gb:XLU39929_25...    34   2.8     
pir|C84507|C84507 hypothetical protein At2g13370 [imported] - Ar...    34   2.8     
sp|Q64127|TF1A_MOUSE|TF1A_MOUSE Transcription intermediary factor 1-alpha (...    34   2.8     
sp|O15164|TF1A_HUMAN|TF1A_HUMAN Transcription intermediary factor 1-alpha (...    34   2.8     
sp|P30658|CBX2_MOUSE|CBX2_MOUSE Chromobox protein homolog 2 (Modifier 3 pro...    34   2.8     
gb:AY145834_2515065 Xenopus laevis putative chromatin remodellin...    34   3.6     
gb:HUMNUCPHOY_2035215 Homo sapiens nuclear phosphoprotein mRNA, ...    34   3.6     
gb:BC001657_1967748 Homo sapiens PHD finger protein 12, mRNA (cD...    34   3.6     
gb:AK160370_1918102 Homo sapiens mRNA for FLJ00295 protein.            34   3.6     
gb:AF280095_1894539 Homo sapiens transcriptional coactivator Sp1...    34   3.6     
gb:AY093116_1575070 Arabidopsis thaliana putative PHD-type zinc ...    34   3.6     
gb:AC004136_1531446 Arabidopsis thaliana chromosome 2 BAC T8K22 ...    34   3.6     
gb:AC002521_1530811 Arabidopsis thaliana chromosome 2 clone T20F...    34   3.6     
gb:AK086118_1174664 Mus musculus 15 days embryo head cDNA, RIKEN...    34   3.6     
gb:AK040994_1165819 Mus musculus adult male aorta and vein cDNA,...    34   3.6     
gb:AK039562_1165430 Mus musculus adult male spinal cord cDNA, RI...    34   3.6     
gb:BX294144_768725 Pirellula sp. strain 1 complete genome; segme...    34   3.6     
pir|T21042|T21042 hypothetical protein F17A2.3 - Caenorhabditis ...    34   3.6     
pir|T00859|T00859 hypothetical protein At2g02690 [imported] - Ar...    34   3.6     
pir|H84783|H84783 probable PHD-type zinc finger protein [importe...    34   3.6     
pir|B49515|B49515 phosphoprotein 75 - human                            34   3.6     
sp|Q9HB58|SP11_HUMAN|SP11_HUMAN Sp110 nuclear body protein (Speckled 110 kD...    34   3.6     
gb:BC085553_2564455 Danio rerio chromobox homolog 2 (Drosophila ...    33   4.7     
gb:BC085432_2564381 Danio rerio cDNA clone IMAGE:7229518, partia...    33   4.7     
gb:BC045443_2549280 Danio rerio zgc:55739, mRNA (cDNA clone MGC:...    33   4.7     
gb:AY598453_2539545 Danio rerio transcriptional intermediary fac...    33   4.7     
gb:AY398319_2531849 Danio rerio clone RK113A3D06 chromobox homol...    33   4.7     
gb:AY186581_2517829 Danio rerio polycomb 2 mRNA, complete cds.         33   4.7     
gb:AY179330_2517125 Danio rerio polycomb 3 mRNA, complete cds.         33   4.7     
gb:AY029300_2508638 Danio rerio polycomb mRNA, partial cds.            33   4.7     
gb:AB074154_2463269 Danio rerio pc1 gene, complete cds.                33   4.7     
gb:AB005619_2460381 Gallus gallus mRNA for chromobox protein (CH...    33   4.7     
gb:AY863219_2088703 Mus musculus duplin mRNA, complete cds.            33   4.7     
gb:AF169825_2057651 Rattus norvegicus beta-catenin binding prote...    33   4.7     
gb:S78570_2041761 MLL=trx zinc-finger domain homolog {alternativ...    33   4.7     
gb:S66432_2040831 MLL {translocation} [human, mRNA PartialMutant...    33   4.7     
gb:HUMTRXLP_2037918 Human trithorax-like protein (TRX1) mRNA, pa...    33   4.7     
gb:HUMMLL_2034848 Human mRNA for MLL.                                  33   4.7     
gb:HUMHRX_2032183 Human germline HRX mRNA, complete cds.               33   4.7     
gb:HSALL1X1_2010501 H.sapiens ALL-1 gene exon 1 (and joined codi...    33   4.7     


>pir|T52301|T52301 GYMNOS/PICKLE protein [imported] - Arabidopsis
           thaliana>gb:AF185577_1775125 Arabidopsis thaliana
           chromatin remodeling factor CHD3 (PKL) mRNA, complete
           cds.>gb:AF185578_1775126 Arabidopsis thaliana
           GYMNOS/PICKLE mRNA, complete cds.
          Length = 1384

 Score =  229 bits (585), Expect = 3e-59
 Identities = 109/179 (60%), Positives = 134/179 (74%)
 Frame = +1

Query: 262 MASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGD 441
           M+SLVERLR+RSDR+PVYNLDDSDD+  +   K   + E VE   R DAK ++CQACG  
Sbjct: 1   MSSLVERLRIRSDRKPVYNLDDSDDDDFVP--KKDRTFEQVEAIVRTDAKENACQACGES 58

Query: 442 ENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDA 621
            NL++C TCTYA+H KCL+ P++     +W+CPECVSPLN+I+KILDCE RPT + +  +
Sbjct: 59  TNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVSPLNEIDKILDCEMRPTKSSEQGS 118

Query: 622 SKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQMSSMTD 798
           S    K IFVKQYLVKWKG SYLH SWVPE EF KAY++  RLKT+VNNFHRQM S  +
Sbjct: 119 SDAEPKPIFVKQYLVKWKGLSYLHCSWVPEKEFQKAYKSNHRLKTRVNNFHRQMESFNN 177



>gb:AP005919_1860132 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0554A06.>gb:AP007226_1863319 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0036B04.
          Length = 1354

 Score =  203 bits (516), Expect = 3e-51
 Identities = 95/181 (52%), Positives = 133/181 (73%), Gaps = 5/181 (2%)
 Frame = +1

Query: 262 MASLVERLRVRSDRRPVYNLDDSDDEADIR----RGKSGPSQEPVERFDRPDAKVDSCQA 429
           M+SLVERLRVRS++RP+Y LD+SDD+   R    +G+   S  P ER +R DAK D+CQ 
Sbjct: 1   MSSLVERLRVRSEKRPLYTLDESDDDLPPRGGGGKGRDRHSDGPTERIEREDAKEDACQK 60

Query: 430 CGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCE-TRPTIA 606
           CG ++NL+ C TCTYA+H KCL+  +       W CPECVSPL ++EKILDCE T+P  +
Sbjct: 61  CGENDNLVPCSTCTYAFHRKCLVPRLNIT-SDKWSCPECVSPLTEMEKILDCEETKPDAS 119

Query: 607 DDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQMS 786
           +++ +S+ GSK+  VK+YL+KWKG S+LH +WV E+E+++  +  PRLKT++NNFH+QM 
Sbjct: 120 EETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESEYLETAKIYPRLKTRLNNFHKQMD 179

Query: 787 S 789
           S
Sbjct: 180 S 180



>pir|B84645|B84645 hypothetical protein At2g25170 [imported] -
           Arabidopsis thaliana
          Length = 1359

 Score =  198 bits (504), Expect = 9e-50
 Identities = 100/179 (55%), Positives = 125/179 (69%)
 Frame = +1

Query: 262 MASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGD 441
           M+SLVERLR+RSDR+PVYNLDDSDD+  +   K   + E VE   R DAK ++CQACG  
Sbjct: 1   MSSLVERLRIRSDRKPVYNLDDSDDDDFVP--KKDRTFEQVEAIVRTDAKENACQACGES 58

Query: 442 ENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDA 621
            NL++C TCTYA+H KCL+ P++     +W+CPECVSPLN+I+KILDCE RPT + +  +
Sbjct: 59  TNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVSPLNEIDKILDCEMRPTKSSEQGS 118

Query: 622 SKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQMSSMTD 798
           S    K IFVKQYLVK           VPE EF KAY++  RLKT+VNNFHRQM S  +
Sbjct: 119 SDAEPKPIFVKQYLVK-----------VPEKEFQKAYKSNHRLKTRVNNFHRQMESFNN 166



>gb:AY062187S2_1565003 Oryza sativa (indica cultivar-group)
           chromatin-remodeling factor CHD3 (PKL) gene, exon 27 and
           complete cds.
          Length = 1111

 Score =  194 bits (494), Expect = 1e-48
 Identities = 94/187 (50%), Positives = 132/187 (70%), Gaps = 11/187 (5%)
 Frame = +1

Query: 262 MASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGP--SQEPVERFDRPDAKV------- 414
           M+SLVERLRVRS++RP+Y LD+SDD+   RRG+ G   +Q    R DR   +V       
Sbjct: 1   MSSLVERLRVRSEKRPLYTLDESDDDLRARRGREGEGSAQRRPHRADRAGGRVIHLCVQK 60

Query: 415 -DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCE- 588
            D+CQ CG ++NL+ C TCTYA+H KCL+  +       W CPECVSPL ++EKILDCE 
Sbjct: 61  EDACQKCGENDNLVPCSTCTYAFHRKCLVPRLNIT-SDKWSCPECVSPLTEMEKILDCEE 119

Query: 589 TRPTIADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNN 768
           T+P  ++++ +S+ GSK+  VK+YL+KWKG S+LH +WV E+E+++  +  PRLKT++NN
Sbjct: 120 TKPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESEYLETAKIYPRLKTRLNN 179

Query: 769 FHRQMSS 789
           FH+QM S
Sbjct: 180 FHKQMDS 186



>gb:AY062186_1565002 Oryza sativa chromatin-remodeling factor CHD3
           (PKL) mRNA, complete cds.
          Length = 1360

 Score =  194 bits (494), Expect = 1e-48
 Identities = 94/187 (50%), Positives = 132/187 (70%), Gaps = 11/187 (5%)
 Frame = +1

Query: 262 MASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGP--SQEPVERFDRPDAKV------- 414
           M+SLVERLRVRS++RP+Y LD+SDD+   RRG+ G   +Q    R DR   +V       
Sbjct: 1   MSSLVERLRVRSEKRPLYTLDESDDDLRARRGREGEGSAQRRPHRADRAGGRVIHLCVQK 60

Query: 415 -DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCE- 588
            D+CQ CG ++NL+ C TCTYA+H KCL+  +       W CPECVSPL ++EKILDCE 
Sbjct: 61  EDACQKCGENDNLVPCSTCTYAFHRKCLVPRLNIT-SDKWSCPECVSPLTEMEKILDCEE 119

Query: 589 TRPTIADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNN 768
           T+P  ++++ +S+ GSK+  VK+YL+KWKG S+LH +WV E+E+++  +  PRLKT++NN
Sbjct: 120 TKPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESEYLETAKIYPRLKTRLNN 179

Query: 769 FHRQMSS 789
           FH+QM S
Sbjct: 180 FHKQMDS 186



>pir|T06312|T06312 hypothetical protein F11C18.100 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547111 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           76.>gb:ATF11C18_1548269 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11C18 (ESSA project).
          Length = 1067

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/71 (59%), Positives = 53/71 (74%), Gaps = 1/71 (1%)
 Frame = +1

Query: 553 PLNDIEKILDCETRPTIADDSDASKLGSKQ-IFVKQYLVKWKGFSYLHSSWVPENEFVKA 729
           PL +IEKILD E RPT +++ ++S  G+   + VKQYLVKWKG SYLH SWVPE EF KA
Sbjct: 43  PLGEIEKILDREWRPTASNNPNSSDNGTPTLVVVKQYLVKWKGLSYLHCSWVPEQEFEKA 102

Query: 730 YQTLPRLKTKV 762
           Y++ P LK K+
Sbjct: 103 YKSHPHLKLKL 113



>gb:AF119716_1242802 Drosophila melanogaster dMi-2 protein (dMi-2)
           mRNA, complete cds.
          Length = 1982

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 37/107 (34%), Positives = 49/107 (45%), Gaps = 4/107 (3%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP--LNDIEKI 576
           D   + C+ C     LL C++C  AYH  CL  P+       W+CP C  P      EKI
Sbjct: 434 DEHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKI 493

Query: 577 LDCETRPTIADDSDASKLGSK--QIFVKQYLVKWKGFSYLHSSWVPE 711
           +         DD  ++  GSK     V++Y +KW   SY H  WVPE
Sbjct: 494 ITWRWAQRSNDDGPSTSKGSKNSNSRVREYFIKWHNMSYWHCEWVPE 540



>sp|O97159|CHDM_DROME Chromodomain helicase-DNA-binding protein Mi-2
           homolog (dMi-2).>gb:AE014296_1137069 Drosophila
           melanogaster chromosome 3L, complete
           sequence.>gb:AE003515_1213620 Drosophila melanogaster
           chromosome 3L, section 70 of 83 of the complete
           sequence.
          Length = 1982

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 37/107 (34%), Positives = 49/107 (45%), Gaps = 4/107 (3%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP--LNDIEKI 576
           D   + C+ C     LL C++C  AYH  CL  P+       W+CP C  P      EKI
Sbjct: 434 DEHQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKI 493

Query: 577 LDCETRPTIADDSDASKLGSK--QIFVKQYLVKWKGFSYLHSSWVPE 711
           +         DD  ++  GSK     V++Y +KW   SY H  WVPE
Sbjct: 494 ITWRWAQRSNDDGPSTSKGSKNSNSRVREYFIKWHNMSYWHCEWVPE 540



>gb:AY071503_1295587 Drosophila melanogaster RE55932 full length
           cDNA.
          Length = 627

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 33/101 (32%), Positives = 50/101 (49%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPT 600
           C+ C    +LL C++C   YH  CL  P+++     W CP C+      EKIL       
Sbjct: 38  CKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAEKILSWRWALD 97

Query: 601 IADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFV 723
            + +   SK G K+   ++Y +KW G SY H  W+PE + +
Sbjct: 98  RSVELRTSK-GEKR---REYFIKWHGMSYWHCEWIPEGQML 134



>gb:AF007780_1231446 Drosophila melanogaster CHD3 mRNA, partial cds.
          Length = 1518

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 33/101 (32%), Positives = 50/101 (49%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPT 600
           C+ C    +LL C++C   YH  CL  P+++     W CP C+      EKIL       
Sbjct: 41  CKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAEKILSWRWALD 100

Query: 601 IADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFV 723
            + +   SK G K+   ++Y +KW G SY H  W+PE + +
Sbjct: 101 RSVELRTSK-GEKR---REYFIKWHGMSYWHCEWIPEGQML 137



>sp|O16102|CHD3_DROME Chromodomain helicase-DNA-binding protein
           3.>gb:AE014296_1136980 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003517_1213743
           Drosophila melanogaster chromosome 3L, section 68 of 83
           of the complete sequence.
          Length = 892

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 33/101 (32%), Positives = 50/101 (49%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPT 600
           C+ C    +LL C++C   YH  CL  P+++     W CP C+      EKIL       
Sbjct: 38  CKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAEKILSWRWALD 97

Query: 601 IADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPENEFV 723
            + +   SK G K+   ++Y +KW G SY H  W+PE + +
Sbjct: 98  RSVELRTSK-GEKR---REYFIKWHGMSYWHCEWIPEGQML 134



>gb:BC058578_2103332 Mus musculus chromodomain helicase DNA binding
           protein 4, mRNA (cDNA clone MGC:68269 IMAGE:6489649),
           complete cds.
          Length = 1915

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 43/142 (30%), Positives = 61/142 (42%), Gaps = 12/142 (8%)
 Frame = +1

Query: 322 DDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQ 501
           D+S+ E  +      P +E        D  ++ C+ C     LL C+TC  +YH  CL  
Sbjct: 419 DNSEGEEILEEVGGDPEEED-------DHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNP 471

Query: 502 PMRAPFPSSWKCPECVSPL--NDIEKILDCE----------TRPTIADDSDASKLGSKQI 645
           P+       W CP C  P     ++KIL  +           RP  AD +  S    +  
Sbjct: 472 PLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGR 531

Query: 646 FVKQYLVKWKGFSYLHSSWVPE 711
             +Q+ VKW+G SY H SWV E
Sbjct: 532 PERQFFVKWQGMSYWHCSWVSE 553



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 364 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 407



>gb:AK034549_1163794 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430004K15
           product:CHROMODOMAIN HELICASE-DNA-BINDING PROTEIN 4
           (CHD-4) (MI-2 AUTOANTIGEN 218 KDA PROTEIN) (MI2-BETA)
           homolog [Homo sapiens], full insert sequence.
          Length = 1045

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 43/142 (30%), Positives = 61/142 (42%), Gaps = 12/142 (8%)
 Frame = +1

Query: 322 DDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQ 501
           D+S+ E  +      P +E        D  ++ C+ C     LL C+TC  +YH  CL  
Sbjct: 171 DNSEGEEILEEVGGDPEEED-------DHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNP 223

Query: 502 PMRAPFPSSWKCPECVSPL--NDIEKILDCE----------TRPTIADDSDASKLGSKQI 645
           P+       W CP C  P     ++KIL  +           RP  AD +  S    +  
Sbjct: 224 PLPEIPNGEWLCPRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGR 283

Query: 646 FVKQYLVKWKGFSYLHSSWVPE 711
             +Q+ VKW+G SY H SWV E
Sbjct: 284 PERQFFVKWQGMSYWHCSWVSE 305



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 116 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 159



>gb:BC038596_1982373 Homo sapiens chromodomain helicase DNA binding
           protein 4, mRNA (cDNA clone MGC:46187 IMAGE:5528023),
           complete cds.
          Length = 1937

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 38/118 (32%), Positives = 53/118 (44%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+TC  +YH  CL  P+       W CP C  P     +
Sbjct: 440 EEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKV 499

Query: 568 EKILDCE----------TRPTIADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPE 711
           +KIL  +           RP  AD +  S    +    +Q+ VKW+G SY H SWV E
Sbjct: 500 QKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE 557



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 368 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 411



>gb:A56817_1449788 Sequence 1 from Patent WO9628547.
          Length = 1911

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 38/118 (32%), Positives = 53/118 (44%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+TC  +YH  CL  P+       W CP C  P     +
Sbjct: 442 EEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKV 501

Query: 568 EKILDCE----------TRPTIADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPE 711
           +KIL  +           RP  AD +  S    +    +Q+ VKW+G SY H SWV E
Sbjct: 502 QKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE 559



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 370 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 413



>sp|Q14839|CHD4_HUMAN Chromodomain helicase-DNA-binding protein 4
           (CHD-4) (Mi-2 autoantigen 218 kDa protein)
           (Mi2-beta).>gb:HSMI2218_2018798 H.sapiens mRNA for 218kD
           Mi-2 protein.
          Length = 1912

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 38/118 (32%), Positives = 53/118 (44%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+TC  +YH  CL  P+       W CP C  P     +
Sbjct: 443 EEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKV 502

Query: 568 EKILDCE----------TRPTIADDSDASKLGSKQIFVKQYLVKWKGFSYLHSSWVPE 711
           +KIL  +           RP  AD +  S    +    +Q+ VKW+G SY H SWV E
Sbjct: 503 QKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE 560



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 371 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 414



>gb:BC046866_2549766 Xenopus laevis chromodomain helicase DNA
           binding protein 4, mRNA (cDNA clone MGC:52739
           IMAGE:4683903), complete cds.
          Length = 1893

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 41/142 (28%), Positives = 60/142 (42%), Gaps = 12/142 (8%)
 Frame = +1

Query: 322 DDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQ 501
           D+S+ + D+      P +E        D  ++ C+ C     LL C+ C  +YH  CL  
Sbjct: 417 DNSELDDDLDDAVGDPEEE--------DHHMEFCRVCKDGGELLCCDVCPSSYHIHCLNP 468

Query: 502 PMRAPFPSSWKCPECVSP--LNDIEKILDCE----------TRPTIADDSDASKLGSKQI 645
           P+       W CP C  P     I+KIL  +          +RP  +D   A     +  
Sbjct: 469 PLPEIPNGEWLCPRCTCPPLKGKIQKILTWKWGQPPPPTPVSRPADSDPDAAPLKPLEGR 528

Query: 646 FVKQYLVKWKGFSYLHSSWVPE 711
             +++ VKW   SYLH SWV E
Sbjct: 529 PEREFFVKWHAMSYLHCSWVTE 550



 Score = 40.8 bits (94), Expect = 0.030
 Identities = 16/44 (36%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   M       W CP C
Sbjct: 362 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMDKAPEGKWSCPHC 405



>sp|Q22516|CHD3_CAEEL Chromodomain helicase-DNA-binding protein 3
           homolog (CHD-3).>pir|T20160|T20160 hypothetical protein
           T14G8.1 - Caenorhabditis elegans>gb:AF308444_1260974
           Caenorhabditis elegans CHD-3 (chd-3) mRNA, complete
           cds.>gb:CEC52G5_1361528 Caenorhabditis elegans cosmid
           C52G5, complete sequence.>gb:CET14G8_1367724
           Caenorhabditis elegans cosmid T14G8, complete sequence.
          Length = 1787

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 35/132 (26%), Positives = 55/132 (41%), Gaps = 17/132 (12%)
 Frame = +1

Query: 406 AKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV--SPLNDIEKIL 579
           A +D C+ C    N+L C+TC  +YH  C+  P+       W CP C+   P   IEKIL
Sbjct: 326 ANMDYCRICKETSNILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRCIIPEPAQRIEKIL 385

Query: 580 DCETR----PTIADDSDASKLGSKQIFVK-----------QYLVKWKGFSYLHSSWVPEN 714
               +    P   +  +  +     +F+K           ++ VKWK  +Y    W+ E 
Sbjct: 386 SWRWKEISYPEPLECKEGEEASKDDVFLKPPRKMEPRREREFFVKWKYLAYWQCEWLSET 445

Query: 715 EFVKAYQTLPRL 750
                +  L R+
Sbjct: 446 LMDVYFTALVRM 457



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           ++C+ C  D  L+ C+TCT AYH  C+ + M  P    W CP C
Sbjct: 266 ENCEVCNQDGELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHC 309



>pir|T34239|T34239 hypothetical protein F26F12.7 - Caenorhabditis
           elegans>gb:AF308445_1260975 Caenorhabditis elegans
           LET-418 (let-418) mRNA, complete cds.>gb:U55373_1405087
           Caenorhabditis elegans cosmid F26F12, complete sequence.
          Length = 1829

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 41/138 (29%), Positives = 61/138 (44%), Gaps = 16/138 (11%)
 Frame = +1

Query: 346 IRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPM-RAPFP 522
           I  G     +EP ++ D      + C+ C   ENLL C++C  ++H  C+  P+   P  
Sbjct: 301 IEHGPEVVKEEPAKQND------EFCKICKETENLLLCDSCVCSFHAYCIDPPLTEVPKE 354

Query: 523 SSWKCPEC--VSPLNDIEKILDCETRP-TIADDSDASKLGSKQIFV------------KQ 657
            +W CP C  V P + IEKIL    +     +  +A K  S    +            ++
Sbjct: 355 ETWSCPRCETVKPEHKIEKILCWRWKEIPYPEPLEAGKEASSDDAMLKPPRKMEPRRERE 414

Query: 658 YLVKWKGFSYLHSSWVPE 711
           + VKWK  SY   SWV E
Sbjct: 415 FFVKWKYLSYWQCSWVSE 432



 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 18/45 (40%), Positives = 23/45 (51%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           D C+ C  D  LL C+TC  AYH  C+ + M  P    W C  C+
Sbjct: 257 DYCEECKQDGELLLCDTCPRAYHTVCIDENMEEPPEGDWSCAHCI 301



>gb:AL596125_2070887 Mouse DNA sequence from clone RP23-5O23 on
           chromosome 11 Contains the Chd3 gene for chromodomain
           helicase DNA binding protein 3, five novel genes, the 3'
           end of the gene for a novel protein similar to dynein
           and four CpG islands, complete
           sequence.>gb:AL645527_2071684 Mouse DNA sequence from
           clone RP23-26L6 on chromosome 11 Contains the Vamp2 gene
           for vesicle-associated membrane 2, the Per1 gene for
           period homolog 1 (Drosophila), the Hes7 gene for hairy
           and enhancer of split 7 (Drosophila), the Aloxe3 gene
           for arachidonate lipoxygenase 3, the Alox12b gene for
           arachidonate 12-lipoxygenase 12R type, the Alox15b gene
           for arachidonate 15-lipoxygenase second type, the Gucy2e
           gene for guanylate cyclase 2e, a novel gene, the gene
           for LYST-interacting protein LIP8 (Lip8-pending), the
           gene for the likely ortholog of H. sapiens trafficking
           protein particle complex 1 (TRAPPC1)), the Kcnab3 gene
           for potassium voltage-gated channel shaker-related
           subfamily beta member 3, a novel gene, the 3' end of the
           Chd3 gene for chromodomain helicase DNA binding protein
           3 and six CpG islands, complete sequence.
          Length = 2055

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 12/139 (8%)
 Frame = +1

Query: 331 DDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMR 510
           ++E     G+ G  +E        D  ++ C+ C     LL C+ C  +YH  CL  P+ 
Sbjct: 488 EEEEYEEEGEEGEKEEE-------DDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLP 540

Query: 511 APFPSSWKCPECVSPL--NDIEKILDCE-TRPTIADDSDASKLGSKQI---------FVK 654
                 W CP C  P+    ++KIL      P +A  +     G+  +           +
Sbjct: 541 DIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSER 600

Query: 655 QYLVKWKGFSYLHSSWVPE 711
           ++ VKW G SY H SW  E
Sbjct: 601 EFFVKWVGLSYWHCSWAKE 619



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 433 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 476



>gb:AK045449_1167421 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230201M16 product:Mi-2 autoantigen 240 kDa
           protein (fragment) homolog [Homo sapiens], full insert
           sequence.
          Length = 708

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 12/139 (8%)
 Frame = +1

Query: 331 DDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMR 510
           ++E     G+ G  +E        D  ++ C+ C     LL C+ C  +YH  CL  P+ 
Sbjct: 447 EEEEYEEEGEEGEKEEE-------DDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLP 499

Query: 511 APFPSSWKCPECVSPL--NDIEKILDCE-TRPTIADDSDASKLGSKQI---------FVK 654
                 W CP C  P+    ++KIL      P +A  +     G+  +           +
Sbjct: 500 DIPNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSER 559

Query: 655 QYLVKWKGFSYLHSSWVPE 711
           ++ VKW G SY H SW  E
Sbjct: 560 EFFVKWVGLSYWHCSWAKE 578



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 392 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 435



>gb:HSU91543_2027525 Homo sapiens zinc-finger helicase (hZFH) mRNA,
           complete cds.
          Length = 2000

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P+    +
Sbjct: 450 EEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRV 509

Query: 568 EKILDCE-TRPTIADDSDASKLGSKQI---------FVKQYLVKWKGFSYLHSSWVPE 711
           +KIL      P +A  +     G+  +           +++ VKW G SY H SW  E
Sbjct: 510 QKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKE 567



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 380 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 423



>gb:HSU08379_2021900 Human Mi-2 autoantigen 240 kDa protein mRNA,
           partial cds.
          Length = 530

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P+    +
Sbjct: 326 EEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRV 385

Query: 568 EKILDCE-TRPTIADDSDASKLGSKQI---------FVKQYLVKWKGFSYLHSSWVPE 711
           +KIL      P +A  +     G+  +           +++ VKW G SY H SW  E
Sbjct: 386 QKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKE 443



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 256 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 299



>pir|I38558|I38558 Mi-2 autoantigen 240 kDa protein - human
           (fragment)
          Length = 530

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P+    +
Sbjct: 326 EEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRV 385

Query: 568 EKILDCE-TRPTIADDSDASKLGSKQI---------FVKQYLVKWKGFSYLHSSWVPE 711
           +KIL      P +A  +     G+  +           +++ VKW G SY H SW  E
Sbjct: 386 QKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKE 443



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 256 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 299



>sp|Q12873|CHD3_HUMAN Chromodomain helicase-DNA-binding protein 3
           (CHD-3) (Mi-2 autoantigen 240 kDa protein)
           (Mi2-alpha).>gb:AF006515_1876020 Homo sapiens CHD3 mRNA,
           complete cds.
          Length = 1944

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 12/118 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL--NDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P+    +
Sbjct: 450 EEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRV 509

Query: 568 EKILDCE-TRPTIADDSDASKLGSKQI---------FVKQYLVKWKGFSYLHSSWVPE 711
           +KIL      P +A  +     G+  +           +++ VKW G SY H SW  E
Sbjct: 510 QKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKE 567



 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 380 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 423



>gb:HS120G22_1997029 Human DNA sequence from clone RP1-120G22 on
           chromosome 1p36.21-36.33 Contains the 5' end of the CHD5
           gene for chromodomain helicase DNA binding protein 5,
           the RPL22 gene for ribosomal protein L22, eight novel
           genes, the ICMT gene for isoprenylcysteine carboxyl
           methyltransferase, possible ortholog of rodent
           transcription factor HES-3, the 3' end of the gene for
           brain acyl-CoA hydrolase (BACH) and seven CpG islands,
           complete sequence.>gb:HS233K16_1997697 Human DNA
           sequence from clone RP1-233K16 on chromosome
           1p36.21-36.33 Contains the 5' end of the NPHP4 gene for
           nephronophthisis 4, the KCNAB2 gene for potassium
           voltage-gated channel, shaker-related subfamily, beta
           member 2, the 3' end of the CHD5 gene for chromodomain
           helicase DNA binding protein 5 and a CpG island,
           complete sequence.
          Length = 1225

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 13/129 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP--LNDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P     +
Sbjct: 410 EEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKV 469

Query: 568 EKILDCE-TRPTI-------ADDSDASKLGSKQ---IFVKQYLVKWKGFSYLHSSWVPEN 714
           ++IL    T P           D + S    K    I  +++ VKW G SY H SWV E 
Sbjct: 470 QRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKEL 529

Query: 715 EFVKAYQTL 741
           + ++ Y T+
Sbjct: 530 Q-LELYHTV 537



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 4/74 (5%)
 Frame = +1

Query: 337 EADIRRGKSGPSQEPVERFDRPDA----KVDSCQACGGDENLLNCETCTYAYHPKCLLQP 504
           E     GK    +   +R D  D       D C+ C     ++ C+TC  AYH  CL   
Sbjct: 314 ECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPE 373

Query: 505 MRAPFPSSWKCPEC 546
           +       W CP C
Sbjct: 374 LEKAPEGKWSCPHC 387



>gb:AK127046_1916570 Homo sapiens cDNA FLJ45103 fis, clone
           BRAWH3032571, moderately similar to Chromodomain
           helicase-DNA-binding protein 4.
          Length = 1225

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 13/129 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP--LNDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P     +
Sbjct: 410 EEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKV 469

Query: 568 EKILDCE-TRPTI-------ADDSDASKLGSKQ---IFVKQYLVKWKGFSYLHSSWVPEN 714
           ++IL    T P           D + S    K    I  +++ VKW G SY H SWV E 
Sbjct: 470 QRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKEL 529

Query: 715 EFVKAYQTL 741
           + ++ Y T+
Sbjct: 530 Q-LELYHTV 537



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 4/74 (5%)
 Frame = +1

Query: 337 EADIRRGKSGPSQEPVERFDRPDA----KVDSCQACGGDENLLNCETCTYAYHPKCLLQP 504
           E     GK    +   +R D  D       D C+ C     ++ C+TC  AYH  CL   
Sbjct: 314 ECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPE 373

Query: 505 MRAPFPSSWKCPEC 546
           +       W CP C
Sbjct: 374 LEKAPEGKWSCPHC 387



>gb:AF425231_1901805 Homo sapiens chromodomain helicase DNA binding
           protein 5 (CHD5) mRNA, complete cds.>gb:HS120G22_1997030
           Human DNA sequence from clone RP1-120G22 on chromosome
           1p36.21-36.33 Contains the 5' end of the CHD5 gene for
           chromodomain helicase DNA binding protein 5, the RPL22
           gene for ribosomal protein L22, eight novel genes, the
           ICMT gene for isoprenylcysteine carboxyl
           methyltransferase, possible ortholog of rodent
           transcription factor HES-3, the 3' end of the gene for
           brain acyl-CoA hydrolase (BACH) and seven CpG islands,
           complete sequence.>gb:HS233K16_1997696 Human DNA
           sequence from clone RP1-233K16 on chromosome
           1p36.21-36.33 Contains the 5' end of the NPHP4 gene for
           nephronophthisis 4, the KCNAB2 gene for potassium
           voltage-gated channel, shaker-related subfamily, beta
           member 2, the 3' end of the CHD5 gene for chromodomain
           helicase DNA binding protein 5 and a CpG island,
           complete sequence.
          Length = 1954

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 13/129 (10%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP--LNDI 567
           +  D  ++ C+ C     LL C+ C  +YH  CL  P+       W CP C  P     +
Sbjct: 410 EEEDDHMEFCRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKV 469

Query: 568 EKILDCE-TRPTI-------ADDSDASKLGSKQ---IFVKQYLVKWKGFSYLHSSWVPEN 714
           ++IL    T P           D + S    K    I  +++ VKW G SY H SWV E 
Sbjct: 470 QRILHWRWTEPPAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKEL 529

Query: 715 EFVKAYQTL 741
           + ++ Y T+
Sbjct: 530 Q-LELYHTV 537



 Score = 41.6 bits (96), Expect = 0.017
 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 4/74 (5%)
 Frame = +1

Query: 337 EADIRRGKSGPSQEPVERFDRPDA----KVDSCQACGGDENLLNCETCTYAYHPKCLLQP 504
           E     GK    +   +R D  D       D C+ C     ++ C+TC  AYH  CL   
Sbjct: 314 ECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPE 373

Query: 505 MRAPFPSSWKCPEC 546
           +       W CP C
Sbjct: 374 LEKAPEGKWSCPHC 387



>gb:AP005452_1852036 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0453E03.
          Length = 1696

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 25/65 (38%), Positives = 32/65 (49%)
 Frame = +1

Query: 370 SQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           S+ P +  D  D   D C  CG D NLL C+ C  A+H KC+          +W CPEC+
Sbjct: 429 SRAPEDSSDTEDGNSDECYLCGMDGNLLCCDGCPAAFHSKCVGVVEDLLPEGNWFCPECL 488

Query: 550 SPLND 564
              ND
Sbjct: 489 IQKND 493



>gb:BC022167_2093774 Mus musculus ubiquitin-like, containing PHD and
           RING finger domains, 1, mRNA (cDNA clone MGC:13771
           IMAGE:4017286), complete cds.
          Length = 782

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 8/123 (6%)
 Frame = +1

Query: 283 LRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGG---DENLL 453
           + +  +RRP+         A    GKSGPS    +  +    +  +C  CGG    E  L
Sbjct: 277 IELPKERRPLIASPSQPPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQL 336

Query: 454 NCETCTYAYHPKCLLQPMRA-PFPSSWKCPECVSPLNDI----EKILDCETRPTIADDSD 618
            C+ C  A+H  CL  P+ + P    W CP C +  +++    EK+ + + +  +A  + 
Sbjct: 337 LCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATS 396

Query: 619 ASK 627
           +S+
Sbjct: 397 SSR 399



>gb:AF274046_2061190 Mus musculus nuclear zinc finger protein Np95
           (Uhrf1) mRNA, complete cds.>gb:D87908_2112599 Mus
           musculus mRNA for nuclear protein np95, complete cds.
          Length = 782

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 8/123 (6%)
 Frame = +1

Query: 283 LRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGG---DENLL 453
           + +  +RRP+         A    GKSGPS    +  +    +  +C  CGG    E  L
Sbjct: 277 IELPKERRPLIASPSQPPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQL 336

Query: 454 NCETCTYAYHPKCLLQPMRA-PFPSSWKCPECVSPLNDI----EKILDCETRPTIADDSD 618
            C+ C  A+H  CL  P+ + P    W CP C +  +++    EK+ + + +  +A  + 
Sbjct: 337 LCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATS 396

Query: 619 ASK 627
           +S+
Sbjct: 397 SSR 399



>gb:AB066245_2047129 Mus musculus gene for Np95, partial cds.
          Length = 474

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 32/123 (26%), Positives = 56/123 (45%), Gaps = 8/123 (6%)
 Frame = +1

Query: 283 LRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGG---DENLL 453
           + +  +RRP+         A    GKSGPS    +  +    +  +C  CGG    E  L
Sbjct: 277 IELPKERRPLIASPSQPPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQL 336

Query: 454 NCETCTYAYHPKCLLQPMRA-PFPSSWKCPECVSPLNDI----EKILDCETRPTIADDSD 618
            C+ C  A+H  CL  P+ + P    W CP C +  +++    EK+ + + +  +A  + 
Sbjct: 337 LCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATS 396

Query: 619 ASK 627
           +S+
Sbjct: 397 SSR 399



>gb:AE017347_1757652 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 940

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = +1

Query: 418 SCQAC---GGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP 555
           +C+ C   G D  L+ C+TC   +H  CL  P+  P   SW CP+C+SP
Sbjct: 79  TCEQCAIKGDDSRLMFCDTCDRGWHSYCLNPPLAKPPKGSWHCPKCLSP 127



>gb:BC019181_2092834 Mus musculus BRAF35/HDAC2 complex, mRNA (cDNA
           clone MGC:29190 IMAGE:5008954), complete cds.
          Length = 556

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 28/96 (29%), Positives = 40/96 (41%)
 Frame = +1

Query: 385 ERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           E + + D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +  
Sbjct: 356 EHWPKGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQMLK 415

Query: 565 IEKILDCETRPTIADDSDASKLGSKQIFVKQYLVKW 672
            E+ +       I     A K   ++   KQ L+KW
Sbjct: 416 KEEAIPWPGTLAIVHSYIAYKAAKEE--EKQKLLKW 449



>gb:AB105178_2048364 Mus musculus PFTF1 mRNA, complete cds.
          Length = 556

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 28/96 (29%), Positives = 40/96 (41%)
 Frame = +1

Query: 385 ERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           E + + D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +  
Sbjct: 356 EHWPKGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQMLK 415

Query: 565 IEKILDCETRPTIADDSDASKLGSKQIFVKQYLVKW 672
            E+ +       I     A K   ++   KQ L+KW
Sbjct: 416 KEEAIPWPGTLAIVHSYIAYKAAKEE--EKQKLLKW 449



>gb:AB051483_1867995 Homo sapiens mRNA for KIAA1696 protein, partial
           cds.
          Length = 635

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 28/96 (29%), Positives = 40/96 (41%)
 Frame = +1

Query: 385 ERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           E + + D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +  
Sbjct: 434 EHWPKGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLK 493

Query: 565 IEKILDCETRPTIADDSDASKLGSKQIFVKQYLVKW 672
            E+ +       I     A K   ++   KQ L+KW
Sbjct: 494 KEEAIPWPGTLAIVHSYIAYKAAKEE--EKQKLLKW 527



>gb:AX880319_1478225 Sequence 15224 from Patent
           EP1074617.>gb:AK023258_1909559 Homo sapiens cDNA
           FLJ13196 fis, clone NT2RP3004428, weakly similar to
           CHROMODOMAIN HELICASE-DNA-BINDING PROTEIN
           4.>gb:AY090777_1936194 Homo sapiens BRAF35/HDAC2 complex
           80 kDa protein (BHC80) mRNA, complete cds.
          Length = 634

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 28/96 (29%), Positives = 40/96 (41%)
 Frame = +1

Query: 385 ERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           E + + D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +  
Sbjct: 433 EHWPKGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLK 492

Query: 565 IEKILDCETRPTIADDSDASKLGSKQIFVKQYLVKW 672
            E+ +       I     A K   ++   KQ L+KW
Sbjct: 493 KEEAIPWPGTLAIVHSYIAYKAAKEE--EKQKLLKW 526



>gb:AF208848_1150553 Homo sapiens BM-006 mRNA, complete cds.
          Length = 328

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 28/96 (29%), Positives = 40/96 (41%)
 Frame = +1

Query: 385 ERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           E + + D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +  
Sbjct: 135 EHWPKGDIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLK 194

Query: 565 IEKILDCETRPTIADDSDASKLGSKQIFVKQYLVKW 672
            E+ +       I     A K   ++   KQ L+KW
Sbjct: 195 KEEAIPWPGTLAIVHSYIAYKAAKEE--EKQKLLKW 228



>sp|O14686|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
           protein 2 (ALL1-related protein).>pir|T03454|T03454 ALR
           protein - human>gb:AF010403_1876229 Homo sapiens ALR
           mRNA, complete cds.
          Length = 5262

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 25/52 (48%), Positives = 27/52 (51%), Gaps = 3/52 (5%)
 Frame = +1

Query: 400 PDAKVDSCQAC---GGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  CQAC   G D  +L CETC   YH  CL  PM      SWKC  C
Sbjct: 271 PECKV--CQACRKPGNDSKMLVCETCDKGYHTFCLKPPMEELPAHSWKCKAC 320



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 15/127 (11%)
 Frame = +1

Query: 253  LKEMASLVERLRVRS-DRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKV---DS 420
            LK  AS +E L V   D  P    ++ DD+           Q  V  F   D  V   D 
Sbjct: 1054 LKSTASSIETLVVADIDSSPSKEEEEEDDDT---------MQNTVVLFSNTDKFVLMQDM 1104

Query: 421  CQACGG-----DENLLNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECV-----SPLNDI 567
            C  CG      + +LL C  C+  YHP C+   + +      W+C EC+        +D 
Sbjct: 1105 CVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDP 1164

Query: 568  EKILDCE 588
             ++L C+
Sbjct: 1165 SRLLLCD 1171



 Score = 41.2 bits (95), Expect = 0.023
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 6/69 (8%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV------SPLND 564
           +A+   C+  G   +L  C +C + YH  CL   + A   + W+CPEC        P ND
Sbjct: 226 EARCAVCEGPGELCDLFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGND 285

Query: 565 IEKILDCET 591
             K+L CET
Sbjct: 286 -SKMLVCET 293



 Score = 39.7 bits (91), Expect = 0.066
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421  CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
            C+ CG       LL C+ C  +YH  CL  P+       WKC  CVS
Sbjct: 1155 CEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVS 1201



>gb:AK129424_2069655 Mus musculus mRNA for mKIAA1696 protein.
          Length = 660

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 37/90 (41%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +   E+ + 
Sbjct: 466 DIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQMLKKEEAIP 525

Query: 583 CETRPTIADDSDASKLGSKQIFVKQYLVKW 672
                 I     A K   ++   KQ L+KW
Sbjct: 526 WPGTLAIVHSYIAYKAAKEE--EKQKLLKW 553



>gb:AK037174_1164780 Mus musculus 6 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:A030005M07
           product:hypothetical protein, full insert sequence.
          Length = 604

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 37/90 (41%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +   E+ + 
Sbjct: 410 DIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQMLKKEEAIP 469

Query: 583 CETRPTIADDSDASKLGSKQIFVKQYLVKW 672
                 I     A K   ++   KQ L+KW
Sbjct: 470 WPGTLAIVHSYIAYKAAKEE--EKQKLLKW 497



>gb:BC083281_2563158 Danio rerio zgc:101789, mRNA (cDNA clone
           MGC:101789 IMAGE:7230912), complete cds.
          Length = 400

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 3/64 (4%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCET 591
           C  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C++ L +   I   + 
Sbjct: 337 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPMSVPPEGSWSCHLCLALLKEKASIFQKQN 396

Query: 592 RPTI 603
            P +
Sbjct: 397 APPL 400



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 28/90 (31%), Positives = 34/90 (37%), Gaps = 16/90 (17%)
 Frame = +1

Query: 325 DSDDEADIRRGKSGPSQEPVERFDRPDAKV---DSCQACGGD----------ENLLNCET 465
           +  DE DIR        EP      PD      + C  C GD          E L++C  
Sbjct: 245 EEKDEMDIREPTPPRQDEPKTPRKGPDGLALPNNYCDFCLGDSSLNQKTGQSEELVSCSD 304

Query: 466 CTYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
           C  + HP CL   P  M A     W+C EC
Sbjct: 305 CGRSGHPSCLQFTPIMMAAVKTYRWQCIEC 334



>gb:BC015714_1975261 Homo sapiens PHD finger protein 21A, mRNA (cDNA
           clone MGC:16851 IMAGE:3908900), complete cds.
          Length = 680

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 37/90 (41%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +   E+ + 
Sbjct: 485 DIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIP 544

Query: 583 CETRPTIADDSDASKLGSKQIFVKQYLVKW 672
                 I     A K   ++   KQ L+KW
Sbjct: 545 WPGTLAIVHSYIAYKAAKEE--EKQKLLKW 572



>gb:HSM808384_1187991 Homo sapiens mRNA; cDNA DKFZp686D02108 (from
           clone DKFZp686D02108).
          Length = 560

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 27/90 (30%), Positives = 37/90 (41%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           D   D C  C     LL C+TC+  YH  CL  P++      W CP C   +   E+ + 
Sbjct: 365 DIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQMLKKEEAIP 424

Query: 583 CETRPTIADDSDASKLGSKQIFVKQYLVKW 672
                 I     A K   ++   KQ L+KW
Sbjct: 425 WPGTLAIVHSYIAYKAAKEE--EKQKLLKW 452



>gb:AF274048_1894211 Homo sapiens nuclear zinc finger protein Np95
           (UHRF1) mRNA, complete cds.>gb:AY787925_1964836 Homo
           sapiens ubiquitin-like, containing PHD and RING finger
           domains, 1 (UHRF1) gene, complete cds.
          Length = 793

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 8/100 (8%)
 Frame = +1

Query: 352 RGKSGPSQEPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRA-PF 519
           R KSGPS +  +       +V +C  CGG ++    L C+ C  A+H  CL  P+ + P 
Sbjct: 295 RRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPS 354

Query: 520 PSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
              W CPEC +  +++    E++ + + +  +A  + +S+
Sbjct: 355 EDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQ 394



>gb:AB006699_1509893 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDJ22.
          Length = 1516

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           DA  D C+ CG D  LL C+ C  AYH +C+ +  M  P    W CPEC
Sbjct: 410 DANSDECRLCGMDGTLLCCDGCPLAYHSRCIGVVKMYIP-DGPWYCPEC 457



>gb:AF108133_2054740 Mus musculus neuro-d4 gene, exons 3 through 12
           and partial cds.
          Length = 323

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 24/65 (36%), Positives = 29/65 (44%), Gaps = 3/65 (4%)
 Frame = +1

Query: 379 PVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           PV  +     +  SC  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C+
Sbjct: 250 PVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCL 309

Query: 550 SPLND 564
             L +
Sbjct: 310 RHLKE 314



>gb:BC058055_2552244 Danio rerio ubiquitin-like, containing PHD and
           RING finger domains, 1, mRNA (cDNA clone MGC:63539
           IMAGE:3815965), complete cds.
          Length = 775

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 20/118 (16%)
 Frame = +1

Query: 334 DEADIRRGKSGPSQEPVERFDRPDAKVD-----------SCQACG----GDENLLNCETC 468
           +E     G    S  P++R + P+ KV            +C  CG     D+ LL C+ C
Sbjct: 275 EEPGSAEGPGASSDSPLKRSNGPECKVCKDDPKKNCRVCNCHVCGIKQDPDKQLL-CDEC 333

Query: 469 TYAYHPKCLLQPMRA-PFPSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
             A+H  CL  P+   P    W CP+C +  +++    EK+ + + +  +A  S +S+
Sbjct: 334 DMAFHTYCLNPPLTTIPDDEDWYCPDCRNDASEVVLAGEKLKESKKKAKMASASSSSQ 391



>gb:AY391455_2531591 Danio rerio requiem, apoptosis response zinc
           finger gene (REQ) mRNA, complete cds.
          Length = 368

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 22/51 (43%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C++ L D
Sbjct: 305 CNVCGTSENDDQLLFCDDCDRGYHMYCLSPPMSDPPEGSWSCHLCLALLKD 355



 Score = 33.1 bits (74), Expect = 6.2
 Identities = 24/91 (26%), Positives = 35/91 (38%), Gaps = 16/91 (17%)
 Frame = +1

Query: 322 DDSDDEADIRRGKSGPSQEPVERFDRPDAKV---DSCQACGGD----------ENLLNCE 462
           ++ +D+ +       P +EP      P+      D C  C GD          E L++C 
Sbjct: 212 EEGEDKEEPEIHTPAPPEEPKTPKKGPNGLALPNDYCDFCLGDSSMNQKTGQSEELVSCS 271

Query: 463 TCTYAYHPKCL---LQPMRAPFPSSWKCPEC 546
            C  + HP CL      M A     W+C EC
Sbjct: 272 DCGRSGHPSCLQFTAVMMAAVKTYRWQCIEC 302



>gb:AB021737_2460986 Xenopus laevis mRNA for Requiem protein,
           complete cds, clone:req030.
          Length = 386

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +1

Query: 421 CQACGGDEN-LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN LL C+ C   YH  CL+ P+  P   SW C  C+  L D
Sbjct: 329 CNICGTSENDLLFCDDCDRGYHMYCLVPPVAEPPEGSWSCHLCLDLLKD 377



>gb:AX063416_1458760 Sequence 1 from Patent
           WO0078949.>gb:AF129507_1885332 Homo sapiens
           transcription factor ICBP90 (ICBP90) mRNA, complete cds.
          Length = 793

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = +1

Query: 352 RGKSGPSQEPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRA-PF 519
           R KSGPS +  +       +V +C  CGG ++    L C+ C  A+H  CL  P+ + P 
Sbjct: 295 RRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPS 354

Query: 520 PSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
              W CPEC +  +++    E++ + +    +A  + +S+
Sbjct: 355 EDEWYCPECRNDASEVVLAGERLRESKKNAKMASATSSSQ 394



>gb:AY648713_2541541 Danio rerio NP95 mRNA, complete cds.
          Length = 776

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 26/109 (23%), Positives = 54/109 (49%), Gaps = 9/109 (8%)
 Frame = +1

Query: 328 SDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACG----GDENLLNCETCTYAYHPKCL 495
           +  ++ ++   +GP  +  +   + + +V +C  CG     D+ LL C+ C  A+H  CL
Sbjct: 285 ASSDSPLKSQSNGPECKVCKDDPKKNCRVCNCHVCGIKQDPDKQLL-CDECDMAFHTYCL 343

Query: 496 LQPMRA-PFPSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
             P+   P    W CP+C +  +++    EK+ + + +  +A  S +S+
Sbjct: 344 NPPLTTIPDDEDWYCPDCRNDASEVVLAGEKLKESKKKAKMASASSSSQ 392



>gb:BC052348_2101041 Mus musculus neuronal d4 domain family member,
           mRNA (cDNA clone MGC:58257 IMAGE:6587002), complete
           cds.>gb:MMU48238_2121614 Mus musculus clone m62 zinc
           finger protein neuro-d4 (neuro-d4) mRNA, complete cds.
          Length = 388

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +1

Query: 418 SCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           SC  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C+  L +
Sbjct: 328 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKE 379



>gb:BC021191_1977406 Homo sapiens D4, zinc and double PHD fingers
           family 1, mRNA (cDNA clone IMAGE:3162448), partial cds.
          Length = 414

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +1

Query: 418 SCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           SC  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C+  L +
Sbjct: 354 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKE 405



>gb:AP003227_1825671 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0018C10.
          Length = 1150

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 2/89 (2%)
 Frame = +1

Query: 448 LLNCE--TCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDA 621
           L+ C+  TC+ ++H  CL  P++     +W+C  C S      K+ +  T   I      
Sbjct: 316 LIKCKNSTCSRSFHTFCLDPPLQEII-GTWECSWCKSNAAPAVKVTEVLTSKKIQRLVGH 374

Query: 622 SKLGSKQIFVKQYLVKWKGFSYLHSSWVP 708
            ++  +  F  Q+LVKW+  S+ H  WVP
Sbjct: 375 RRILQEADFQYQFLVKWQSLSHHHDCWVP 403



>gb:TAE577391_1724498 Triticum aestivum partial mRNA for
           hypothetical protein.
          Length = 134

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 19/49 (38%), Positives = 26/49 (53%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           D+  D C+ CG D  L+ C+ C +AYH +C+           W CPECV
Sbjct: 23  DSNSDDCRICGMDGTLVCCDGCPWAYHSRCIGLNKAFLPQGLWFCPECV 71



>gb:AX528700_1469909 Sequence 33 from Patent WO0246443.
          Length = 165

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 17/42 (40%), Positives = 24/42 (57%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C    NLL C++C   YH +CL  P++   P +W+CP C
Sbjct: 106 CVECDLGGNLLCCDSCPRTYHLECLNPPLKRAPPGNWQCPRC 147



>sp|Q9QX66|DPF1_MOUSE Zinc-finger protein neuro-d4 (D4, zinc and
           double PHD fingers family 1).
          Length = 387

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +1

Query: 418 SCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           SC  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C+  L +
Sbjct: 327 SCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHLKE 378



>sp|Q9W638|REQ1_XENLA Zinc-finger protein ubi-d4 1 (Requiem) (xReq)
           (Apoptosis response zinc finger
           protein).>gb:AB021741_2460990 Xenopus laevis mRNA for
           Requiem protein, complete cds, clone:req206.
          Length = 388

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL+ P+  P   SW C  C+  L D
Sbjct: 329 CNICGTSENDDQLLFCDDCDRGYHMYCLVPPVAEPPEGSWSCHLCLDLLKD 379



>gb:AB040975_1866904 Homo sapiens mRNA for KIAA1542 protein, partial
           cds.
          Length = 1654

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 5/64 (7%)
 Frame = +1

Query: 379 PVERFDRPDAKVDS--CQACGG---DENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPE 543
           PVE     + + D   C+ CG    ++ LL C+ C   YH +CL  P++      W CPE
Sbjct: 175 PVENTKASEEEEDPTFCEVCGRSDREDRLLLCDGCDAGYHMECLDPPLQEVPVDEWFCPE 234

Query: 544 CVSP 555
           C +P
Sbjct: 235 CAAP 238



>gb:AP002031_1821474 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3D20.
          Length = 1515

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           D   D C+ CG D  LL C+ C  AYH +C+ +  M  P    W CPEC
Sbjct: 408 DGNSDECRICGMDGTLLCCDGCPLAYHSRCIGVVKMYIP-DGPWFCPEC 455



>gb:AY321334_1177780 Rattus norvegicus Ac2-121 mRNA, complete cds.
          Length = 829

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 8/100 (8%)
 Frame = +1

Query: 352 RGKSGPSQEPVERFDRPDAKVDSCQACGG---DENLLNCETCTYAYHPKCLLQPMR-APF 519
           R KSGPS +  +  +    +  +C  CGG    E  + C+ C  A+H  CL  P+   P 
Sbjct: 347 RRKSGPSCQYCKDDENKPCRKCACHICGGREAPEKQVLCDECDMAFHLYCLQPPLTCVPP 406

Query: 520 PSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
              W CP C +  +++    EK+   + +  +A  + +S+
Sbjct: 407 EPEWYCPSCRTDSSEVVQAGEKLKKSKKKAKMASATSSSR 446



>gb:AF056116_2471084 Fugu rubripes serine/threonine kinase receptor
            type1, All-1 related protein (ALR), fugu hedgehog (fhh),
            Ikaros-like, wnt1, wnt10b, ARF3, erbB3, PAS1, and L41
            ribosomal protein genes, complete cds; LRP1 gene, partial
            cds; and unknown genes.
          Length = 4823

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 37/138 (26%), Positives = 53/138 (38%), Gaps = 14/138 (10%)
 Frame = +1

Query: 253  LKEMASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKV---DSC 423
            LK MAS ++ L + SD       ++ +D+           Q  V  F   D  V   D C
Sbjct: 639  LKAMASCIDALSMASDTGVTKEEEEEEDDT---------MQNTVVLFSNTDKFVLLQDMC 689

Query: 424  QACGG-----DENLLNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECV-----SPLNDIE 570
              CG      +  LL C  C   YHP C+   + +      W+C EC+        +D  
Sbjct: 690  VVCGSFGKGSEGQLLACAQCAQCYHPYCVNSKITKTKLRKGWRCLECIVCEMCGKASDPS 749

Query: 571  KILDCETRPTIADDSDAS 624
            ++L C       DD D S
Sbjct: 750  RLLLC-------DDCDVS 760



 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 5/61 (8%)
 Frame = +1

Query: 379 PVER--FDRPDAKVDSCQAC---GGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPE 543
           P++R  +  P+ KV  CQ C   G D  +L C+ C   YH  CL   M +     WKC  
Sbjct: 248 PIQRAGWQCPECKV--CQTCRKPGEDSKMLVCDACDKGYHTFCLQPAMDSLPTDPWKCKR 305

Query: 544 C 546
           C
Sbjct: 306 C 306



 Score = 37.7 bits (86), Expect = 0.25
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ CG       LL C+ C  +YH  CL  P+       WKC  CV
Sbjct: 739 CEMCGKASDPSRLLLCDDCDVSYHTYCLDPPLHNVPKGGWKCKWCV 784



 Score = 33.9 bits (76), Expect = 3.6
 Identities = 15/42 (35%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C + G   +LL C  C   YH  CL         + W+CPEC
Sbjct: 218 CDSAGELSDLLFCTGCGQHYHAACLEIGATPIQRAGWQCPEC 259



>gb:BC067021_2105913 Mus musculus RIKEN cDNA A730032D07 gene, mRNA
           (cDNA clone IMAGE:6847295), partial cds.
          Length = 505

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C AC    +L  C TC+ AYH  CL  P++ P    W CP+C
Sbjct: 328 CAACKRGASLQPCGTCSGAYHLSCLDPPLKTPPKGLWVCPKC 369



>gb:HSM801308_2017283 Homo sapiens mRNA; cDNA DKFZp434N0335 (from
           clone DKFZp434N0335); partial cds.
          Length = 1350

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 20/85 (23%)
 Frame = +1

Query: 358 KSGPSQEPVERFD--------RPDAKVDS---------CQACGG---DENLLNCETCTYA 477
           KS   QEP+ER D        +P ++            C  CG    ++ LL C+ C  +
Sbjct: 80  KSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDS 139

Query: 478 YHPKCLLQPMRAPFPSSWKCPECVS 552
           YH  CL+ P+       W+CP+C++
Sbjct: 140 YHTFCLIPPLHDVPKGDWRCPKCLA 164



 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            D K+  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 981  DIKICLCQKAPAAP-MIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKIL 1039



>gb:HSA243706_2001055 Homo sapiens mRNA for RB-binding protein
           (rbbp2h1a gene).
          Length = 1681

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 20/85 (23%)
 Frame = +1

Query: 358 KSGPSQEPVERFD--------RPDAKVDS---------CQACGG---DENLLNCETCTYA 477
           KS   QEP+ER D        +P ++            C  CG    ++ LL C+ C  +
Sbjct: 411 KSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDS 470

Query: 478 YHPKCLLQPMRAPFPSSWKCPECVS 552
           YH  CL+ P+       W+CP+C++
Sbjct: 471 YHTFCLIPPLHDVPKGDWRCPKCLA 495



 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            D K+  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1312 DIKICLCQKAPAAP-MIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKIL 1370



>gb:HSA132440_2000289 Homo sapiens mRNA for PLU-1 protein.
          Length = 1544

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 20/85 (23%)
 Frame = +1

Query: 358 KSGPSQEPVERFD--------RPDAKVDS---------CQACGG---DENLLNCETCTYA 477
           KS   QEP+ER D        +P ++            C  CG    ++ LL C+ C  +
Sbjct: 274 KSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDS 333

Query: 478 YHPKCLLQPMRAPFPSSWKCPECVS 552
           YH  CL+ P+       W+CP+C++
Sbjct: 334 YHTFCLIPPLHDVPKGDWRCPKCLA 358



 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            D K+  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1175 DIKICLCQKAPAAP-MIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKIL 1233



>gb:AF087481_1881845 Homo sapiens retinoblastoma binding protein 2
           homolog 1 (RBBP2H1) mRNA, complete cds.
          Length = 1580

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 20/85 (23%)
 Frame = +1

Query: 358 KSGPSQEPVERFD--------RPDAKVDS---------CQACGG---DENLLNCETCTYA 477
           KS   QEP+ER D        +P ++            C  CG    ++ LL C+ C  +
Sbjct: 310 KSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDS 369

Query: 478 YHPKCLLQPMRAPFPSSWKCPECVS 552
           YH  CL+ P+       W+CP+C++
Sbjct: 370 YHTFCLIPPLHDVPKGDWRCPKCLA 394



 Score = 33.1 bits (74), Expect = 6.2
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = +1

Query: 448  LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1224 MIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKIL 1268



>gb:AC115599_1205844 Dictyostelium discoideum chromosome 2 map
            4229098-4354721 strain AX4, complete sequence.
          Length = 2722

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 10/102 (9%)
 Frame = +1

Query: 313  YNLDDSDDEADIRRGKSGPSQEPVERFDRP-------DAKVDSCQACGGDE---NLLNCE 462
            Y  D+ ++E +    +    + P E   +        ++K  +C  C   +   N++ C+
Sbjct: 2506 YEYDEGEEEEEQEEEEDNNDESPDENETKNKKIIKIVESKHRACSECNKMDVKSNMITCD 2565

Query: 463  TCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCE 588
            TC   YH KCLL P+     + W C +C   ++D E+IL+C+
Sbjct: 2566 TCCSYYHSKCLLDPIDKSGYAYWICFKCC--MSD-EEILNCK 2604



 Score = 33.5 bits (75), Expect = 4.7
 Identities = 13/43 (30%), Positives = 22/43 (51%)
 Frame = +1

Query: 442  ENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIE 570
            E+ +NC TC   +H +C   P+    P +W C    S L+ ++
Sbjct: 896  ESFVNCGTCESVFHLECADPPLHKIPPGTWYCSNECSSLSQLK 938



>gb:AK042863_1166432 Mus musculus 7 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:A730032D07
           product:hypothetical FYVE/PHD zinc finger structure
           containing protein, full insert sequence.
          Length = 487

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C AC    +L  C TC+ AYH  CL  P++ P    W CP+C
Sbjct: 310 CAACKRGASLQPCGTCSGAYHLSCLDPPLKTPPKGLWVCPKC 351



>pir|T42697|T42697 hypothetical protein DKFZp434N0335.1 - human
           (fragment)
          Length = 1350

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 20/85 (23%)
 Frame = +1

Query: 358 KSGPSQEPVERFD--------RPDAKVDS---------CQACGG---DENLLNCETCTYA 477
           KS   QEP+ER D        +P ++            C  CG    ++ LL C+ C  +
Sbjct: 80  KSSIKQEPIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDS 139

Query: 478 YHPKCLLQPMRAPFPSSWKCPECVS 552
           YH  CL+ P+       W+CP+C++
Sbjct: 140 YHTFCLIPPLHDVPKGDWRCPKCLA 164



 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            D K+  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 981  DIKICLCQKAPAAP-MIQCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKIL 1039



>sp|P58268|REQU_CHICK Zinc-finger protein ubi-d4 (Requiem)
           (Apoptosis response zinc finger
           protein).>gb:AF362751_2489350 Gallus gallus requiem
           mRNA, complete cds.
          Length = 405

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  PM  P   SW C  C+  L +
Sbjct: 344 CNICGTSENDDQLLFCDDCDRGYHMYCLTPPMSEPPEGSWSCHLCLDLLKE 394



>gb:BC070839_2555808 Xenopus laevis cDNA clone MGC:84564
           IMAGE:6638153, complete cds.>gb:BC082478_2562713 Xenopus
           laevis cDNA clone MGC:84615 IMAGE:6642494, complete cds.
          Length = 387

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C+  L D
Sbjct: 328 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPVAEPPEGSWSCHLCLDLLKD 378



>gb:AB021740_2460989 Xenopus laevis mRNA for Requiem protein,
           partial cds, clone:req204.
          Length = 290

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C+  L D
Sbjct: 231 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPVAEPPEGSWSCHLCLDLLKD 281



>gb:AB021738_2460987 Xenopus laevis mRNA for Requiem protein,
           partial cds, clone:req201.
          Length = 198

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C+  L D
Sbjct: 139 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPVAEPPEGSWSCHLCLDLLKD 189



>gb:BC037661_2098121 Mus musculus fetal Alzheimer antigen, mRNA
           (cDNA clone IMAGE:5353895), partial cds.
          Length = 796

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC+  YH +C+  P+       W+C  CV+  + +  + DC
Sbjct: 254 DHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVA--HKVPGVTDC 308



>gb:AY138582_2076730 Mus musculus mixed-lineage leukemia 3 protein
           (Mll3) mRNA, partial cds.
          Length = 3396

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC  C
Sbjct: 317 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 366



 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421  CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
            C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 896  CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 941



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = +1

Query: 394  DRPDAKVDSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
            D+   + D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 837  DKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 893



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 274 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 333

Query: 574 ILDCET 591
           +L C+T
Sbjct: 334 MLVCDT 339



>gb:AY282495_1941893 Homo sapiens bromodomain PHD finger
           transcription factor mRNA, complete cds.
          Length = 2764

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC+  YH +C+  P+       W+C  CV+  + +  + DC
Sbjct: 252 DHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVA--HKVPGVTDC 306



>gb:AY024361_1934335 Homo sapiens MLL3 mRNA, complete cds.
          Length = 4911

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC  C
Sbjct: 386 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 435



 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421  CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
            C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 1010 CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 1055



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 343 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 402

Query: 574 ILDCET 591
           +L C+T
Sbjct: 403 MLVCDT 408



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)
 Frame = +1

Query: 415  DSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
            D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 958  DMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 1007



>gb:AB032251_1866046 Homo sapiens BPTF mRNA for bromodomain PHD
           finger transcription factor, complete cds.
          Length = 2781

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC+  YH +C+  P+       W+C  CV+  + +  + DC
Sbjct: 252 DHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVA--HKVPGVTDC 306



>gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid
           contig 3H10.
          Length = 1736

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 19/97 (19%)
 Frame = +1

Query: 316 NLDDSDDEADIRRGK-----SGPS---------QEPVERFDRPDAKV-DSCQACG-GDEN 447
           ++D  D EA  RR K     S P+         +    R  R D+   ++C+ CG G E 
Sbjct: 404 SVDKDDGEAGSRRSKRLKKDSVPTVAGSHMSLFRPSAPRIPREDSSSGENCEQCGKGSEE 463

Query: 448 ---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
              +L CE+C   YH  CL  P++    + W CP C+
Sbjct: 464 GSCMLVCESCDNHYHGSCLDPPLKTKPENEWNCPRCL 500



>gb:AK054270_1170760 Mus musculus 2 days pregnant adult female ovary
           cDNA, RIKEN full-length enriched library,
           clone:E330008K23 product:hypothetical HMG-I and HMG-Y
           DNA-binding domain (A+T-hook)/PHD-finger/DHHC-type
           Zn-finger/RING finger containing protein, full insert
           sequence.
          Length = 813

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC  C
Sbjct: 385 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 434



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 342 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 401

Query: 574 ILDCET 591
           +L C+T
Sbjct: 402 MLVCDT 407



>pir|T01020|T01020 hypothetical protein YUP8H12R.3 - Arabidopsis
           thaliana>gb:AE005173_895456 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:YUP8H12R_1731296 Arabidopsis thaliana
           chromosome 1 YAC YUP8H12R sequence, complete sequence.
          Length = 1257

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 8/82 (9%)
 Frame = +1

Query: 325 DSDDEADIRRGKSGPSQ-----EPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAY 480
           DSD+E+D+      PS+     +  +  +  D +   CQ C G++    LL+C  C   +
Sbjct: 667 DSDNESDLESEGGFPSENMYSADSADDSNDSDDEFQICQICSGEDERKKLLHCSECDKLF 726

Query: 481 HPKCLLQPMRAPFPSSWKCPEC 546
           HP C++ P+      +W C  C
Sbjct: 727 HPDCVVPPVIDLPSEAWICFSC 748



>sp|Q9W636|REQ2_XENLA Zinc-finger protein ubi-d4 2 (Requiem) (xReq)
           (Apoptosis response zinc finger protein) (Fragment).
          Length = 366

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C+  L D
Sbjct: 307 CNICGTSENDDQLLFCDDCDRGYHMYCLSPPVAEPPEGSWSCHLCLDLLKD 357



>sp|Q8BRH4|MLL3_MOUSE Myeloid/lymphoid or mixed-lineage leukemia
           protein 3 homolog (Histone- lysine N-methyltransferase,
           H3 lysine-4 specific MLL3) (EC 2.1.1.43).
          Length = 4903

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC  C
Sbjct: 385 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 434



 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421  CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
            C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 1003 CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 1048



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 17/57 (29%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = +1

Query: 394  DRPDAKVDSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
            D+   + D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 944  DKFTLQQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 1000



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 342 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 401

Query: 574 ILDCET 591
           +L C+T
Sbjct: 402 MLVCDT 407



>sp|Q8NEZ4|MLL3_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
           protein 3 homolog (Histone- lysine N-methyltransferase,
           H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to
           ALR protein).
          Length = 4911

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC  C
Sbjct: 386 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNC 435



 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421  CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
            C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 1010 CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 1055



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 343 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 402

Query: 574 ILDCET 591
           +L C+T
Sbjct: 403 MLVCDT 408



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)
 Frame = +1

Query: 415  DSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
            D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 958  DMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 1007



>sp|Q12830|FALZ_HUMAN Fetal Alzheimer antigen (Fetal Alz-50-reactive
           clone 1).>pir|G01252|G01252 small GTP binding protein
           SEC4 homolog - human>gb:HSU05237_2021602 Human fetal
           Alz-50-reactive clone 1 (FAC1) mRNA, complete cds.
          Length = 810

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC+  YH +C+  P+       W+C  CV+  + +  + DC
Sbjct: 252 DHCRVCHKLGDLLCCETCSAVYHLECVKPPLEEVPEDEWQCEVCVA--HKVPGVTDC 306



>gb:BC075306_2558411 Xenopus tropicalis D4, zinc and double PHD
           fingers family 2, mRNA (cDNA clone MGC:88966
           IMAGE:7003480), complete cds.
          Length = 428

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 3/55 (5%)
 Frame = +1

Query: 418 SCQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEK 573
           SC  CG    D+ LL C+ C   YH  CL  P+  P   SW C  C+    D  K
Sbjct: 368 SCGLCGTSDNDDQLLFCDDCDRGYHMYCLKPPLSEPPEGSWSCHLCIVEFYDGRK 422



>gb:AY069824_1294554 Drosophila melanogaster SD07276 full length
           cDNA.
          Length = 907

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C G   L+ C  C  ++H  C+ +P    F SSWKCPEC
Sbjct: 132 CWKCRGCGKLMPCSKCLRSFHSYCV-RPATTKFDSSWKCPEC 172



>gb:AE014297_1142361 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224354 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.
          Length = 1121

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C G   L+ C  C  ++H  C+ +P    F SSWKCPEC
Sbjct: 346 CWKCRGCGKLMPCSKCLRSFHSYCV-RPATTKFDSSWKCPEC 386



>gb:AE014297_1142360 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224353 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.>gb:BT010115_1357481 Drosophila melanogaster
           GH01331 full insert cDNA.
          Length = 1664

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C G   L+ C  C  ++H  C+ +P    F SSWKCPEC
Sbjct: 346 CWKCRGCGKLMPCSKCLRSFHSYCV-RPATTKFDSSWKCPEC 386



>gb:AE014297_1142359 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224352 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.
          Length = 1674

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/42 (42%), Positives = 23/42 (54%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C G   L+ C  C  ++H  C+ +P    F SSWKCPEC
Sbjct: 356 CWKCRGCGKLMPCSKCLRSFHSYCV-RPATTKFDSSWKCPEC 396



>sp|P58267|DPF1_CHICK Zinc-finger protein neuro-d4 (D4, zinc and
           double PHD fingers family 1).>gb:AF362752_2489351 Gallus
           gallus neuro-d4 mRNA, complete cds.
          Length = 380

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 3/52 (5%)
 Frame = +1

Query: 418 SCQACGG---DENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           +C  CG    DE LL C+ C   YH  C+  P+  P   +W C  C+  L D
Sbjct: 320 NCSLCGSAENDEQLLFCDDCDRGYHMYCISPPVAEPPEGTWSCHLCLRQLKD 371



>gb:AK039011_1165249 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230085B09
           product:cerebellum D4, full insert sequence.
          Length = 378

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 3/74 (4%)
 Frame = +1

Query: 376 EPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           E V+ +     +  SC  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C
Sbjct: 304 EAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLC 363

Query: 547 VSPLNDIEKILDCE 588
              L +      C+
Sbjct: 364 WELLKEKASAFGCQ 377



>gb:BC080691_2107781 Mus musculus jumonji, AT rich interactive
           domain 1A (Rbp2 like), mRNA (cDNA clone IMAGE:30111462),
           partial cds.
          Length = 1102

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
           C  CG    ++ LL C+ C  +YH  CLL P+       W+CP+CV+
Sbjct: 296 CMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVA 342



>gb:BC010717_2091067 Mus musculus jumonji, AT rich interactive
           domain 1A (Rbp2 like), mRNA (cDNA clone MGC:11659
           IMAGE:3603073), complete cds.
          Length = 621

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
           C  CG    ++ LL C+ C  +YH  CLL P+       W+CP+CV+
Sbjct: 296 CMFCGRGNNEDKLLLCDGCDDSYHTFCLLPPLPDVPKGDWRCPKCVA 342



>gb:HS127B20_1997060 Human DNA sequence from clone RP1-127B20 on
           chromosome 22, complete sequence.>gb:HSRYR7CC1_2020213
           Human DNA sequence from clone XX-PRYR7CC1 on chromosome
           22, complete sequence.
          Length = 432

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           + C AC    NL  C TC  AYH  CL  P++      W CP C
Sbjct: 311 EHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRC 354



>gb:CR456448_1992739 Homo sapiens dJ127B20.3 full length open
           reading frame (ORF) cDNA clone (cDNA clone
           C22ORF:pGEM.dJ127B20.3.V2).
          Length = 489

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           + C AC    NL  C TC  AYH  CL  P++      W CP C
Sbjct: 311 EHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRC 354



>gb:BC012187_1973508 Homo sapiens PHD finger protein 21B, mRNA (cDNA
           clone MGC:20476 IMAGE:4634631), complete cds.
          Length = 531

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           + C AC    NL  C TC  AYH  CL  P++      W CP C
Sbjct: 353 EHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRC 396



>gb:AE013599_1130126 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003787_1224588 Drosophila melanogaster
           chromosome 2R, section 2 of 74 of the complete sequence.
          Length = 495

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIE 570
           C  CG    D+ LL C+ C   YH  CL  P+  P   SW C  C+   + I+
Sbjct: 443 CSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLCMEEFHKIK 495



>gb:AE013599_1130125 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003787_1224587 Drosophila melanogaster
           chromosome 2R, section 2 of 74 of the complete
           sequence.>gb:AF427473_1270010 Drosophila melanogaster
           dd4 protein mRNA, complete cds.>gb:AY058600_1291754
           Drosophila melanogaster LD29238 full length cDNA.
          Length = 497

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIE 570
           C  CG    D+ LL C+ C   YH  CL  P+  P   SW C  C+   + I+
Sbjct: 445 CSICGTSDNDDQLLFCDDCDRGYHMYCLSPPLVTPPEGSWSCKLCMEEFHKIK 497



>pir|T47337|T47337 nucleic acid binding protein-like - Arabidopsis
           thaliana>gb:ATT21C14_1555104 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T21C14.>gb:AY062851_1565507
           Arabidopsis thaliana nucleic acid binding protein-like
           (T21C14.1) mRNA, complete cds.>gb:AY114574_1578616
           Arabidopsis thaliana nucleic acid binding protein-like
           (At3g42790) mRNA, complete cds.
          Length = 250

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 26/88 (29%), Positives = 39/88 (44%), Gaps = 11/88 (12%)
 Frame = +1

Query: 316 NLDDSDDEADIRRGKSGPSQEP------VERFDRPDAKVDSCQACG----GDENLLNCET 465
           N   S+ +     GKS  +++P      ++  D  D     C ACG     DE  + C+ 
Sbjct: 156 NKSKSNSKVRTSEGKSSKTKQPKEEDEEIDEDDEDDHGETLCGACGDSDGADEFWICCDL 215

Query: 466 CTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           C   +H KC+ + P RA     +KCP C
Sbjct: 216 CEKWFHGKCVKITPARAEHIKQYKCPSC 243



>gb:BC072079_2556343 Xenopus laevis hypothetical protein LOC432234,
           mRNA (cDNA clone IMAGE:4405272), partial cds.
          Length = 597

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 24/101 (23%), Positives = 50/101 (49%), Gaps = 8/101 (7%)
 Frame = +1

Query: 349 RRGKSGPSQEPVERFDRPDAKVDSCQACGGD---ENLLNCETCTYAYHPKCLLQPMRA-P 516
           ++ ++GP  +  +   +   ++ +C  CGG    E  L C+ C  A+H  CL  P+   P
Sbjct: 292 QKRQNGPECKHCKDNPKRACRMCACCICGGKQDPEKQLLCDECDLAFHIYCLKPPLSVIP 351

Query: 517 FPSSWKCPECVSPLNDI----EKILDCETRPTIADDSDASK 627
               W CP+C +  +++    EK+ + + +  +A  + +S+
Sbjct: 352 QDEDWYCPDCRNDASEVVLAGEKLKESKKKARMASANSSSQ 392



>gb:BC028397_1979256 Homo sapiens ubiquitin-like, containing PHD and
           RING finger domains, 2, transcript variant 1, mRNA (cDNA
           clone MGC:33463 IMAGE:4797830), complete cds.
          Length = 503

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC+ CGG  + N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 346 SCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVK 401



>gb:AL133480_1918606 Human DNA sequence from clone RP11-307L3 on
           chromosome 9p23-24.3 Contains a selenoprotein T
           (LOC51714) pseudogene, the gene for a novel protein
           kinase (NYD-SP25), the 5' end of the gene for
           ubiquitin-like, containing PHD and RING finger domains 2
           (URF2), a novel gene and a CpG island, complete
           sequence.>gb:AL353718_1922993 Human DNA sequence from
           clone RP11-472F14 on chromosome 9 Cotains the 3' end of
           the gene for ubiquitin-like, containing PHD and RING
           finger domains 2 (URF2), a novel gene (PROO365), the 3'
           end of the GLDC gene for glycine dehydrogenase
           (decarboxylating; glycine decarboxylase, glycine
           cleavage system protein P) and a pseudogene similar to
           part of RP42 homolog, complete sequence.
          Length = 503

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC+ CGG  + N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 346 SCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVK 401



>gb:AB071698_1871214 Homo sapiens NIRF mRNA for Np95-like ring
           finger protein, complete cds.>gb:AF274049_1894212 Homo
           sapiens nuclear zinc finger protein Np97 (UHRF2) mRNA,
           complete cds.>gb:AL133480_1918605 Human DNA sequence
           from clone RP11-307L3 on chromosome 9p23-24.3 Contains a
           selenoprotein T (LOC51714) pseudogene, the gene for a
           novel protein kinase (NYD-SP25), the 5' end of the gene
           for ubiquitin-like, containing PHD and RING finger
           domains 2 (URF2), a novel gene and a CpG island,
           complete sequence.>gb:AL353718_1922992 Human DNA
           sequence from clone RP11-472F14 on chromosome 9 Cotains
           the 3' end of the gene for ubiquitin-like, containing
           PHD and RING finger domains 2 (URF2), a novel gene
           (PROO365), the 3' end of the GLDC gene for glycine
           dehydrogenase (decarboxylating; glycine decarboxylase,
           glycine cleavage system protein P) and a pseudogene
           similar to part of RP42 homolog, complete sequence.
          Length = 802

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC+ CGG  + N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 346 SCRVCGGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVK 401



>gb:BX908807_1644503 Neurospora crassa DNA linkage group III BAC
            contig B13B7.
          Length = 1369

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +1

Query: 391  FDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPM-RAPFPSSWKCPEC 546
            + + D   D C +CGG+  L+ C+ CT ++H  C+  P+ +   P  W C  C
Sbjct: 889  YAKEDDNDDYCSSCGGNGQLICCDGCTRSFHFSCVDPPLVQGAMPDEWFCNVC 941



>pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo
            sapiens ALR mRNA, complete cds.
          Length = 4957

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 15/127 (11%)
 Frame = +1

Query: 253  LKEMASLVERLRVRS-DRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKV---DS 420
            LK  AS +E L V   D  P    ++ DD+           Q  V  F   D  V   D 
Sbjct: 749  LKSTASSIETLVVADIDSSPSKEEEEEDDDT---------MQNTVVLFSNTDKFVLMQDM 799

Query: 421  CQACGG-----DENLLNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECV-----SPLNDI 567
            C  CG      + +LL C  C+  YHP C+   + +      W+C EC+        +D 
Sbjct: 800  CVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDP 859

Query: 568  EKILDCE 588
             ++L C+
Sbjct: 860  SRLLLCD 866



 Score = 39.7 bits (91), Expect = 0.066
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
           C+ CG       LL C+ C  +YH  CL  P+       WKC  CVS
Sbjct: 850 CEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVS 896



>gb:AF362753_2489352 Gallus gallus cer-d4 mRNA, complete cds.
          Length = 378

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 3/60 (5%)
 Frame = +1

Query: 376 EPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           E V+ +     +  SC  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C
Sbjct: 304 EAVKTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLNPPVFEPPEGSWSCHLC 363



>gb:BC048180_2099574 Mus musculus jumonji, AT rich interactive
           domain 1B (Rbp2 like), mRNA (cDNA clone MGC:61207
           IMAGE:6826125), complete cds.>gb:BC057318_2102699 Mus
           musculus jumonji, AT rich interactive domain 1B (Rbp2
           like), mRNA (cDNA clone MGC:66676 IMAGE:6826125),
           complete cds.
          Length = 1544

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDAKVDS--CQACGG---DENLLNCETCTYAYHPKCLLQPMRAPFPSSWKC 537
           ++P  R  +    VD   C  CG    ++ LL C+ C  +YH  CL+ P+       W+C
Sbjct: 294 EKPKSRAKKTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDWRC 353

Query: 538 PECVS 552
           P+C++
Sbjct: 354 PKCLA 358



 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            + KV  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1175 EMKVCLCQKTPATP-MIQCELCRDAFHTSCVAAPSISQSSRIWLCPHCRRSEKPPLEKIL 1233



>gb:AY082429_2075966 Mus musculus PLU1 (Plu1) mRNA, complete
           cds.>gb:AY082430_2075967 Mus musculus PLU1 short form
           (Plu1) mRNA, complete cds.
          Length = 1544

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDAKVDS--CQACGG---DENLLNCETCTYAYHPKCLLQPMRAPFPSSWKC 537
           ++P  R  +    VD   C  CG    ++ LL C+ C  +YH  CL+ P+       W+C
Sbjct: 294 EKPKSRAKKTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDWRC 353

Query: 538 PECVS 552
           P+C++
Sbjct: 354 PKCLA 358



 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            + KV  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1175 EMKVCLCQKTPATP-MIQCELCRDAFHTSCVAAPSISQSSRIWLCPHCRRSEKPPLEKIL 1233



>gb:BC048307_1984141 Homo sapiens Jumonji, AT rich interactive
           domain 1A (RBBP2-like), mRNA (cDNA clone IMAGE:5551045),
           partial cds.>gb:BC053893_1985100 Homo sapiens Jumonji,
           AT rich interactive domain 1A (RBBP2-like), mRNA (cDNA
           clone IMAGE:6144764), partial cds.
          Length = 1102

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
           C  CG    ++ LL C+ C  +YH  CL+ P+       W+CP+CV+
Sbjct: 296 CMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVA 342



>gb:ATAC010870_1543187 Arabidopsis thaliana chromosome III BAC T13O15
            genomic sequence, complete sequence.
          Length = 2176

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421  CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
            C+ CG    D+++L C+TC   YH  CL  P+      +W CP CV
Sbjct: 1290 CKVCGVDKDDDSVLLCDTCDAEYHTYCLNPPLIRIPDGNWYCPSCV 1335



>gb:AF417921_1269439 Drosophila melanogaster nucleosome remodeling
           factor large subunit NURF301 (Nurf301) mRNA, complete
           cds.
          Length = 2669

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC   YH +C+  PM       W+C  C S  + +  ++DC
Sbjct: 340 DHCRVCHRLGDLLCCETCPAVYHLECVDPPMNDVPTEDWQCGLCRS--HKVSGVVDC 394



>gb:AK041304_1165943 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530098F22
           product:PLU-1 PROTEIN homolog [Homo sapiens], full
           insert sequence.
          Length = 1433

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDAKVDS--CQACGG---DENLLNCETCTYAYHPKCLLQPMRAPFPSSWKC 537
           ++P  R  +    VD   C  CG    ++ LL C+ C  +YH  CL+ P+       W+C
Sbjct: 294 EKPKSRAKKTATAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLVPPLHDVPKGDWRC 353

Query: 538 PECVS 552
           P+C++
Sbjct: 354 PKCLA 358



 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC-VSPLNDIEKIL 579
            + KV  CQ       ++ CE C  A+H  C+  P  +     W CP C  S    +EKIL
Sbjct: 1175 EMKVCLCQKTPATP-MIQCELCRDAFHTSCVAAPSISQSSRIWLCPHCRRSEKPPLEKIL 1233



>gb:AE014296_1133984 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003467_1211283 Drosophila melanogaster
           chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 2159

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC   YH +C+  PM       W+C  C S  + +  ++DC
Sbjct: 340 DHCRVCHRLGDLLCCETCPAVYHLECVDPPMNDVPTEDWQCGLCRS--HKVSGVVDC 394



>gb:AE014296_1133983 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003467_1211282 Drosophila melanogaster
           chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 2669

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC   YH +C+  PM       W+C  C S  + +  ++DC
Sbjct: 340 DHCRVCHRLGDLLCCETCPAVYHLECVDPPMNDVPTEDWQCGLCRS--HKVSGVVDC 394



>gb:AE014296_1133982 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003467_1211281 Drosophila melanogaster
           chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 2649

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
           D C+ C    +LL CETC   YH +C+  PM       W+C  C S  + +  ++DC
Sbjct: 340 DHCRVCHRLGDLLCCETCPAVYHLECVDPPMNDVPTEDWQCGLCRS--HKVSGVVDC 394



>sp|P29375|RBB2_HUMAN Retinoblastoma-binding protein 2
           (RBBP-2).>pir|I78879|I78879 retinoblastoma binding
           protein 2 - human>gb:S66431_2040830 RBP2=retinoblastoma
           binding protein 2 [human, Nalm-6 pre-B cell leukemia,
           mRNA, 6455 nt].
          Length = 1722

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 3/47 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
           C  CG    ++ LL C+ C  +YH  CL+ P+       W+CP+CV+
Sbjct: 296 CMFCGRGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVA 342



>sp|P58270|DPF3_CHICK Zinc-finger protein DPF3
           (cer-d4).>gb:AF362754_2489353 Gallus gallus cer-d4 mRNA,
           complete cds.
          Length = 427

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 3/60 (5%)
 Frame = +1

Query: 376 EPVERFDRPDAKVDSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           E V+ +     +  SC  CG  EN   LL C+ C   YH  CL  P+  P   SW C  C
Sbjct: 353 EAVKTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLNPPVFEPPEGSWSCHLC 412



>gb:BC071280_2556026 Danio rerio zgc:85741, mRNA (cDNA clone
           MGC:85741 IMAGE:6523916), complete cds.
          Length = 1503

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 25/109 (22%), Positives = 49/109 (44%), Gaps = 8/109 (7%)
 Frame = +1

Query: 250 LLKEMASLVERLRVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDS--- 420
           L + M S V    V+++ +    +   ++  +I+     P +   ++ + P   V     
Sbjct: 240 LRRRMGSFV----VKTEPKKEIPIQVKEEPVEIKELNPEPEKSKPKKKNIPPPPVSMVDL 295

Query: 421 --CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
             C  CG    ++ LL C+ C  +YH  CL+ P+       W+CP+C++
Sbjct: 296 YVCLVCGKGNDEDRLLLCDGCDDSYHTFCLIPPLTDVPKGDWRCPKCLT 344



 Score = 37.4 bits (85), Expect = 0.33
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = +1

Query: 394  DRPDAKVDSCQ--ACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV----SP 555
            D    KV  CQ  A G    +L CE C  A+H  C+  P     P +W CP C+     P
Sbjct: 1164 DCASLKVCVCQKPAMGA---MLQCELCRDAFHSVCVRGPSDPLDPEAWLCPLCLRSTKPP 1220

Query: 556  LNDIEKIL 579
            L+ I  +L
Sbjct: 1221 LDKIRSLL 1228



>gb:AC124144_1740444 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0099P06, complete sequence.
          Length = 258

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 7/86 (8%)
 Frame = +1

Query: 316 NLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDS--CQACGG----DENLLNCETCTYA 477
           N   S   +D+ R ++   +E  E +D  D       C  CGG    DE  + C+ C   
Sbjct: 169 NKISSKHTSDVARVENNIKEED-EGYDEDDGDHSETLCGTCGGIYSADEFWIGCDVCERW 227

Query: 478 YHPKCL-LQPMRAPFPSSWKCPECVS 552
           YH KC+ + P +A     +KCP C S
Sbjct: 228 YHGKCVKITPAKAESIKQYKCPSCSS 253



>gb:AY064131_1566013 Arabidopsis thaliana AT5g09790/F17I14_20 mRNA,
           complete cds.>gb:AY120701_1579583 Arabidopsis thaliana
           AT5g09790/F17I14_20 mRNA, complete cds.
          Length = 352

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
 Frame = +1

Query: 358 KSGPSQEPVERFDRPDAKVDSCQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFP-S 525
           KS P  E  E  D       +C+ CG   GD+ LL C+ C   +H KC L+P+    P  
Sbjct: 46  KSVPVVEQEEEEDEDSYSNVTCEKCGSGEGDDELLLCDKCDRGFHMKC-LRPIVVRVPIG 104

Query: 526 SWKCPEC 546
           +W C +C
Sbjct: 105 TWLCVDC 111



>gb:AB020752_1514691 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MTH16.
          Length = 378

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
 Frame = +1

Query: 358 KSGPSQEPVERFDRPDAKVDSCQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFP-S 525
           KS P  E  E  D       +C+ CG   GD+ LL C+ C   +H KC L+P+    P  
Sbjct: 46  KSVPVVEQEEEEDEDSYSNVTCEKCGSGEGDDELLLCDKCDRGFHMKC-LRPIVVRVPIG 104

Query: 526 SWKCPEC 546
           +W C +C
Sbjct: 105 TWLCVDC 111



>pir|T49919|T49919 hypothetical protein F17I14.20 - Arabidopsis
           thaliana>gb:ATF17I14_1548907 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F17I14 (ESSA project).
          Length = 379

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)
 Frame = +1

Query: 358 KSGPSQEPVERFDRPDAKVDSCQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFP-S 525
           KS P  E  E  D       +C+ CG   GD+ LL C+ C   +H KC L+P+    P  
Sbjct: 46  KSVPVVEQEEEEDEDSYSNVTCEKCGSGEGDDELLLCDKCDRGFHMKC-LRPIVVRVPIG 104

Query: 526 SWKCPEC 546
           +W C +C
Sbjct: 105 TWLCVDC 111



>pir|A88925|A88925 protein F33E11.3 [imported] - Caenorhabditis
           elegans
          Length = 1192

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)
 Frame = +1

Query: 400 PDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPF---PSSWKCPEC 546
           P    DSC+  GG+  ++ C TC  AYHP+C+  P R         W C +C
Sbjct: 423 PSRPCDSCEKTGGE--MICCATCKIAYHPQCIEMPERMAALVKTYEWSCVDC 472



>sp|P56163|DPF1_RAT Zinc-finger protein neuro-d4 (D4, zinc and
           double PHD fingers family 1).>pir|S26731|S26731 neuro-D4
           protein - rat
          Length = 397

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 13/62 (20%)
 Frame = +1

Query: 418 SCQACGGDEN-------------LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL 558
           SC  CG  EN             LL C+ C   YH  CL  PM  P   SW C  C+  L
Sbjct: 327 SCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHL 386

Query: 559 ND 564
            +
Sbjct: 387 KE 388



>sp|Q92782|DPF1_HUMAN Zinc-finger protein neuro-d4 (D4, zinc and
           double PHD fingers family 1).>gb:HSU43843_2024322 Human
           h-neuro-d4 protein mRNA, complete cds.
          Length = 353

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 13/62 (20%)
 Frame = +1

Query: 418 SCQACGGDEN-------------LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPL 558
           SC  CG  EN             LL C+ C   YH  CL  PM  P   SW C  C+  L
Sbjct: 283 SCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLCLRHL 342

Query: 559 ND 564
            +
Sbjct: 343 KE 344



>gb:BC086142_2564725 Xenopus laevis hypothetical LOC495762, mRNA
           (cDNA clone IMAGE:7199201), partial cds.
          Length = 390

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 329 CNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 379



 Score = 32.7 bits (73), Expect = 8.1
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRGKSGPS-QEPVERFDRPDAKVDSCQACGGDENLLNCETC 468
           + D RP   +    +E   ++G  G +       F   D+K++  +  G  E L++C  C
Sbjct: 240 KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKIN--KKTGQPEELVSCSDC 297

Query: 469 TYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
             + HP CL   P  M A     W+C EC
Sbjct: 298 GRSGHPSCLQFTPVMMAAVKTYRWQCIEC 326



>gb:BT007983_2150915 Synthetic construct Homo sapiens requiem,
           apoptosis response zinc finger gene mRNA, partial cds.
          Length = 392

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 330 CNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 380



>gb:BC007188_2090579 Mus musculus D4, zinc and double PHD fingers
           family 2, mRNA (cDNA clone IMAGE:3592482), partial cds.
          Length = 351

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 290 CNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 340



 Score = 32.7 bits (73), Expect = 8.1
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRGKSGPS-QEPVERFDRPDAKVDSCQACGGDENLLNCETC 468
           + D RP   +    +E   ++G  G +       F   D+K++  +  G  E L++C  C
Sbjct: 201 KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKIN--KKTGQPEELVSCSDC 258

Query: 469 TYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
             + HP CL   P  M A     W+C EC
Sbjct: 259 GRSGHPSCLQFTPVMMAAVKTYRWQCIEC 287



>gb:AL596125_2070891 Mouse DNA sequence from clone RP23-5O23 on
           chromosome 11 Contains the Chd3 gene for chromodomain
           helicase DNA binding protein 3, five novel genes, the 3'
           end of the gene for a novel protein similar to dynein
           and four CpG islands, complete sequence.
          Length = 143

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 4/71 (5%)
 Frame = +1

Query: 346 IRRGKSGPSQEPVERFDRPDA----KVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           ++RG+ G  ++ V   +  D       D C+ C     ++ C+TC  AYH  CL   +  
Sbjct: 56  LKRGRPGRKKKKVTGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDR 115

Query: 514 PFPSSWKCPEC 546
                W CP C
Sbjct: 116 APEGKWSCPHC 126



>gb:AF108134_2054741 Mus musculus ubi-d4/requiem gene, exons 2
           through 11 and partial cds.
          Length = 380

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 319 CNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 369



 Score = 32.7 bits (73), Expect = 8.1
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRGKSGPS-QEPVERFDRPDAKVDSCQACGGDENLLNCETC 468
           + D RP   +    +E   ++G  G +       F   D+K++  +  G  E L++C  C
Sbjct: 230 KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKIN--KKTGQPEELVSCSDC 287

Query: 469 TYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
             + HP CL   P  M A     W+C EC
Sbjct: 288 GRSGHPSCLQFTPVMMAAVKTYRWQCIEC 316



>gb:AY030283_1934506 Homo sapiens PHD zinc finger transcription
           factor mRNA, complete cds.
          Length = 704

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 31/110 (28%), Positives = 44/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 334 DEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           DEA+ R  K  P +EP  R        DSC +C    +LL C+ C  A+H +C   P+  
Sbjct: 34  DEAEKRSRK--PEKEP--RRSGRATNHDSCDSCKEGGDLLCCDHCPAAFHLQCCNPPLSE 89

Query: 514 PF--PSSWKCPECV---------SPLNDIEKILDCETRPTIADDSDASKL 630
               P  W C  C            L  +  ++D   + T +  SD   L
Sbjct: 90  EMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSGKRTTSPSSDTDLL 139



 Score = 33.9 bits (76), Expect = 3.6
 Identities = 26/105 (24%), Positives = 43/105 (40%)
 Frame = +1

Query: 448 LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDASK 627
           L+ C+ C   +H  CL  P+ A     W CP      N IE ++  +   T+++      
Sbjct: 286 LIQCDYCPLLFHMDCLEPPLTAMPLGRWMCP------NHIEHVVLNQKNMTLSNRCQV-- 337

Query: 628 LGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKV 762
               Q  V Q++VK    + +H    P     +  Q++ R   KV
Sbjct: 338 FDRFQDTVSQHVVKVDFLNRIHKKHPPNR---RVLQSVKRRSLKV 379



>gb:AY087173_1572207 Arabidopsis thaliana clone 32443 mRNA, complete
           sequence.
          Length = 255

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDAKVDSCQACG----GDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKC 537
           +E VE  D  +     C ACG     DE  + C+ C   +H KC+ + P RA     +KC
Sbjct: 186 EEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKC 245

Query: 538 PEC 546
           P C
Sbjct: 246 PSC 248



>gb:ATT2L20_1555744 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T2L20 (ESSA project).
          Length = 1595

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 19/48 (39%), Positives = 22/48 (45%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D   D C  C  D +LL C+ C  AYH KC+           W CPEC
Sbjct: 605 DRNSDDCCFCKMDGSLLCCDGCPAAYHSKCVGLASHLLPEGDWYCPEC 652



>gb:CR925955_1185487 Pongo pygmaeus mRNA; cDNA DKFZp459N0520 (from
           clone DKFZp459N0520).
          Length = 405

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 344 CNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 394



>pir|A55302|A55302 probable transcription factor requiem -
           mouse>gb:MMU10435_2118266 Mus musculus zinc finger
           protein Requiem (req) mRNA, complete cds.
          Length = 371

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 310 CNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 360



 Score = 32.7 bits (73), Expect = 8.1
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRGKSGPS-QEPVERFDRPDAKVDSCQACGGDENLLNCETC 468
           + D RP   +    +E   ++G  G +       F   D+K++  +  G  E L++C  C
Sbjct: 221 KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKIN--KKTGQPEELVSCSDC 278

Query: 469 TYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
             + HP CL   P  M A     W+C EC
Sbjct: 279 GRSGHPSCLQFTPVMMAAVKTYRWQCIEC 307



>pir|T01840|T01840 hypothetical protein F9D12.13 - Arabidopsis
           thaliana>gb:F9D12_1678662 Arabidopsis thaliana BAC
           F9D12.
          Length = 251

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 5/63 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDAKVDSCQACG----GDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKC 537
           +E VE  D  +     C ACG     DE  + C+ C   +H KC+ + P RA     +KC
Sbjct: 182 EEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKC 241

Query: 538 PEC 546
           P C
Sbjct: 242 PSC 244



>sp|Q61103|REQU_MOUSE Zinc-finger protein ubi-d4 (Requiem)
           (Apoptosis response zinc finger protein) (D4, zinc and
           double PHD fingers family 2).>gb:AK004812_1152613 Mus
           musculus adult male lung cDNA, RIKEN full-length
           enriched library, clone:1200016G04 product:requiem, full
           insert sequence.>gb:BC012709_2091638 Mus musculus D4,
           zinc and double PHD fingers family 2, mRNA (cDNA clone
           MGC:14002 IMAGE:4208205), complete
           cds.>gb:MMU43921_2121488 Mus musculus ubi-d4 mRNA,
           complete cds.
          Length = 391

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 330 CNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 380



 Score = 32.7 bits (73), Expect = 8.1
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 4/89 (4%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRGKSGPS-QEPVERFDRPDAKVDSCQACGGDENLLNCETC 468
           + D RP   +    +E   ++G  G +       F   D+K++  +  G  E L++C  C
Sbjct: 241 KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKIN--KKTGQPEELVSCSDC 298

Query: 469 TYAYHPKCL-LQP--MRAPFPSSWKCPEC 546
             + HP CL   P  M A     W+C EC
Sbjct: 299 GRSGHPSCLQFTPVMMAAVKTYRWQCIEC 327



>sp|Q92785|REQU_HUMAN Zinc-finger protein ubi-d4 (Requiem)
           (Apoptosis response zinc finger protein) (D4, zinc and
           double PHD fingers family 2).>gb:AY220877_1939542 Homo
           sapiens requiem, apoptosis response zinc finger gene
           (REQ) gene, complete cds.>gb:BC014889_1974814 Homo
           sapiens D4, zinc and double PHD fingers family 2, mRNA
           (cDNA clone MGC:10180 IMAGE:3908181), complete
           cds.>gb:BT006718_1990156 Homo sapiens requiem, apoptosis
           response zinc finger gene mRNA, complete
           cds.>gb:HSAF001433_2010085 Human requiem (HREQ) mRNA,
           complete cds.>gb:HSU94585_2027686 Homo sapiens requiem
           homolog (hsReq) mRNA, complete cds.
          Length = 391

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 3/51 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           C  CG  EN   LL C+ C   YH  CL   M  P   SW C  C+  L +
Sbjct: 330 CNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKE 380



>gb:BC076654_2559403 Xenopus tropicalis protein kinase C binding
           protein 1, mRNA (cDNA clone MGC:79521 IMAGE:6977562),
           complete cds.
          Length = 1145

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 23/90 (25%), Positives = 40/90 (44%), Gaps = 5/90 (5%)
 Frame = +1

Query: 292 RSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLLN 456
           +  ++P     ++ +++++R G     K   + +PV+   +       C  C  +  +L 
Sbjct: 63  KKKKKPGVINSNNKEQSELRHGPFYYMKQPLTTDPVDVIPQDGRNDFYCWVCHREGQVLC 122

Query: 457 CETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CE C   YH KCL   + A     W CPEC
Sbjct: 123 CELCPRVYHAKCL--KLTAEPEGDWFCPEC 150



>gb:BC068803_2555303 Xenopus laevis hypothetical protein MGC81393,
           mRNA (cDNA clone MGC:81393 IMAGE:6634814), complete cds.
          Length = 329

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 32/125 (25%), Positives = 50/125 (40%), Gaps = 22/125 (17%)
 Frame = +1

Query: 310 VYNLDDSDDEADIRRGKSGP--SQEPVERFDRPDAKV---------DSCQACGGDENLLN 456
           VY+LD S    +  +    P  S+E  ++  RP+ +          DSC +C    +LL 
Sbjct: 7   VYDLDTSGGLMEQIQALLAPPKSEEGEKKSKRPEKEPRRSGRATNHDSCDSCKEGGDLLC 66

Query: 457 CETCTYAYHPKCLLQPMRAPF--PSSWKCPECV---------SPLNDIEKILDCETRPTI 603
           C+ C  A+H +C   P+      P  W C  C            L  +  + D   R T+
Sbjct: 67  CDHCPAAFHLQCCNPPLSEEMLPPGEWMCHRCTIRRKKRERKKELGQVNGLFDRYGRRTV 126

Query: 604 ADDSD 618
           +  SD
Sbjct: 127 SPTSD 131



>gb:HSU52365_2024740 Human SMCY mRNA, partial cds.
          Length = 457

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCET 591
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+        + +C+ 
Sbjct: 317 CQVCSRGDEDNKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI--------LAECKQ 368

Query: 592 RPTIADDSDASKLGSKQIF 648
            P       A++  S Q F
Sbjct: 369 PPEAFGFEQATQEYSLQSF 387



>gb:HSU52191_2024737 Human SMCY (H-Y) mRNA, complete cds.
          Length = 1539

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCET 591
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+        + +C+ 
Sbjct: 317 CQVCSRGDEDNKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI--------LAECKQ 368

Query: 592 RPTIADDSDASKLGSKQIF 648
            P       A++  S Q F
Sbjct: 369 PPEAFGFEQATQEYSLQSF 387



>gb:D87072_1995302 Homo sapiens mRNA for KIAA0234 gene, partial cds.
          Length = 1512

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCET 591
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+        + +C+ 
Sbjct: 290 CQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI--------LAECKQ 341

Query: 592 RPTIADDSDASKLGSKQIF 648
            P       A++  S Q F
Sbjct: 342 PPEAFGFEQATQEYSLQSF 360



>gb:AK044828_1167155 Mus musculus 9.5 days embryo parthenogenote
           cDNA, RIKEN full-length enriched library,
           clone:B130006H11 product:hypothetical HMG-I and HMG-Y
           DNA-binding domain (A+T-hook)/PHD-finger/DHHC-type
           Zn-finger/RING finger containing protein, full insert
           sequence.
          Length = 440

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +1

Query: 400 PDAKV-DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKC 537
           P+ KV  +C+  G D  +L C+TC   YH  CL   M++   + WKC
Sbjct: 385 PECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKC 431



 Score = 35.8 bits (81), Expect = 0.95
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 8/66 (12%)
 Frame = +1

Query: 418 SCQACGGDENLLN---CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN-----DIEK 573
           +C  C    +LL+   C TC   YH  CL   +     + W+CPEC    N     +  K
Sbjct: 342 NCAVCDSPGDLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSK 401

Query: 574 ILDCET 591
           +L C+T
Sbjct: 402 MLVCDT 407



>sp|Q9BY66|SMCY_HUMAN SmcY protein (Histocompatibility Y antigen)
           (H-Y).>gb:AF273841_1894206 Homo sapiens SMCY (SMCY)
           gene, complete cds.
          Length = 1539

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 3/79 (3%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCET 591
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+        + +C+ 
Sbjct: 317 CQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI--------LAECKQ 368

Query: 592 RPTIADDSDASKLGSKQIF 648
            P       A++  S Q F
Sbjct: 369 PPEAFGFEQATQEYSLQSF 387



>gb:AF274047_2061191 Mus musculus nuclear zinc finger protein Np97
           (Uhrf2) mRNA, complete cds.
          Length = 803

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC  CG   D N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 347 SCHKCGEKRDPNMQLLCDECNMAYHIYCLSPPLDKVPEEEYWYCPSCKTDSSEVVK 402



>gb:AB116653_2048588 Mus musculus NIRF mRNA for Np95-like ring
           finger protein, complete cds.>gb:BC060241_2103946 Mus
           musculus ubiquitin-like, containing PHD and RING finger
           domains 2, mRNA (cDNA clone MGC:59403 IMAGE:6334856),
           complete cds.
          Length = 803

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC  CG   D N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 347 SCHKCGEKRDPNMQLLCDECNMAYHIYCLSPPLDKVPEEEYWYCPSCKTDSSEVVK 402



>gb:AY736376_1960736 Pan troglodytes JARID1D mRNA, complete cds.
          Length = 1535

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+
Sbjct: 317 CQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI 362



>gb:SPBP19A11_1720579 S.pombe chromosome II cosmid p19A11.
          Length = 1513

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)
 Frame = +1

Query: 415 DSCQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIE 570
           + C+ CG D+N   +L C+ C  AYH  CL  P+ +     W C  C   ++D +
Sbjct: 269 EQCEYCGLDKNPETILLCDGCEAAYHTSCLDPPLTSIPKEDWYCDACKFNISDYD 323



>gb:OSJN00088_1694673 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0085I10, complete sequence.
          Length = 849

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 25/90 (27%), Positives = 33/90 (36%), Gaps = 3/90 (3%)
 Frame = +1

Query: 286 RVRSDRRPVYNLDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDEN---LLN 456
           RVR   + V   DD  D+        G ++         D +   CQ C  +E    LL+
Sbjct: 209 RVRKVAKLVEVSDDDSDDYSPSESDHGSTES--------DEEFHMCQICNTEEEKTLLLH 260

Query: 457 CETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C+   HP CL  P        W C  C
Sbjct: 261 CSGCSRHVHPGCLTPPWTGVLTDDWSCYTC 290



>gb:CR382138_1671563 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 795

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 17/49 (34%), Positives = 23/49 (46%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLN 561
           D C  CGG    + C+TC  ++H  C   P+      +W C ECV   N
Sbjct: 334 DFCTNCGGPGVFICCDTCPKSFHFTCCNPPLEECPEDNWHCQECVIKQN 382



>gb:AC116977_1206991 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 914

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 9/89 (10%)
 Frame = +1

Query: 307 PVYNLDDSDDEADI-RRGKSGPSQEPVE--------RFDRPDAKVDSCQACGGDENLLNC 459
           P+ N+D S+  +++ ++ +  PS E +E        +  R     D C  CG   +LL C
Sbjct: 17  PIPNVDPSNTNSNLPQKRQRRPSSEYLESQLPKTNLKNKRGVINDDYCSGCGDGGDLLCC 76

Query: 460 ETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           + C  ++H  CL  P+       W C  C
Sbjct: 77  DNCQASFHLICLNPPLNEIPSGDWFCDSC 105



>gb:CR858238_1182423 Pongo pygmaeus mRNA; cDNA DKFZp469B034 (from
           clone DKFZp469B034).
          Length = 1088

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           CQ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+
Sbjct: 317 CQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPKCI 362



>gb:AK080925_1173132 Mus musculus 4 days neonate male adipose cDNA,
           RIKEN full-length enriched library, clone:B430210O11
           product:hypothetical Ubiquitin domain containing
           protein, full insert sequence.
          Length = 516

 Score = 41.2 bits (95), Expect = 0.023
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)
 Frame = +1

Query: 418 SCQACGG--DENL-LNCETCTYAYHPKCLLQPM-RAPFPSSWKCPECVSPLNDIEK 573
           SC  CG   D N+ L C+ C  AYH  CL  P+ + P    W CP C +  +++ K
Sbjct: 347 SCHKCGEKRDPNMQLLCDECNMAYHIYCLSPPLDKVPEEEYWYCPSCKTDSSEVVK 402



>gb:HSAJ9610_2010458 Homo sapiens AIRE gene.
          Length = 515

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 3/72 (4%)
 Frame = +1

Query: 343 DIRRGKSGPSQEPVERFDRPDA---KVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           + R G+ G    P+     P       D C  C     L+ C+ C  A+H  CL  P+R 
Sbjct: 270 EARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLRE 329

Query: 514 PFPSSWKCPECV 549
               +W+C  C+
Sbjct: 330 IPSGTWRCSSCL 341



>gb:AL390212_1926544 Human DNA sequence from clone RP1-29M10 on
           chromosome 20 Contains part of the PRKCBP1 gene for
           protein kinase C binding protein 1, ESTs, GSSs and a CpG
           island, complete sequence.>gb:HS569M23_1999071 Human DNA
           sequence from clone RP4-569M23 on chromosome 20q12-13.1
           Contains the PRKCBP1 gene for protein kinase C binding
           protein 1, a putative novel gene, ESTs, STSs and GSSs,
           complete sequence.>gb:HSJ890O15_2016620 Human DNA
           sequence from clone RP5-890O15 on chromosome 20,
           complete sequence.
          Length = 1141

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P     ++ +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 42  IKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 101

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 102 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 130



>gb:AF186605_1888632 Homo sapiens MLL2 protein mRNA, partial cds.
          Length = 2605

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421  CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAPFP-SSWKCPECV 549
            C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 1142 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACV 1191



>gb:AF104918_1883939 Homo sapiens myeloid/lymphoid leukemia 2 (MLL2)
           mRNA, partial cds.
          Length = 1010

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421 CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAPFP-SSWKCPECV 549
           C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 590 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACV 639



>gb:AB032951_1866132 Homo sapiens mRNA for KIAA1125 protein, partial
           cds.
          Length = 1205

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P     ++ +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 61  IKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 120

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 121 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 149



>gb:AB002302_1863609 Homo sapiens mRNA for KIAA0304 protein, partial
           cds.
          Length = 1900

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421 CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAPFP-SSWKCPECV 549
           C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 437 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACV 486



>gb:BT008599_1639814 Arabidopsis thaliana clone U09668 unknown
           protein (At1g05380) mRNA, complete cds.
          Length = 600

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 19/57 (33%), Positives = 24/57 (42%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           D  D   D+C  CG   +L+ C+ C   YH  CL   M+      W CP C     D
Sbjct: 81  DGDDPNDDACGICGDGGDLICCDGCPSTYHQNCL--GMQVLPSGDWHCPNCTCKFCD 135



>gb:AY034984_1559764 Arabidopsis thaliana unknown protein
           (At1g05380) mRNA, partial cds.
          Length = 620

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 19/57 (33%), Positives = 24/57 (42%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           D  D   D+C  CG   +L+ C+ C   YH  CL   M+      W CP C     D
Sbjct: 101 DGDDPNDDACGICGDGGDLICCDGCPSTYHQNCL--GMQVLPSGDWHCPNCTCKFCD 155



>gb:AB015475_1512585 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMN10.
          Length = 656

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 3/59 (5%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCE 588
           C+ACG       + NCE C +  H KC   PM+     S      + P ND+ K+LDC+
Sbjct: 392 CEACGHPVEFGRIYNCEECCFILHEKCANLPMKKRLVFSTLPFLLLGPGNDVCKVLDCK 450



>gb:AY069463_1294193 Drosophila melanogaster LD18949 full length
           cDNA.
          Length = 779

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 4/87 (4%)
 Frame = +1

Query: 349 RRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSS 528
           ++GK   S   VE    P      C+       L+ C+TC   YH  CL  P+  P   S
Sbjct: 339 KQGKHSTSSASVEA--APSVSCGICKRSKDQHLLVKCDTCNLHYHLGCLNPPLTRPPKKS 396

Query: 529 ----WKCPECVSPLNDIEKILDCETRP 597
               W+C EC       + + +  + P
Sbjct: 397 KQYGWQCSECCDKSEGSDAVTEISSGP 423



>gb:HSM807170_1187825 Homo sapiens mRNA; cDNA DKFZp686L09243 (from
           clone DKFZp686L09243).
          Length = 1168

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P     ++ +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 42  IKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 101

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 102 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 130



>gb:AE014134_1127749 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127750 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003612_1217856
           Drosophila melanogaster chromosome 2L, section 21 of 83
           of the complete sequence.>gb:AE003612_1217857 Drosophila
           melanogaster chromosome 2L, section 21 of 83 of the
           complete sequence.>gb:AY095051_1298201 Drosophila
           melanogaster LD40310 full insert cDNA.
          Length = 1838

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GD--ENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C  C  GD  E++L C+ C  +YH  CLL P+ +     W CP CV
Sbjct: 451 CHICNRGDVEESMLLCDGCDDSYHTFCLLPPLTSIPKGEWLCPRCV 496



>gb:AE014134_1127490 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003576_1216140 Drosophila melanogaster
           chromosome 2L, section 15 of 83 of the complete
           sequence.
          Length = 1008

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 23/87 (26%), Positives = 34/87 (39%), Gaps = 4/87 (4%)
 Frame = +1

Query: 349 RRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSS 528
           ++GK   S   VE    P      C+       L+ C+TC   YH  CL  P+  P   S
Sbjct: 568 KQGKHSTSSASVEA--APSVSCGICKRSKDQHLLVKCDTCNLHYHLGCLNPPLTRPPKKS 625

Query: 529 ----WKCPECVSPLNDIEKILDCETRP 597
               W+C EC       + + +  + P
Sbjct: 626 KQYGWQCSECCDKSEGSDAVTEISSGP 652



>gb:AE005172_889562 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC005106_1532173 Genomic sequence
           for Arabidopsis thaliana BAC T25N20 from chromosome I,
           complete sequence.
          Length = 1138

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 19/57 (33%), Positives = 24/57 (42%)
 Frame = +1

Query: 394 DRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLND 564
           D  D   D+C  CG   +L+ C+ C   YH  CL   M+      W CP C     D
Sbjct: 619 DGDDPNDDACGICGDGGDLICCDGCPSTYHQNCL--GMQVLPSGDWHCPNCTCKFCD 673



>pir|H96684|H96684 probable RING zinc finger protein F15E12.8
           [imported] - Arabidopsis thaliana>gb:AE005173_894252
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539637 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.
          Length = 622

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVTPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59



>sp|Q9ULU4|PKCB_HUMAN Protein kinase C binding protein 1 (Rack7)
           (Cutaneous T-cell lymphoma associated antigen se14-3)
           (CTCL tumor antigen se14-3) (Zinc finger MYND domain
           containing protein 8).>gb:AL390212_1926546 Human DNA
           sequence from clone RP1-29M10 on chromosome 20 Contains
           part of the PRKCBP1 gene for protein kinase C binding
           protein 1, ESTs, GSSs and a CpG island, complete
           sequence.>gb:HS569M23_1999073 Human DNA sequence from
           clone RP4-569M23 on chromosome 20q12-13.1 Contains the
           PRKCBP1 gene for protein kinase C binding protein 1, a
           putative novel gene, ESTs, STSs and GSSs, complete
           sequence.>gb:HSJ890O15_2016621 Human DNA sequence from
           clone RP5-890O15 on chromosome 20, complete sequence.
          Length = 1186

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P     ++ +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 42  IKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 101

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 102 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 130



>sp|Q9UMN6|MLL4_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
            protein 4 (Trithorax homolog 2).>gb:HSA7041_2009859 Homo
            sapiens mRNA for trithorax homologue 2.
          Length = 2715

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421  CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAPFP-SSWKCPECV 549
            C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 1252 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACV 1301



>sp|O43918|AIRE_HUMAN Autoimmune regulator (Autoimmune
           polyendocrinopathy candidiasis ectodermal dystrophy
           protein) (APECED protein).>gb:AB006682_1863861 Homo
           sapiens APECED mRNA for AIRE-1, complete
           cds.>gb:AB006684_1863863 Homo sapiens APECED gene for
           AIRE-1, AIRE-2, AIRE-3, complete
           cds.>gb:AP001754_1933561 Homo sapiens genomic DNA,
           chromosome 21q, section 98/105.>gb:HSAPECED_2010587 Homo
           Sapiens mRNA for AIRE protein.
          Length = 545

 Score = 40.8 bits (94), Expect = 0.030
 Identities = 20/72 (27%), Positives = 30/72 (41%), Gaps = 3/72 (4%)
 Frame = +1

Query: 343 DIRRGKSGPSQEPVERFDRPDA---KVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           + R G+ G    P+     P       D C  C     L+ C+ C  A+H  CL  P+R 
Sbjct: 270 EARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLRE 329

Query: 514 PFPSSWKCPECV 549
               +W+C  C+
Sbjct: 330 IPSGTWRCSSCL 341



>gb:BC087250_2565106 Xenopus laevis hypothetical LOC495907, mRNA
           (cDNA clone MGC:98573 IMAGE:7199404), complete cds.
          Length = 516

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P      + +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 61  IKKKKKPGLLNSSNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 120

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 121 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 149



>gb:BC058064_2552252 Danio rerio protein kinase C binding protein 1,
           like, mRNA (cDNA clone MGC:63775 IMAGE:2642736),
           complete cds.
          Length = 1111

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 6/82 (7%)
 Frame = +1

Query: 319 LDDSDDEADIRRGKSGPSQEPVERFDRPDAKVDS------CQACGGDENLLNCETCTYAY 480
           ++ + D+ ++R G     ++P    D  D           C  C  +  +L CE C   Y
Sbjct: 51  VNSNKDQCELRHGPFYYVKQPALTTDPVDVVPQDGRNDFYCWVCHREGQVLCCELCPRVY 110

Query: 481 HPKCLLQPMRAPFPSSWKCPEC 546
           H KCL   + A     W CPEC
Sbjct: 111 HAKCL--KLAAEPEGDWFCPEC 130



>gb:BC065123_2105542 Mus musculus cDNA sequence BC065123, mRNA (cDNA
           clone IMAGE:30536990), partial cds.
          Length = 892

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           +A+   C+  G  EN++ C+ C   +H  C+   ++A     W CPEC        + L 
Sbjct: 486 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPECRP--KQRSRRLS 543

Query: 583 CETRPTIADDSD 618
              RP++  D +
Sbjct: 544 SRQRPSLESDEE 555



>gb:BC056344_2102322 Mus musculus cDNA clone IMAGE:5704432, partial
           cds.
          Length = 2013

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421 CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAP-FPSSWKCPECV 549
           C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 549 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACV 598



>gb:BC048186_2099580 Mus musculus protein kinase C binding protein
           1, mRNA (cDNA clone MGC:61398 IMAGE:6827541), complete
           cds.
          Length = 1255

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P      + +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 66  IKKKKKPGLLNSSNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 125

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 126 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 154



>gb:BC043080_2098814 Mus musculus PHD finger protein 12, mRNA (cDNA
           clone MGC:57991 IMAGE:6400617), complete cds.
          Length = 999

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 334 DEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           DEA+ R  K  P +E   R        DSC +C    +LL C+ C  A+H +C   P+  
Sbjct: 30  DEAEKRSRK--PEKE--SRRSGRATNHDSCDSCKEGGDLLCCDHCPAAFHLQCCNPPLSE 85

Query: 514 PF--PSSWKCPECV---------SPLNDIEKILDCETRPTIADDSDASKL 630
               P  W C  C            L  +  ++D  ++ T +  SD   L
Sbjct: 86  EMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSSKRTTSPSSDTDLL 135



 Score = 33.5 bits (75), Expect = 4.7
 Identities = 25/105 (23%), Positives = 41/105 (39%)
 Frame = +1

Query: 448 LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDASK 627
           L+ C+ C   +H  CL  P+ A     W CP  +  +   +K L    R  + D      
Sbjct: 282 LIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNLTLSNRCQVFD------ 335

Query: 628 LGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKV 762
               Q  + Q++VK    + +H    P     +  Q++ R   KV
Sbjct: 336 --RFQDTISQHVVKVDFLNRIHKKHPPNR---RVLQSVKRRSLKV 375



>gb:AL669840_2072479 Mouse DNA sequence from clone RP23-43J1 on
           chromosome 11, complete sequence.>gb:AL845484_2073118
           Mouse DNA sequence from clone RP23-336L14 on chromosome
           11 Contains the 3' end of the Sez6 gene for seizure
           related gene 6, complete sequence.
          Length = 788

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 334 DEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           DEA+ R  K  P +E   R        DSC +C    +LL C+ C  A+H +C   P+  
Sbjct: 34  DEAEKRSRK--PEKE--SRRSGRATNHDSCDSCKEGGDLLCCDHCPAAFHLQCCNPPLSE 89

Query: 514 PF--PSSWKCPECV---------SPLNDIEKILDCETRPTIADDSDASKL 630
               P  W C  C            L  +  ++D  ++ T +  SD   L
Sbjct: 90  EMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSSKRTTSPSSDTDLL 139



 Score = 33.5 bits (75), Expect = 4.7
 Identities = 25/105 (23%), Positives = 41/105 (39%)
 Frame = +1

Query: 448 LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDASK 627
           L+ C+ C   +H  CL  P+ A     W CP  +  +   +K L    R  + D      
Sbjct: 286 LIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNLTLSNRCQVFD------ 339

Query: 628 LGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKV 762
               Q  + Q++VK    + +H    P     +  Q++ R   KV
Sbjct: 340 --RFQDTISQHVVKVDFLNRIHKKHPPNR---RVLQSVKRRSLKV 379



>gb:AL669840_2072478 Mouse DNA sequence from clone RP23-43J1 on
           chromosome 11, complete sequence.>gb:AL845484_2073119
           Mouse DNA sequence from clone RP23-336L14 on chromosome
           11 Contains the 3' end of the Sez6 gene for seizure
           related gene 6, complete sequence.
          Length = 1003

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 30/110 (27%), Positives = 44/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 334 DEADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRA 513
           DEA+ R  K  P +E   R        DSC +C    +LL C+ C  A+H +C   P+  
Sbjct: 34  DEAEKRSRK--PEKE--SRRSGRATNHDSCDSCKEGGDLLCCDHCPAAFHLQCCNPPLSE 89

Query: 514 PF--PSSWKCPECV---------SPLNDIEKILDCETRPTIADDSDASKL 630
               P  W C  C            L  +  ++D  ++ T +  SD   L
Sbjct: 90  EMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSSKRTTSPSSDTDLL 139



 Score = 33.5 bits (75), Expect = 4.7
 Identities = 25/105 (23%), Positives = 41/105 (39%)
 Frame = +1

Query: 448 LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRPTIADDSDASK 627
           L+ C+ C   +H  CL  P+ A     W CP  +  +   +K L    R  + D      
Sbjct: 286 LIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNLTLSNRCQVFD------ 339

Query: 628 LGSKQIFVKQYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKV 762
               Q  + Q++VK    + +H    P     +  Q++ R   KV
Sbjct: 340 --RFQDTISQHVVKVDFLNRIHKKHPPNR---RVLQSVKRRSLKV 379



>gb:AB182318_2049738 Mus musculus Mll2 mRNA for mixed lineage leukemia
            2, complete cds.
          Length = 2713

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421  CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAP-FPSSWKCPECV 549
            C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 1258 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACV 1307



>gb:AB093284_2048069 Mus musculus mRNA for mKIAA1125 protein.
          Length = 1253

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 5/91 (5%)
 Frame = +1

Query: 289 VRSDRRPVYNLDDSDDEADIRRG-----KSGPSQEPVERFDRPDAKVDSCQACGGDENLL 453
           ++  ++P      + +++++R G     K   + +PV+   +       C  C  +  +L
Sbjct: 64  IKKKKKPGLLNSSNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQVL 123

Query: 454 NCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
            CE C   YH KCL   + +     W CPEC
Sbjct: 124 CCELCPRVYHAKCL--RLTSEPEGDWFCPEC 152



>gb:AB093223_2048008 Mus musculus mRNA for mKIAA0304 protein.
          Length = 1744

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 22/50 (44%), Positives = 25/50 (50%), Gaps = 7/50 (14%)
 Frame = +1

Query: 421 CQACG----GDENLLNCETCTYAYHPKCL--LQPMRAP-FPSSWKCPECV 549
           C  CG    G ++LL CE C +AYHP CL    P RA      W C  CV
Sbjct: 307 CHVCGRKGRGSKHLLECERCRHAYHPACLGPSYPTRATRRRRHWICSACV 356



>gb:AF221130_1890779 Homo sapiens chromatin remodeling factor WCRF180
            mRNA, complete cds.
          Length = 1556

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
            +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC        + L 
Sbjct: 1148 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP--KQRSRRLS 1205

Query: 583  CETRPTIADDSD 618
               RP++  D D
Sbjct: 1206 SRQRPSLESDED 1217



>gb:AB006684_1863865 Homo sapiens APECED gene for AIRE-1, AIRE-2,
           AIRE-3, complete cds.>gb:AB006685_1863866 Homo sapiens
           APECED mRNA for AIRE-3, complete cds.
          Length = 254

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           D C  C     L+ C+ C  A+H  CL  P+R     +W+C  C+
Sbjct: 100 DECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL 144



>gb:AB006683_1863862 Homo sapiens APECED mRNA for AIRE-2, complete
           cds.>gb:AB006684_1863864 Homo sapiens APECED gene for
           AIRE-1, AIRE-2, AIRE-3, complete cds.
          Length = 348

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           D C  C     L+ C+ C  A+H  CL  P+R     +W+C  C+
Sbjct: 100 DECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCL 144



>gb:AP003508_1830068 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0470C02.
          Length = 814

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
 Frame = +1

Query: 394 DRPDAKVDSCQAC--GGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D  D + + C+ C   G   ++ C+ C   +H +C+  P+R      W CP C
Sbjct: 154 DAEDPEAEECRVCFRAGAAVMVECDVCLGGFHLRCVRPPLRRVPEGDWACPYC 206



>gb:AB037135_1519096 Oryza sativa (japonica cultivar-group) OsORC1
           mRNA for origin recognition complex 1, complete cds.
          Length = 812

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
 Frame = +1

Query: 394 DRPDAKVDSCQAC--GGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D  D + + C+ C   G   ++ C+ C   +H +C+  P+R      W CP C
Sbjct: 152 DAEDPEAEECRVCFRAGAAVMVECDVCLGGFHLRCVRPPLRRVPEGDWACPYC 204



>gb:AB016874_1512951 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K23L20.>gb:ATAC002342_1542755 Arabidopsis
           thaliana chromosome V BAC T19K24 genomic sequence,
           complete sequence.
          Length = 2228

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 6/64 (9%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC------VSPLND 564
           D     C  C    +LL C++C   YH  CL  P++      W CP+C      + P+N 
Sbjct: 58  DGNYFECVICDLGGDLLCCDSCPRTYHTACLNPPLKRIPNGKWICPKCSPNSEALKPVNR 117

Query: 565 IEKI 576
           ++ I
Sbjct: 118 LDAI 121



>gb:AX878499_1477459 Sequence 13404 from Patent EP1074617.
          Length = 475

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC        + L 
Sbjct: 67  NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP--KQRSRRLS 124

Query: 583 CETRPTIADDSD 618
              RP++  D D
Sbjct: 125 SRQRPSLESDED 136



>gb:HSM800156_1185750 Homo sapiens mRNA; cDNA DKFZp586E0518 (from
           clone DKFZp586E0518).
          Length = 811

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC        + L 
Sbjct: 403 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP--KQRSRRLS 460

Query: 583 CETRPTIADDSD 618
              RP++  D D
Sbjct: 461 SRQRPSLESDED 472



>gb:AK047427_1168102 Mus musculus 10 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:B930060C03
           product:hypothetical Bromodomain/ PHD-finger containing
           protein, full insert sequence.
          Length = 718

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 33/72 (45%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           +A+   C+  G  EN++ C+ C   +H  C+   ++A     W CPEC        + L 
Sbjct: 312 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKAVPDGDWFCPECRP--KQRSRRLS 369

Query: 583 CETRPTIADDSD 618
              RP++  D +
Sbjct: 370 SRQRPSLESDEE 381



>pir|T08738|T08738 hypothetical protein DKFZp586E0518.1 - human
           (fragment)
          Length = 811

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
           +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC        + L 
Sbjct: 403 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP--KQRSRRLS 460

Query: 583 CETRPTIADDSD 618
              RP++  D D
Sbjct: 461 SRQRPSLESDED 472



>pir|E85135|E85135 hypothetical protein AT4g12620 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV34_1545027 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           34.>gb:ATH426477_1552563 Arabidopsis thaliana mRNA for
           origin recognition complex 1b protein (orc1b
           gene).>gb:ATT1P17_1554925 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T1P17 (ESSA project).
          Length = 813

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 3/107 (2%)
 Frame = +1

Query: 286 RVRSDRRPVYNLDDSDD-EADIRRGKSGPSQEPVERFDRPDAKVDSCQAC-GGDENLL-N 456
           + +  +R  YN  + D+ E +I        +E     +  D +++ CQ C   D N++  
Sbjct: 123 KTKKKKRVYYNKVEFDETEFEIGDDVYVKRREDSNSDEEEDPEIEDCQICFKSDTNIMIE 182

Query: 457 CETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDCETRP 597
           C+ C   +H KCL  P++      W C  C    +   + LD    P
Sbjct: 183 CDDCLGGFHLKCLKPPLKEVPEGDWICQFCEVKKSGQSQTLDLPKPP 229



>sp|Q09819|YAC5_SCHPO Hypothetical protein C16C9.05 in chromosome
           I.>pir|T37778|S62475 PHD finger protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC16C9_1716641 S.pombe
           chromosome I cosmid c16C9.
          Length = 404

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 25/63 (39%), Positives = 29/63 (46%), Gaps = 5/63 (7%)
 Frame = +1

Query: 373 QEPVERFDRPDA--KVDSCQACGGDENLLNCETCTYAYHPKCL---LQPMRAPFPSSWKC 537
           Q PV+R  R      VD C ACGG    + CE C  ++H  CL   L P   P   SW C
Sbjct: 102 QTPVKRRRRKATIRNVDYCSACGGRGLFICCEGCPCSFHLSCLEPPLTPENIP-EGSWFC 160

Query: 538 PEC 546
             C
Sbjct: 161 VTC 163



>sp|Q9NRL2|BA1A_HUMAN Bromodomain adjacent to zinc finger domain
            protein 1A (ATP-utilizing chromatin assembly and
            remodeling factor 1) (hACF1) (ATP-dependent chromatin
            remodelling protein) (Williams syndrome transcription
            factor-related chromatin remodeling factor 180) (WCRF180)
            (hWALp1) (CHRAC subunit ACF1)
            (HSPC317).>gb:AF213467_1890344 Homo sapiens ATP-dependent
            chromatin remodelling protein (ACF1) mRNA, complete cds.
          Length = 1556

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
            +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC        + L 
Sbjct: 1148 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPECRP--KQRSRRLS 1205

Query: 583  CETRPTIADDSD 618
               RP++  D D
Sbjct: 1206 SRQRPSLESDED 1217



>gb:BT007800_2150732 Synthetic construct Homo sapiens chromodomain
           helicase DNA binding protein 2 mRNA, partial cds.
          Length = 502

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:MMSMCX3_2117378 M.domesticus Smcx mRNA.
          Length = 1033

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 292 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 337



>gb:BC043096_2098829 Mus musculus jumonji, AT rich interactive
           domain 1C (Rbp2 like), mRNA (cDNA clone MGC:58015
           IMAGE:6405943), complete cds.>gb:BC054550_2101755 Mus
           musculus jumonji, AT rich interactive domain 1C (Rbp2
           like), mRNA (cDNA clone MGC:62410 IMAGE:6405943),
           complete cds.
          Length = 1510

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 286 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 331



>gb:AY036886S1_2074338 Mus musculus MLL3-like protein mRNA, partial
           cds.
          Length = 420

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 47  CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 92



 Score = 33.5 bits (75), Expect = 4.7
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +1

Query: 433 GGDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           G +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 6   GAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 44



>gb:AK129096_2069327 Mus musculus mRNA for mKIAA0234 protein.
          Length = 1390

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 163 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 208



>gb:AF127245_2055525 Mus musculus Smcx (Smcx) mRNA, complete cds.
          Length = 1551

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>gb:BC054499_1985182 Homo sapiens Smcy homolog, X-linked (mouse),
           mRNA (cDNA clone MGC:57577 IMAGE:5492114), complete cds.
          Length = 1559

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 326 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 371



>gb:BC020810_1977223 Homo sapiens chromodomain helicase DNA binding
           protein 2, mRNA (cDNA clone IMAGE:4293394), complete
           cds.
          Length = 501

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:BC007347_1970662 Homo sapiens chromodomain helicase DNA binding
           protein 2, mRNA (cDNA clone IMAGE:3050321), complete
           cds.>gb:BT007050_1990488 Homo sapiens chromodomain
           helicase DNA binding protein 2 mRNA, complete cds.
          Length = 501

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:AL139396_1920695 Human DNA sequence from clone RP11-258C19 on
           chromosome Xp11.21-11.23 Contains a novel gene
           (KIAA0522), the SMCX gene for Smcx homolog X chromosome
           (mouse), an actin beta (ACTB) pseudogene, a pseudogene
           similar to part of suppressor of variegation 3-9 homolog
           2 (SUV39H2), the 3' end of a novel gene and a CpG
           island, complete sequence.
          Length = 1560

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>gb:AL139396_1920694 Human DNA sequence from clone RP11-258C19 on
           chromosome Xp11.21-11.23 Contains a novel gene
           (KIAA0522), the SMCX gene for Smcx homolog X chromosome
           (mouse), an actin beta (ACTB) pseudogene, a pseudogene
           similar to part of suppressor of variegation 3-9 homolog
           2 (SUV39H2), the 3' end of a novel gene and a CpG
           island, complete sequence.
          Length = 1557

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>gb:AL139396_1920693 Human DNA sequence from clone RP11-258C19 on
           chromosome Xp11.21-11.23 Contains a novel gene
           (KIAA0522), the SMCX gene for Smcx homolog X chromosome
           (mouse), an actin beta (ACTB) pseudogene, a pseudogene
           similar to part of suppressor of variegation 3-9 homolog
           2 (SUV39H2), the 3' end of a novel gene and a CpG
           island, complete sequence.
          Length = 1516

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 286 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 331



>gb:AF264750_1893756 Homo sapiens ALR-like protein mRNA, complete
           cds.
          Length = 4025

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 71  CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 116



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)
 Frame = +1

Query: 415 DSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 19  DMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 68



>gb:AC006474_1875155 Homo sapiens PAC clone RP4-669I17 from 7,
           complete sequence.
          Length = 2185

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 71  CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 116



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)
 Frame = +1

Query: 415 DSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 19  DMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 68



>gb:AB040939_1866868 Homo sapiens mRNA for KIAA1506 protein, partial
           cds.
          Length = 3310

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACGGDEN---LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ACG   +   LL C+ C  +YH  CL  P++      WKC  CV
Sbjct: 455 CEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCV 500



 Score = 35.4 bits (80), Expect = 1.2
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 6/50 (12%)
 Frame = +1

Query: 415 DSCQACGG-----DENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPEC 546
           D C  CG      +  LL C  C   YHP C+ ++  +      W+C EC
Sbjct: 403 DMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLEC 452



>gb:AB032252_1866047 Homo sapiens BAZ1A mRNA for bromodomain adjacent
            to zinc finger domain 1A, complete cds.
          Length = 1674

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/72 (27%), Positives = 33/72 (45%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILD 582
            +A+   C+  G  EN++ C+ C   +H  C+   ++      W CPEC  P     + L 
Sbjct: 1266 NARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDWFCPEC-RPKQRCRR-LS 1323

Query: 583  CETRPTIADDSD 618
               RP++  D D
Sbjct: 1324 FRQRPSLESDED 1335



>gb:AP000366_1819727 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0437H03.>gb:AP005785_1857830 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0453H10.
          Length = 929

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG---GDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ CG    D+++L C+ C   YH  CL  P+      +W CP C+
Sbjct: 61  CKVCGIDRDDDSVLLCDKCDSEYHTYCLNPPLARIPEGNWYCPSCM 106



>gb:AK175694_1817682 Arabidopsis thaliana mRNA for hypothetical
           protein, complete cds, clone:
           RAFL22-22-C10.>gb:AK175887_1817875 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL22-52-O07.>gb:AK176012_1818000 Arabidopsis thaliana
           mRNA for hypothetical protein, complete cds, clone:
           RAFL22-71-G21.
          Length = 623

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVNPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59



>gb:BT010568_1640514 Arabidopsis thaliana At1g66050 gene, complete
           cds.
          Length = 615

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVNPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59



>gb:AY088087_1573111 Arabidopsis thaliana clone 41104 mRNA, complete
           sequence.>gb:BT006199_1639091 Arabidopsis thaliana
           At1g14510 mRNA, complete cds.
          Length = 252

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)
 Frame = +1

Query: 394 DRPDAKVDSCQACG----GDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPECVS 552
           D  D +   C ACG    GDE  + C+ C   +H KC+ + P +A     +KCP C +
Sbjct: 189 DEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSCTT 246



>gb:AF132069_1414620 Sus scrofa SMCX (SMCX) mRNA, partial cds.
          Length = 316

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 264 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 309



>gb:AF314193_1261649 Drosophila melanogaster Toutatis (tou) gene,
            complete cds.
          Length = 3109

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 27/97 (27%), Positives = 37/97 (38%), Gaps = 7/97 (7%)
 Frame = +1

Query: 316  NLDDSDDEADIRRGKSGPSQEPVERFDRPDAK----VDSCQACGGDEN---LLNCETCTY 474
            N  DSD +   R  K    +      +   +K    + +CQ C   EN   LL C+ C  
Sbjct: 2551 NTSDSDSDFGKRTKKKSGGKRRRSANNTNSSKYSNSLQNCQFCTSGENEDKLLLCDGCDK 2610

Query: 475  AYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
             YH  C    M       W C ECV+   +  K + C
Sbjct: 2611 GYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVC 2647



 Score = 36.2 bits (82), Expect = 0.73
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 5/49 (10%)
 Frame = +1

Query: 421  CQACGGDE-----NLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
            C  CGG        ++ C+ C  AYH  C + P+       W C  C+S
Sbjct: 2644 CIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCIS 2692



>gb:CR859025_1183165 Pongo pygmaeus mRNA; cDNA DKFZp468O0728 (from
           clone DKFZp468O0728).
          Length = 1259

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>gb:CR858251_1182436 Pongo pygmaeus mRNA; cDNA DKFZp469E1718 (from
           clone DKFZp469E1718).
          Length = 614

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:CR627422_1180791 Homo sapiens mRNA; cDNA DKFZp781D1727 (from
           clone DKFZp781D1727).
          Length = 351

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:AE013599_1131296 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003825_1226390 Drosophila melanogaster
            chromosome 2R, section 25 of 74 of the complete sequence.
          Length = 3080

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 27/97 (27%), Positives = 37/97 (38%), Gaps = 7/97 (7%)
 Frame = +1

Query: 316  NLDDSDDEADIRRGKSGPSQEPVERFDRPDAK----VDSCQACGGDEN---LLNCETCTY 474
            N  DSD +   R  K    +      +   +K    + +CQ C   EN   LL C+ C  
Sbjct: 2551 NTSDSDSDFGKRTKKKSGGKRRRSANNTNSSKYSNSLQNCQFCTSGENEDKLLLCDGCDK 2610

Query: 475  AYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKILDC 585
             YH  C    M       W C ECV+   +  K + C
Sbjct: 2611 GYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVC 2647



 Score = 36.2 bits (82), Expect = 0.73
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 5/49 (10%)
 Frame = +1

Query: 421  CQACGGDE-----NLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVS 552
            C  CGG        ++ C+ C  AYH  C + P+       W C  C+S
Sbjct: 2644 CIVCGGHRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCIS 2692



>pir|A96685|A96685 probable RING zinc finger protein F15E12.5
           [imported] - Arabidopsis thaliana>gb:AE005173_894253
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539638 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.
          Length = 598

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVNPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59



>pir|A86280|A86280 F14L17.29 protein - Arabidopsis
           thaliana>gb:AE005172_890445 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F14L17_1677470 Sequence of BAC F14L17 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 273

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 5/58 (8%)
 Frame = +1

Query: 394 DRPDAKVDSCQACG----GDENLLNCETCTYAYHPKCL-LQPMRAPFPSSWKCPECVS 552
           D  D +   C ACG    GDE  + C+ C   +H KC+ + P +A     +KCP C +
Sbjct: 210 DEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSCTT 267



>pir|I48775|I48775 Smcx protein (escapes X-chromosome inactivation)
           - mouse  (fragment)
          Length = 1033

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 292 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 337



>sp|Q09698|YA27_SCHPO Hypothetical protein C2F7.07c in chromosome
           I.>pir|T38555|S58151 hypothetical protein SPAC2F7.07c -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC2F7_1717620 S.pombe chromosome I cosmid
           c2F7.
          Length = 607

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 2/46 (4%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPF--PSSWKCPEC 546
           D C AC G  N L CETC  ++H  C+  P+        +W C EC
Sbjct: 264 DYCSACHGPGNFLCCETCPNSFHFTCIDPPIEEKNLPDDAWYCNEC 309



 Score = 33.9 bits (76), Expect = 3.6
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%)
 Frame = +1

Query: 442 ENLLNCETCTYAYHPKCLLQPMRAPFPSS---WKCP 540
           +++L C+ C   +HP CL  P+ A  PS+   WKCP
Sbjct: 420 QSILACDYCNSYWHPDCLNPPL-ATLPSNLRKWKCP 454



>sp|P41230|JD1C_MOUSE Jumonji/ARID domain-containing protein 1C
           (SmcX protein) (Xe169 protein).
          Length = 1554

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>sp|P41229|JD1C_HUMAN Jumonji/ARID domain-containing protein 1C
           (SmcX protein) (Xe169 protein).>pir|I54361|I54361 SMCX
           protein - human>gb:HUMXE169A_2038178 Human XE169 mRNA,
           complete cds.
          Length = 1560

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+CV
Sbjct: 327 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPKGVWRCPKCV 372



>sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2
           (CHD-2).>gb:AF006514_1876019 Homo sapiens CHD2 mRNA,
           complete cds.
          Length = 1739

 Score = 40.0 bits (92), Expect = 0.051
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPENEFVKAYQTLPRLKTKVNNFHRQ 780
           QYL+KWKG+SY+HS+W  E+E     Q +  LK K+ NF ++
Sbjct: 306 QYLIKWKGWSYIHSTW--ESEESLQQQKVKGLK-KLENFKKK 344



>gb:AK176778_1818766 Arabidopsis thaliana mRNA for zinc finger-like
           protein, complete cds, clone: RAFL25-32-I19.
          Length = 617

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVNPPSEETLTCGTCVTPWHVPCLLPESLASSTGEWECPDC 59



>gb:AC137623_1743703 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0426G01, complete sequence.
          Length = 258

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = +1

Query: 358 KSGPSQEPVERFDRPDAKVDSCQACGG-DENLLNCETCTYAYHPKCL-LQPMRAPFPSSW 531
           +SG      E  +R +    SC    G DE  + C++C   YH KC+ + P RA     +
Sbjct: 187 ESGDEYADEEEEERDNTLCGSCGTNDGKDEFWICCDSCERWYHGKCVKITPARAEHIKHY 246

Query: 532 KCPEC 546
           KCP+C
Sbjct: 247 KCPDC 251



>gb:AB012243_1511731 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIJ24.>gb:BT010573_1640519 Arabidopsis thaliana
           At5g39550 gene, complete cds.
          Length = 617

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +1

Query: 421 CQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           CQ     E  L C TC   +H  CLL    A     W+CP+C
Sbjct: 18  CQVNPPSEETLTCGTCVTPWHVPCLLPESLASSTGEWECPDC 59



>gb:AB005241_1509494 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOP10.>gb:AY084560_1569649 Arabidopsis thaliana
           clone 111750 mRNA, complete
           sequence.>gb:AK176462_1818450 Arabidopsis thaliana mRNA
           for nucleic acid binding protein-like, complete cds,
           clone: RAFL24-25-C05.>gb:AK176806_1818794 Arabidopsis
           thaliana mRNA for nucleic acid binding protein-like,
           complete cds, clone: RAFL25-35-H08.
          Length = 241

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 6/69 (8%)
 Frame = +1

Query: 358 KSGPSQEPVERFDRPDAKVDS-CQACGG----DENLLNCETCTYAYHPKCL-LQPMRAPF 519
           KS P        D  D   D+ C +CGG    DE  + C+ C   YH KC+ + P +A  
Sbjct: 166 KSTPKLMEESYEDEDDEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAES 225

Query: 520 PSSWKCPEC 546
              +KCP C
Sbjct: 226 IKQYKCPSC 234



>gb:AK037737_1164907 Mus musculus 16 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A130044E01
           product:bromodomain adjacent to zinc finger domain, 1B,
           full insert sequence.
          Length = 657

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 403 DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP 555
           +A+   C+  G D+ L+ C+ C  A+H  CL   +       W+CP C  P
Sbjct: 362 NARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPP 412



>sp|Q9Z277|BA1B_MOUSE Bromodomain adjacent to zinc finger domain
            protein 1B (Williams-Beuren syndrome chromosome region 9
            protein homolog) (WBRS9).>pir|T17401|T17401 transcription
            regulator WBSCR9 - mouse>gb:AF084480_2053926 Mus musculus
            Williams-Beuren syndrome deletion transcript 9 homolog
            (Wbscr9) mRNA, complete cds.
          Length = 1479

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +1

Query: 403  DAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSP 555
            +A+   C+  G D+ L+ C+ C  A+H  CL   +       W+CP C  P
Sbjct: 1184 NARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPP 1234



>gb:MMSMCY4_2117379 M.musculus (BALB/C) Smcy gene.
          Length = 564

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDE--NLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE    L C+ C+  YH  CLL P+       W+CP+C+
Sbjct: 304 CRICSRGDEVDKFLLCDGCSDNYHIFCLLPPLSEVPKGVWRCPKCI 349



>gb:AL596125_2070890 Mouse DNA sequence from clone RP23-5O23 on
           chromosome 11 Contains the Chd3 gene for chromodomain
           helicase DNA binding protein 3, five novel genes, the 3'
           end of the gene for a novel protein similar to dynein
           and four CpG islands, complete sequence.
          Length = 151

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +1

Query: 415 DSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           D C+ C     ++ C+TC  AYH  CL   +       W CP C
Sbjct: 85  DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHC 128



>gb:HSU26311_2023023 Human heterochromatin protein HP1Hs-alpha mRNA,
           partial cds.
          Length = 190

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 16/64 (25%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPE---------NEFVKAYQTL-------PRLKTKVNNFHRQMS 786
           +YL+KWKGFS  H++W PE         +EF+K Y+ +       PR K++ N      S
Sbjct: 35  EYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFS 94

Query: 787 SMTD 798
           +  D
Sbjct: 95  NSAD 98



>gb:CR457418_1993625 Homo sapiens full open reading frame cDNA clone
           RZPDo834G1110D for gene CBX5, chromobox homolog 5 (HP1
           alpha homolog, Drosophila); complete cds, incl.
           stopcodon.
          Length = 191

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 16/64 (25%)
 Frame = +1

Query: 655 QYLVKWKGFSYLHSSWVPE---------NEFVKAYQTL-------PRLKTKVNNFHRQMS 786
           +YL+KWKGFS  H++W PE         +EF+K Y+ +       PR K++ N      S
Sbjct: 36  EYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFS 95

Query: 787 SMTD 798
           +  D
Sbjct: 96  NSAD 99



>gb:AP004885_1846609 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0575F10.
          Length = 361

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 6/75 (8%)
 Frame = +1

Query: 349 RRGKSGPSQEPVERFDRPDAKVDS--CQACGGDEN---LLNCETCTYAYHPKCLLQPMRA 513
           RR ++ P+    E     D   D   C+ACG  E+   LL C+ C    H  CL +P+  
Sbjct: 9   RRTRARPAATRAEGGSGGDGDDDDVRCEACGSGESAAELLLCDGCDRGLHIFCL-RPILP 67

Query: 514 PFPSS-WKCPECVSP 555
             P+  W CP C SP
Sbjct: 68  RVPAGDWFCPSCASP 82



>gb:AF417481_1798280 Zea mays origin recognition complex subunit 1
           (orc1) mRNA, complete cds.
          Length = 810

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = +1

Query: 301 RRPVYNLDDSD--DEADIRRGKSGPSQEPVERFDRPDAKVDSCQAC--GGDENLLNCETC 468
           R+ VY+  + +  D+  ++R ++  S       D  D + + C+ C   G   ++ C+ C
Sbjct: 119 RKVVYDGGEFEVGDDVYVKRREAAES-------DAEDPEEEECRVCFRTGGGVMVECDAC 171

Query: 469 TYAYHPKCLLQPMRAPFPSSWKCPEC 546
              +H +C+  P+R      W CP C
Sbjct: 172 LGGFHLRCVRPPLRRVPEGDWACPYC 197



>gb:AE017349_1758734 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 518

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%)
 Frame = +1

Query: 421 CQACGGDENL---LNCETCTYAYHPKCLLQPMRAPFPSSWKCPEC 546
           C  C  D      L CE C   YH  CL  P+ A     W CPEC
Sbjct: 391 CLVCNTDHEQDAPLECERCDQPYHIGCLSPPLSAVPEGEWFCPEC 435



>gb:OSJN00099_1694895 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0020J19, complete sequence.
          Length = 1566

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 3/80 (3%)
 Frame = +1

Query: 340  ADIRRGKSGPSQEPVERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQ---PMR 510
            A+    K   S   VE  D  D   D+C  CG    LL C+ C   YH  CL     P  
Sbjct: 1004 AEFLSRKCDASGRKVEAMDEND---DTCGFCGDGGELLCCDNCPSTYHQTCLSDQELPEG 1060

Query: 511  APFPSSWKCPECVSPLNDIE 570
            + +  +  C  C +PL++ E
Sbjct: 1061 SWYCHNCTCRSCGNPLSEKE 1080



>gb:ECU52364_1439782 Equus caballus SMCY mRNA, partial cds.
          Length = 345

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDEN--LLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE+  LL C+ C   YH  CLL P+       W+CP+C+
Sbjct: 286 CRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPEIPRGVWRCPKCI 331



>gb:AC006661_1203584 Caenorhabditis elegans fosmid H20J04, complete
            sequence.
          Length = 1427

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 20/82 (24%), Positives = 33/82 (40%)
 Frame = +1

Query: 397  RPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECVSPLNDIEKI 576
            R   K  SC+      +L+ C  C   YH KC    + +  P+ W C  C +    +E  
Sbjct: 1110 RLQGKCRSCRRKAAAHDLVLCSECDNCYHLKCAKLDVNSDAPADWMCTSCRAQQRKVEN- 1168

Query: 577  LDCETRPTIADDSDASKLGSKQ 642
               E +    DD   ++  S++
Sbjct: 1169 ---EAKRMARDDDQLAESSSQE 1187



>gb:AK047790_1168204 Mus musculus adult male corpus striatum cDNA,
           RIKEN full-length enriched library, clone:C030040N04
           product:selected mouse cDNA on the Y, full insert
           sequence.
          Length = 476

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 3/46 (6%)
 Frame = +1

Query: 421 CQACG-GDE--NLLNCETCTYAYHPKCLLQPMRAPFPSSWKCPECV 549
           C+ C  GDE    L C+ C+  YH  CLL P+       W+CP+C+
Sbjct: 326 CRICSRGDEVDKFLLCDGCSDNYHIFCLLPPLSEVPKGVWRCPKCI 371



>pir|D96660|D96660 protein F2K11.14 [imported] - Arabidopsis
           thaliana>gb:AE005173_894016 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008047_1536501 Genomic sequence for
           Arabidopsis thaliana BAC F2K11 from chromosome I,
           complete sequence.
          Length = 1518

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = +1

Query: 328 SDDEADIRRGKSGPSQEP-VERFDRPDAKVDSCQACGGDENLLNCETCTYAYHPKCLLQP 504
           S+  +  RR ++   + P VE  +  D   + C++    E +L C++C   +H  CL  P
Sbjct: 213 SESRSSKRRKRNADVKNPKVENEEGVDQACEQCKSDKHGEVMLLCDSCNKGWHIYCLSPP 272

Query: 505 MRAPFPSSWKCPECVS 552
           ++     +W C EC++
Sbjct: 273 LKHIPLGNWYCLECLN 288


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 815,356,834
Number of Sequences: 1806583
Number of extensions: 17209714
Number of successful extensions: 45753
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 43860
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45646
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)