BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3113
         (843 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T48054|T48054 hypothetical protein F26K9.80 - Arabidopsis th...    96   8e-19   Arabidopsis thaliana [mouse-ear cress]
gb:BT015062_1642032 Arabidopsis thaliana At2g47485 gene, complet...    86   1e-15   
pir|T00435|T00435 probable mitochondrial carrier protein [import...    86   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP007204_1863215 Oryza sativa (japonica cultivar-group) genom...    69   9e-11   
gb:AY642688_1619111 Fragaria x ananassa probable mitochondrial c...    51   2e-05   
gb:AC098571_1736746 Oryza sativa (japonica cultivar-group) chrom...    44   0.005   
gb:AP002031_1821469 Arabidopsis thaliana genomic DNA, chromosome...    21   1.1     
gb:CEC09G5_1360293 Caenorhabditis elegans cosmid C09G5, complete...    35   1.4     
sp|Q09457|YQ36_CAEEL|YQ36_CAEEL Putative cuticle collagen C09G5.6.>pir|T191...    35   1.4     Caenorhabditis elegans [roundworm]
gb:AY548484_2360018 Frog virus 3, complete genome.                     34   3.0     
gb:AF186605_1888632 Homo sapiens MLL2 protein mRNA, partial cds.       34   3.0     
sp|Q9UMN6|MLL4_HUMAN|MLL4_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    34   3.0     Homo sapiens [man]
gb:AC130729_1740925 Oryza sativa (japonica cultivar-group) chrom...    34   4.0     
gb:CR382126_1658535 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   6.8     


>pir|T48054|T48054 hypothetical protein F26K9.80 - Arabidopsis
           thaliana>gb:ATF26K9_1550112 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F26K9.>gb:AY054562_1563216
           Arabidopsis thaliana putative protein (At3g62650;
           F26K9_80) mRNA, complete cds.>gb:AY064642_1566093
           Arabidopsis thaliana putative protein (At3g62650;
           F26K9_80) mRNA, complete cds.
          Length = 152

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 60/142 (42%), Positives = 82/142 (57%), Gaps = 9/142 (6%)
 Frame = +3

Query: 144 KQYWKTKRKGYERIS---------RGGRRRKFDTGDGASGRKKPSWRIKLTPKIKLNFNL 296
           K+YW+  R GYE++          R G+R K D       RKK  WRIK+ PK+++    
Sbjct: 6   KRYWRRWR-GYEKLDGSSETTSGRRKGKRVKMDPT-----RKKRFWRIKIVPKLRILKTA 59

Query: 297 RFSPKKLLIRLRNAYVNMMLRIANTRVIXXXXXXXXXXFSGDTVASFGARPLKEYDERML 476
             SPKK L+ LR++YV MM+R+AN+RV+           SG   + FG+  +KEYDE+ML
Sbjct: 60  --SPKKFLVWLRDSYVKMMMRLANSRVVGS---------SGYGGSGFGSGQMKEYDEKML 108

Query: 477 VQIYKSMLAAHGQTQLVPRDAP 542
           V+IYKS+L    Q  LV RD P
Sbjct: 109 VEIYKSILMVQAQGNLVHRDTP 130



>gb:BT015062_1642032 Arabidopsis thaliana At2g47485 gene, complete
           cds.>gb:BT015657_1642275 Arabidopsis thaliana At2g47485
           gene, complete cds.
          Length = 141

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 58/137 (42%), Positives = 78/137 (56%), Gaps = 5/137 (3%)
 Frame = +3

Query: 147 QYWKTKRKGYERISRGGR-----RRKFDTGDGASGRKKPSWRIKLTPKIKLNFNLRFSPK 311
           +YW+  R GY+R+    +     RR          RK+  WRIK+ PK+++    + SPK
Sbjct: 4   RYWRRLR-GYQRLDGSAKKASSGRRNVKRVKMDPTRKRRFWRIKIVPKLRIL--KKASPK 60

Query: 312 KLLIRLRNAYVNMMLRIANTRVIXXXXXXXXXXFSGDTVASFGARPLKEYDERMLVQIYK 491
           KLL  LR+AYVNMMLR+AN+RV+          + G  +AS      KEYDE+ LV+IYK
Sbjct: 61  KLLTWLRDAYVNMMLRLANSRVVGSSYGYGEYGY-GSGLAS------KEYDEKKLVEIYK 113

Query: 492 SMLAAHGQTQLVPRDAP 542
           S+L A G   LV RD P
Sbjct: 114 SILMAQG--NLVHRDVP 128



>pir|T00435|T00435 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana
          Length = 447

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 58/137 (42%), Positives = 78/137 (56%), Gaps = 5/137 (3%)
 Frame = +3

Query: 147 QYWKTKRKGYERISRGGR-----RRKFDTGDGASGRKKPSWRIKLTPKIKLNFNLRFSPK 311
           +YW+  R GY+R+    +     RR          RK+  WRIK+ PK+++    + SPK
Sbjct: 4   RYWRRLR-GYQRLDGSAKKASSGRRNVKRVKMDPTRKRRFWRIKIVPKLRIL--KKASPK 60

Query: 312 KLLIRLRNAYVNMMLRIANTRVIXXXXXXXXXXFSGDTVASFGARPLKEYDERMLVQIYK 491
           KLL  LR+AYVNMMLR+AN+RV+          + G  +AS      KEYDE+ LV+IYK
Sbjct: 61  KLLTWLRDAYVNMMLRLANSRVVGSSYGYGEYGY-GSGLAS------KEYDEKKLVEIYK 113

Query: 492 SMLAAHGQTQLVPRDAP 542
           S+L A G   LV RD P
Sbjct: 114 SILMAQG--NLVHRDVP 128



>gb:AP007204_1863215 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0008D05.
          Length = 170

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 49/156 (31%), Positives = 75/156 (48%), Gaps = 16/156 (10%)
 Frame = +3

Query: 138 GIKQYWKTKRKGYERISRGGRRRKF-----DTGDGAS-----------GRKKPSWRIKLT 269
           G+K YWK   +GY R+     +R+      + G GA             R+   WR++  
Sbjct: 9   GVKAYWK--HRGYYRLDAAAAQRRAPLPTAELGGGARRGGAPAQEPRRARRHRGWRVR-- 64

Query: 270 PKIKLNFNLRFSPKKLLIRLRNAYVNMMLRIANTRVIXXXXXXXXXXFSGDTVASFGARP 449
             +        SP++ L+RLR+AYV+ MLR+A++  +             ++ A    R 
Sbjct: 65  HGLGRRVLRALSPRRWLVRLRDAYVSAMLRLASSPAVGFGAGAPYCTAGQESFAR--PRQ 122

Query: 450 LKEYDERMLVQIYKSMLAAHGQTQLVPRDAPPRIAT 557
           LKEYDE++LV+IY+S+LA  G    VP   P   AT
Sbjct: 123 LKEYDEKVLVEIYRSILARGGVPVAVPAGGPAATAT 158



>gb:AY642688_1619111 Fragaria x ananassa probable mitochondrial
           carrier protein mRNA, partial cds.
          Length = 70

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 3/81 (3%)
 Frame = +3

Query: 216 TGDGASGRKKPSWR--IKLTPKIKLNFNLRFS-PKKLLIRLRNAYVNMMLRIANTRVIXX 386
           +G+G   +++  WR  IKL+PK+KL     F  PKK L+ LR+AYV++M+R AN+RV   
Sbjct: 1   SGNGNGKKRRRVWRRRIKLSPKLKLRI---FPWPKKFLVWLRDAYVSLMMRFANSRVFTT 57

Query: 387 XXXXXXXXFSGDTVASFGARP 449
                     G    SFG RP
Sbjct: 58  SY--------GGHEGSFGTRP 70



>gb:AC098571_1736746 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete sequence.
          Length = 176

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 36/151 (23%), Positives = 71/151 (47%), Gaps = 11/151 (7%)
 Frame = +3

Query: 108 MEGVSVNVYNGIKQYWKTKRKGYERI--SRGGRRRKFDTGDGASGRKKPSWRIKLTPKIK 281
           +E   +    GI+ +W   R+ Y+R+  + GG + +     G + R    W ++L   ++
Sbjct: 3   VEAFPIRFTRGIRSHWG--RRKYQRLEAANGGGKTRATQQLGGARRGGAGWGLRLRRLLR 60

Query: 282 LNFNLR----FSPKKLLIRLRNAYVNMMLRIANTRVIXXXXXXXXXXFSGDTVASF---G 440
           +   +      SP +LL R+R+AYV  ML ++               +            
Sbjct: 61  VRVRVARAWLSSPARLLARIRDAYVGGMLAVSRKASGMSLPNAPEGLWPRRVPRRKQLPA 120

Query: 441 ARP--LKEYDERMLVQIYKSMLAAHGQTQLV 527
           ARP  L ++++R++V+IYKS++A+   T ++
Sbjct: 121 ARPGQLTDFEQRLVVEIYKSIVASKELTTML 151



>gb:AP002031_1821469 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3D20.
          Length = 334

 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 231 PPYVYNSP 238



 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 206 PPYVYNSP 213



 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 181 PPYVYNSP 188



 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 156 PPYVYNSP 163



 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 131 PPYVYNSP 138



 Score = 20.8 bits (42), Expect(7) = 1.1
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -1

Query: 81  PPYLFNSP 58
           PPY++NSP
Sbjct: 106 PPYVYNSP 113



 Score = 20.4 bits (41), Expect(7) = 1.1
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -1

Query: 78  PYLFNSP 58
           PYLFNSP
Sbjct: 82  PYLFNSP 88



>gb:CEC09G5_1360293 Caenorhabditis elegans cosmid C09G5, complete
           sequence.
          Length = 948

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 7/92 (7%)
 Frame = +2

Query: 104 GNGRGVC*CIQRDK------AVLEDEEEGIREDKPRRPEKEV*YRRRS*RPEETVVEDKA 265
           G   G C C +R        A  +DE+ G+ E +PR  + E   R    RP +TV  +  
Sbjct: 550 GTDGGYCPCPKRSSKFDFNDAYNDDEKRGLEEHRPRGYDSE---RAEEPRPRQTVRTNTY 606

Query: 266 HAQDQAQFQ-PPIFSQKAAYSPPQRLRQHDAE 358
                A+ Q  P +   A  +PP++ R  D E
Sbjct: 607 DENSGAEHQRRPNYEPSAEVAPPRQDRYEDEE 638



>sp|Q09457|YQ36_CAEEL Putative cuticle collagen
           C09G5.6.>pir|T19140|T19140 hypothetical protein C09G5.6
           - Caenorhabditis elegans
          Length = 963

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 7/92 (7%)
 Frame = +2

Query: 104 GNGRGVC*CIQRDK------AVLEDEEEGIREDKPRRPEKEV*YRRRS*RPEETVVEDKA 265
           G   G C C +R        A  +DE+ G+ E +PR  + E   R    RP +TV  +  
Sbjct: 565 GTDGGYCPCPKRSSKFDFNDAYNDDEKRGLEEHRPRGYDSE---RAEEPRPRQTVRTNTY 621

Query: 266 HAQDQAQFQ-PPIFSQKAAYSPPQRLRQHDAE 358
                A+ Q  P +   A  +PP++ R  D E
Sbjct: 622 DENSGAEHQRRPNYEPSAEVAPPRQDRYEDEE 653



>gb:AY548484_2360018 Frog virus 3, complete genome.
          Length = 229

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 9/84 (10%)
 Frame = +2

Query: 134 QRDKAVLEDEEEGIREDKPRRPEKEV*YRRRS*RPEETVVEDK---------AHAQDQAQ 286
           + D  V E EE  + + + ++PEK V  ++   +PEE VVE +            Q++ Q
Sbjct: 94  KEDTVVSEPEEAVVEQQEKQQPEKAVVEQQEKQQPEEAVVEQQEKQQPEEAVVEQQEKQQ 153

Query: 287 FQPPIFSQKAAYSPPQRLRQHDAE 358
            +  +   +    P Q  RQ  A+
Sbjct: 154 PEEAVVESEQPEQPEQPERQQQAQ 177



>gb:AF186605_1888632 Homo sapiens MLL2 protein mRNA, partial cds.
          Length = 2605

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = +2

Query: 98  REGNGRGVC*CIQRDKAVLEDEEEGIREDKPRRPEKEV*YRRRS*RPEETVVED--KAHA 271
           R G+G+G   C ++ +  L+DEEE  +E++ +  E E        + E  V E+   A  
Sbjct: 233 RVGSGQGGSPCWKKQEQKLDDEEEEKKEEEEKDKEGEE-------KEERAVAEEMMPAAE 285

Query: 272 QDQAQFQPPIFSQKAAYSPP 331
           +++A+  PP  +  A   PP
Sbjct: 286 KEEAKLPPPPLTPPAPSPPP 305



>sp|Q9UMN6|MLL4_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
           protein 4 (Trithorax homolog 2).>gb:HSA7041_2009859 Homo
           sapiens mRNA for trithorax homologue 2.
          Length = 2715

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = +2

Query: 98  REGNGRGVC*CIQRDKAVLEDEEEGIREDKPRRPEKEV*YRRRS*RPEETVVED--KAHA 271
           R G+G+G   C ++ +  L+DEEE  +E++ +  E E        + E  V E+   A  
Sbjct: 343 RVGSGQGGSPCWKKQEQKLDDEEEEKKEEEEKDKEGEE-------KEERAVAEEMMPAAE 395

Query: 272 QDQAQFQPPIFSQKAAYSPP 331
           +++A+  PP  +  A   PP
Sbjct: 396 KEEAKLPPPPLTPPAPSPPP 415



>gb:AC130729_1740925 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668F02, complete sequence.
          Length = 985

 Score = 33.9 bits (76), Expect = 4.0
 Identities = 19/46 (41%), Positives = 27/46 (58%)
 Frame = -3

Query: 238 RPLAPSPVSNFLLRPPRLILSYPFLFVFQYCFIPLYTLTDTPSIPL 101
           RPL P   S+     PR + ++PFLFVF + F     L++ PS+PL
Sbjct: 425 RPLRPYSFSHL----PRQVFTHPFLFVFWFFF----CLSEIPSLPL 462



>gb:CR382126_1658535 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 447

 Score = 33.1 bits (74), Expect = 6.8
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +3

Query: 414 SGDTVASFGARPLKEYDERM-LVQIYKSMLAAHGQTQLVPRDAPPRIAT 557
           SG  +   G  P+  +D ++ L Q+Y+   A H  + LV ++ PP++ T
Sbjct: 193 SGYKIVDCGDIPMTPFDNKLALNQLYRGQRALHNHSSLVHKEQPPKLIT 241


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 757,144,911
Number of Sequences: 1806583
Number of extensions: 14803925
Number of successful extensions: 42072
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 40145
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42023
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 56474197762
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)