BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3058
         (862 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T52121|T52121 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal [va...   331   1e-89   Arabidopsis thaliana [mouse-ear cress]
gb:AF404404_1796728 Glycine max acyl-CoA oxidase (ACX1;2) mRNA, ...   327   2e-88   
gb:AF404403_1796727 Glycine max acyl-CoA oxidase (ACX1;1) mRNA, ...   321   1e-86   
pir|H71434|H71434 probable apetala2 domain TINY - Arabidopsis th...   306   3e-82   Arabidopsis thaliana [mouse-ear cress]
pir|G84771|G84771 probable acyl-CoA oxidase [imported] - Arabido...   305   7e-82   Arabidopsis thaliana [mouse-ear cress]
gb:AP002842_1823076 Oryza sativa (japonica cultivar-group) genom...   301   1e-80   
pir|T04418|T04418 probable acyl-CoA oxidase (EC 1.3.3.6), peroxi...   269   6e-71   Hordeum vulgare [barley]
gb:AJ719574_2501761 Gallus gallus mRNA for hypothetical protein,...   148   1e-34   
gb:BC089698_2566246 Xenopus tropicalis cDNA clone MGC:108278 IMA...   144   2e-33   
pir|B29328|OXRTA2 acyl-CoA oxidase (EC 1.3.3.6) chain A, peroxis...   144   3e-33   
sp|P07872|CAO1_RAT|CAO1_RAT Acyl-coenzyme A oxidase 1, peroxisomal (EC 1....   144   3e-33   Rattus norvegicus [brown rat]
sp|Q9Z1N0|CAO1_CAVPO|CAO1_CAVPO Acyl-coenzyme A oxidase 1, peroxisomal (EC ...   142   6e-33   Cavia porcellus [guinea pig]
sp|Q8HYL8|CAO1_PHACI|CAO1_PHACI Acyl-coenzyme A oxidase 1, peroxisomal (EC ...   142   8e-33   Phascolarctos cinereus
gb:BC063727_2553580 Xenopus laevis hypothetical protein MGC68531...   139   7e-32   
gb:AF463454_1420784 Phascolarctos cinereus acyl-CoA oxidase type...   139   7e-32   
gb:AB034914_2044925 Mus musculus muspaox mRNA for peroxisomal ac...   138   1e-31   
gb:AK040566_1165673 Mus musculus 0 day neonate thymus cDNA, RIKE...   138   1e-31   
gb:AK028876_1161210 Mus musculus 10 days neonate skin cDNA, RIKE...   138   1e-31   
sp|Q9R0H0|CAO1_MOUSE|CAO1_MOUSE Acyl-coenzyme A oxidase 1, peroxisomal (EC ...   137   2e-31   Mus musculus [mouse]
gb:S69189_2041030 Homo sapiens peroxisomal acyl-coenzyme A oxida...   136   6e-31   
gb:BC083524_2563325 Danio rerio zgc:92584, mRNA (cDNA clone MGC:...   135   8e-31   
gb:CR859802_1183905 Pongo pygmaeus mRNA; cDNA DKFZp469D1734 (fro...   131   2e-29   
gb:CR858463_1182636 Pongo pygmaeus mRNA; cDNA DKFZp468K0611 (fro...   131   2e-29   
pir|I38095|I38095 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal - h...   129   6e-29   Homo sapiens [man]
gb:HSM805675_2017979 Homo sapiens mRNA; cDNA DKFZp686L1882 (from...   129   7e-29   
gb:BC010425_1972625 Homo sapiens acyl-Coenzyme A oxidase 1, palm...   129   7e-29   
gb:BC008767_1971567 Homo sapiens acyl-Coenzyme A oxidase 1, palm...   129   7e-29   
sp|Q15067|CAO1_HUMAN|CAO1_HUMAN Acyl-coenzyme A oxidase 1, peroxisomal (EC ...   129   7e-29   Homo sapiens [man]
gb:AX155023_1462750 Sequence 69 from Patent WO0138484.                124   2e-27   
gb:HSU07866_2021846 Human peroxisomal fatty acyl-coA oxidase mRN...   121   1e-26   
pir|A54942|A54942 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal spl...   121   1e-26   Homo sapiens [man]
pir|B54942|B54942 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal spl...   121   1e-26   Homo sapiens [man]
gb:BC068891_2555387 Xenopus laevis hypothetical protein MGC83074...   114   3e-24   
gb:CR859705_1183809 Pongo pygmaeus mRNA; cDNA DKFZp469P0525 (fro...   107   4e-22   
gb:BC021339_2093379 Mus musculus acyl-Coenzyme A oxidase 2, bran...   104   2e-21   
sp|P97562|CAO2_RAT|CAO2_RAT Acyl-coenzyme A oxidase 2, peroxisomal (EC 1....   104   2e-21   Rattus norvegicus [brown rat]
sp|Q9QXD1|CAO2_MOUSE|CAO2_MOUSE Acyl-coenzyme A oxidase 2, peroxisomal (EC ...   104   2e-21   Mus musculus [mouse]
sp|Q99424|CAO2_HUMAN|CAO2_HUMAN Acyl-coenzyme A oxidase 2, peroxisomal (EC ...   103   3e-21   Homo sapiens [man]
sp|O02767|CAO2_RABIT|CAO2_RABIT Acyl-coenzyme A oxidase 2, peroxisomal (EC ...   102   1e-20   Oryctolagus cuniculus [domestic rabbit]
gb:AY069799_1294529 Drosophila melanogaster SD03592 full length ...    92   2e-17   
gb:AE013599_1133112 Drosophila melanogaster chromosome 2R, compl...    92   2e-17   
pir|T23010|T23010 hypothetical protein F59F4.1 - Caenorhabditis ...    83   8e-15   Caenorhabditis elegans [roundworm]
gb:AE013599_1133113 Drosophila melanogaster chromosome 2R, compl...    82   2e-14   
gb:CR382131_1664596 Yarrowia lipolytica chromosome E of strain C...    81   3e-14   
gb:CR382132_1665395 Yarrowia lipolytica chromosome F of strain C...    80   5e-14   
gb:AY060596_1292401 Drosophila melanogaster GH01266 full length ...    78   2e-13   
gb:AE013599_1132496 Drosophila melanogaster chromosome 2R, compl...    78   2e-13   
pir|T20569|T20569 hypothetical protein F08A8.3 - Caenorhabditis ...    77   3e-13   Caenorhabditis elegans [roundworm]
pir|T20570|T20570 hypothetical protein F08A8.4 - Caenorhabditis ...    77   6e-13   Caenorhabditis elegans [roundworm]
pir|T20568|T20568 hypothetical protein F08A8.2 - Caenorhabditis ...    76   9e-13   Caenorhabditis elegans [roundworm]
sp|P34355|CAOP_CAEEL|CAOP_CAEEL Probable acyl-coenzyme A oxidase, peroxisom...    75   2e-12   Caenorhabditis elegans [roundworm]
gb:CR382131_1663732 Yarrowia lipolytica chromosome E of strain C...    74   5e-12   
gb:CEF08A8_1362045 Caenorhabditis elegans cosmid F08A8, complete...    74   5e-12   
pir|T20571|T20571 hypothetical protein F08A8.1 - Caenorhabditis ...    74   5e-12   Caenorhabditis elegans [roundworm]
gb:YLACO1_1727881 Yarrowia lipolytica ACO1 gene.                       71   2e-11   
gb:CR382131_1664825 Yarrowia lipolytica chromosome E of strain C...    71   2e-11   
pir|T21329|T21329 hypothetical protein F25C8.1 - Caenorhabditis ...    71   2e-11   Caenorhabditis elegans [roundworm]
gb:CR382130_1663339 Yarrowia lipolytica chromosome D of strain C...    71   3e-11   
gb:CR380947_1649149 Candida glabrata strain CBS138 chromosome A ...    71   3e-11   
gb:AE014298_1124607 Drosophila melanogaster chromosome X, comple...    71   3e-11   
gb:AE017347_1757659 Cryptococcus neoformans var. neoformans JEC2...    67   4e-10   
gb:CR382129_1662276 Yarrowia lipolytica chromosome C of strain C...    67   6e-10   
gb:CR382136_1669397 Debaryomyces hansenii chromosome D of strain...    65   1e-09   
gb:YSCPOX1_1730332 Yeast (S.cerevisiae) acyl-coenzyme A oxidase ...    65   2e-09   
gb:SCYGL204C_1712132 S.cerevisiae chromosome VII reading frame O...    65   2e-09   
sp|P13711|CAO_YEAST|CAO_YEAST Acyl-coenzyme A oxidase (EC 1.3.3.6) (Acyl-C...    65   2e-09   Saccharomyces cerevisiae [brewer's yeast]
gb:AY766151_1433735 Ovibos moschatus acyl-CoA oxidase gene, part...    64   5e-09   
gb:AE016818_1748502 Ashbya gossypii (= Eremothecium gossypii) AT...    61   2e-08   
gb:YSAPOX5_1728151 Candida tropicalis acyl-coenzyme A oxidase I ...    60   4e-08   
pir|B25123|OXCKX5 acyl-CoA oxidase (EC 1.3.3.6) POX5, peroxisoma...    60   4e-08   
sp|P08790|CAO1_CANTR|CAO1_CANTR Acyl-coenzyme A oxidase I (EC 1.3.3.6) (Acy...    60   4e-08   Candida tropicalis
pir|A27331|OXCKP2 acyl-CoA oxidase (EC 1.3.3.6) PXP2, peroxisoma...    60   7e-08   
sp|P11356|CAO4_CANTR|CAO4_CANTR Acyl-coenzyme A oxidase PXP-2 (EC 1.3.3.6) ...    60   7e-08   Candida tropicalis
gb:HVCDR29_1682305 H.vulgare cdr29 gene.                               59   2e-07   
pir|T04480|T04480 acyl-CoA oxidase homolog - barley (fragment)         59   2e-07   Hordeum vulgare [barley]
gb:CR382126_1658796 Kluyveromyces lactis strain NRRL Y-1140 chro...    58   3e-07   
sp|Q00468|CAO2_CANMA|CAO2_CANMA Acyl-coenzyme A oxidase POX2 (EC 1.3.3.6) (...    58   3e-07   Candida maltosa
gb:CR858922_1183065 Pongo pygmaeus mRNA; cDNA DKFZp469G0723 (fro...    56   8e-07   
gb:AB013395_1512157 Arabidopsis thaliana genomic DNA, chromosome...    56   1e-06   
pir|T52120|T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal [va...    56   1e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O15254|CAO3_HUMAN|CAO3_HUMAN Acyl-coenzyme A oxidase 3, peroxisomal (EC ...    56   1e-06   Homo sapiens [man]
gb:AE016822_341096 Leifsonia xyli subsp. xyli str. CTCB07, compl...    55   2e-06   
gb:AY071328_1295412 Drosophila melanogaster RE34879 full length ...    54   5e-06   
gb:AE014134_1127829 Drosophila melanogaster chromosome 2L, compl...    54   5e-06   
pir|T28847|T28847 hypothetical protein F58F9.7 - Caenorhabditis ...    52   1e-05   Caenorhabditis elegans [roundworm]
gb:BC054613_2551023 Danio rerio zgc:64087, mRNA (cDNA clone MGC:...    52   1e-05   
sp|Q63448|CAO3_RAT|CAO3_RAT Acyl-coenzyme A oxidase 3, peroxisomal (EC 1....    51   3e-05   Rattus norvegicus [brown rat]
gb:YSAAOX_1728068 Candida tropicalis peroxisomal fatty acyl-CoA ...    50   4e-05   
gb:CTPOX42_1674227 Candida tropicalis mRNA fragment for acyl-coe...    50   4e-05   
gb:CTPOX42_1674226 Candida tropicalis mRNA fragment for acyl-coe...    50   4e-05   
pir|A29047|OXCKX acyl-CoA oxidase (EC 1.3.3.6) AOx, peroxisomal ...    50   4e-05   
pir|A28584|OXCKAX acyl-CoA oxidase (EC 1.3.3.6) POX4-2, peroxiso...    50   4e-05   
sp|P11355|CAO3_CANTR|CAO3_CANTR Acyl-coenzyme A oxidase POX4-2 (EC 1.3.3.6)...    50   4e-05   Candida tropicalis
sp|P06598|CAO2_CANTR|CAO2_CANTR Acyl-coenzyme A oxidase II (EC 1.3.3.6) (Ac...    50   4e-05   Candida tropicalis
gb:CR382135_1667744 Debaryomyces hansenii chromosome C of strain...    50   6e-05   
gb:AF013216_468779 Myxococcus xanthus Dog (dog), isocitrate lyas...    50   6e-05   
pir|T07901|T07901 acyl CoA oxidase homolog - cucurbit>gb:AF00201...    50   6e-05   
gb:AB031272_1518608 Candida tropicalis POX4 gene for acyl-CoA ox...    50   7e-05   
gb:AB031271_1518607 Candida tropicalis POX4 gene for acyl-CoA ox...    50   7e-05   
pir|A25123|OXCKX4 acyl-CoA oxidase (EC 1.3.3.6) POX4, peroxisoma...    50   7e-05   
pir|A29441|OXCKPM acyl-CoA oxidase (EC 1.3.3.6) PXP4, peroxisoma...    50   7e-05   
sp|P05335|CAO4_CANMA|CAO4_CANMA Acyl-coenzyme A oxidase POX4 (EC 1.3.3.6) (...    50   7e-05   Candida maltosa
gb:AF202987_1776546 Petroselinum crispum acyl-CoA oxidase (ACO) ...    49   2e-04   
gb:BC055019_2101891 Mus musculus acyl-Coenzyme A oxidase 3, pris...    48   3e-04   
sp|Q9EPL9|CAO3_MOUSE|CAO3_MOUSE Acyl-coenzyme A oxidase 3, peroxisomal (EC ...    48   3e-04   Mus musculus [mouse]
gb:BC044725_2099008 Mus musculus acyl-Coenzyme A oxidase 3, pris...    47   4e-04   
gb:AE017234_412806 Mycobacterium avium subsp. paratuberculosis s...    47   6e-04   
gb:AF133102_1770901 Pichia pastoris acyl-coenzyme A oxidase (POX...    44   0.004   
gb:AK028818_1161179 Mus musculus 10 days neonate skin cDNA, RIKE...    43   0.007   
gb:AP003574_1831122 Oryza sativa (japonica cultivar-group) genom...    42   0.015   
gb:CR382136_1669394 Debaryomyces hansenii chromosome D of strain...    39   0.098   
gb:BA000030_701593 Streptomyces avermitilis MA-4680 genomic DNA,...    39   0.13    
gb:AX155025_1462751 Sequence 71 from Patent WO0138484.                 37   0.49    
gb:BC048717_2099797 Mus musculus acyl-Coenzyme A oxidase-like, m...    36   1.1     
gb:AK004775_1152585 Mus musculus adult male lung cDNA, RIKEN ful...    36   1.1     
gb:AP006618_558875 Nocardia farcinica IFM 10152 DNA, complete ge...    36   1.1     
gb:DME276483_1379125 Drosophila melanogaster putative sar1 gene ...    35   1.8     
gb:AE014297_1140779 Drosophila melanogaster chromosome 3R, compl...    35   1.8     
gb:AE014297_1140775 Drosophila melanogaster chromosome 3R, compl...    35   1.8     
gb:AF055922_474077 Streptomyces fradiae dipeptidil carboxypeptid...    34   4.1     
pir|T44585|T44585 acyl-CoA oxidase homolog [imported] - Streptom...    34   4.1     Streptomyces fradiae
gb:AF077536_1239218 Caenorhabditis elegans cosmid C16A11, comple...    33   5.4     
pir|T33346|T33346 hypothetical protein C16A11.5 - Caenorhabditis...    33   5.4     Caenorhabditis elegans [roundworm]


>pir|T52121|T52121 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal
            [validated] - Arabidopsis thaliana>gb:AY058849_1564386
            Arabidopsis thaliana AT4g16760/dl4405c mRNA, complete
            cds.>gb:BT001067_1635322 Arabidopsis thaliana
            At4g16760/dl4405c mRNA, complete cds.>gb:AF057044_1764770
            Arabidopsis thaliana acyl-CoA oxidase (ACX1) mRNA,
            complete cds.
          Length = 664

 Score =  331 bits (848), Expect = 1e-89
 Identities = 160/211 (75%), Positives = 183/211 (86%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TTAYMGR   LLQCRS VQ+A+DW+NP  VLEA+EARA RM  +CAKNL+ F + E GF 
Sbjct: 454  TTAYMGRAAHLLQCRSGVQKAEDWLNPDVVLEAFEARALRMAVTCAKNLSKFENQEQGFQ 513

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            EL +DLVEAA+AHCQ+IVVSKFI KL+QDI G GVK+QL NL  IY+LYL+HKH GDFLS
Sbjct: 514  ELLADLVEAAIAHCQLIVVSKFIAKLEQDIGGKGVKKQLNNLCYIYALYLLHKHLGDFLS 573

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            T CITPKQASLANDQLR+LYT VRPNAVALVDAFNYTDH+L+S+LGRYDGNVYPKL+E A
Sbjct: 574  TNCITPKQASLANDQLRSLYTQVRPNAVALVDAFNYTDHYLNSVLGRYDGNVYPKLFEEA 633

Query: 320  WKDPLNESVVPDGYHEYIRPLLKQQLRMARL 228
             KDPLN+SVVPDGY EY+RP+L+QQLR ARL
Sbjct: 634  LKDPLNDSVVPDGYQEYLRPVLQQQLRTARL 664



>gb:AF404404_1796728 Glycine max acyl-CoA oxidase (ACX1;2) mRNA,
            complete cds.
          Length = 665

 Score =  327 bits (838), Expect = 2e-88
 Identities = 154/211 (72%), Positives = 188/211 (89%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TT+Y+GR++QL+Q RS+VQ+ +DW+ P+AVL A+EARAA+ + +CA+NL+ F + E+GF 
Sbjct: 455  TTSYIGRVEQLMQYRSDVQKVEDWLKPNAVLGAFEARAAKKVVACAQNLSKFTNPEEGFQ 514

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            ELS DLVEAAVAHCQ+IVVSKFIEKL+QDIPG GVKQQLE L  IY+L+L+HKH GDFL+
Sbjct: 515  ELSVDLVEAAVAHCQLIVVSKFIEKLQQDIPGKGVKQQLELLCSIYALFLLHKHLGDFLA 574

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            TGCITPKQ SLAN+ LR+LY+ VRPNA+ALVDAFNYTDH+L S+LGRYDG+VYPKLYE A
Sbjct: 575  TGCITPKQGSLANELLRSLYSQVRPNAIALVDAFNYTDHYLGSVLGRYDGDVYPKLYEEA 634

Query: 320  WKDPLNESVVPDGYHEYIRPLLKQQLRMARL 228
            WKDPLN+SVVPDG+ EYIRP+LKQQLR ARL
Sbjct: 635  WKDPLNDSVVPDGFQEYIRPMLKQQLRNARL 665



>gb:AF404403_1796727 Glycine max acyl-CoA oxidase (ACX1;1) mRNA,
            complete cds.
          Length = 664

 Score =  321 bits (823), Expect = 1e-86
 Identities = 152/211 (72%), Positives = 187/211 (88%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TTAYM R++QL+Q  S+V++A+DW+ P+ VLEA+EARA+RM  +CA+NL+ FA+ E+GF 
Sbjct: 454  TTAYMARVEQLMQYHSDVEKAEDWLKPNVVLEAFEARASRMSVACAQNLSKFANPEEGFQ 513

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            EL++DLV+AAVAHCQ+IVVSKFIEKL+QDIPG GVK+QLE L  IY+L+L+HKH GDFLS
Sbjct: 514  ELAADLVDAAVAHCQLIVVSKFIEKLQQDIPGKGVKKQLEVLCSIYALFLLHKHLGDFLS 573

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            TGCI PKQ SLA++QLR LY+ VRPNA+ALVDAFNYTDH+L SILGRYDGNVYPK+ E A
Sbjct: 574  TGCINPKQGSLASEQLRNLYSQVRPNAIALVDAFNYTDHYLGSILGRYDGNVYPKMNEEA 633

Query: 320  WKDPLNESVVPDGYHEYIRPLLKQQLRMARL 228
            WKDPLN+SVVPDG+ EYI+P+LKQQLR ARL
Sbjct: 634  WKDPLNDSVVPDGFKEYIQPMLKQQLRNARL 664



>pir|H71434|H71434 probable apetala2 domain TINY - Arabidopsis
            thaliana>gb:ATCHRIV44_1545478 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 44.>gb:ATFCA6_1551726
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 6.
          Length = 895

 Score =  306 bits (785), Expect = 3e-82
 Identities = 148/194 (76%), Positives = 168/194 (86%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TTAYMGR   LLQCRS VQ+A+DW+NP  VLEA+EARA RM  +CAKNL+ F + E GF 
Sbjct: 674  TTAYMGRAAHLLQCRSGVQKAEDWLNPDVVLEAFEARALRMAVTCAKNLSKFENQEQGFQ 733

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            EL +DLVEAA+AHCQ+IVVSKFI KL+QDI G GVK+QL NL  IY+LYL+HKH GDFLS
Sbjct: 734  ELLADLVEAAIAHCQLIVVSKFIAKLEQDIGGKGVKKQLNNLCYIYALYLLHKHLGDFLS 793

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            T CITPKQASLANDQLR+LYT VRPNAVALVDAFNYTDH+L+S+LGRYDGNVYPKL+E A
Sbjct: 794  TNCITPKQASLANDQLRSLYTQVRPNAVALVDAFNYTDHYLNSVLGRYDGNVYPKLFEEA 853

Query: 320  WKDPLNESVVPDGY 279
             KDPLN+SVVPDGY
Sbjct: 854  LKDPLNDSVVPDGY 867



>pir|G84771|G84771 probable acyl-CoA oxidase [imported] - Arabidopsis
            thaliana>gb:AC006068_1533360 Arabidopsis thaliana
            chromosome 2 clone T20F21 map ve016, complete
            sequence.>gb:AY074357_1567512 Arabidopsis thaliana
            putative acyl-CoA oxidase (At2g35690) mRNA, complete
            cds.>gb:AY096691_1576227 Arabidopsis thaliana putative
            acyl-CoA oxidase (At2g35690) mRNA, complete cds.
          Length = 664

 Score =  305 bits (781), Expect = 7e-82
 Identities = 147/211 (69%), Positives = 176/211 (83%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TTAYMGR + LLQC S V+ A+DW+NP  VLEA+EARA RM  +CA NL+ F + E GF+
Sbjct: 454  TTAYMGRAKHLLQCSSGVRNARDWLNPGMVLEAFEARALRMAVTCANNLSKFENQEQGFS 513

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            EL +DLVEAA AHCQ+IVVSKFI K++ DI G GVK+QL+NL  IY+LYL+HKH GDFLS
Sbjct: 514  ELLADLVEAATAHCQLIVVSKFIAKVEGDIEGKGVKKQLKNLCYIYALYLLHKHLGDFLS 573

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            T  +TP+QASLAN QLR+LY+ VRPNAVALVDAF+YTD +L S+LGRYDGNVYPKL+E A
Sbjct: 574  TNSVTPEQASLANQQLRSLYSQVRPNAVALVDAFDYTDQYLGSVLGRYDGNVYPKLFEEA 633

Query: 320  WKDPLNESVVPDGYHEYIRPLLKQQLRMARL 228
             KDPLN+SVVPDGY EYIRPL+KQ+ R A+L
Sbjct: 634  LKDPLNDSVVPDGYREYIRPLIKQRFRSAKL 664



>gb:AP002842_1823076 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 669

 Score =  301 bits (771), Expect = 1e-80
 Identities = 141/211 (66%), Positives = 174/211 (82%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            TTAYMG +Q L+QC+  V  A+DW+NP+A+ E +EARA RM  +CA+N+N   S E+GF 
Sbjct: 459  TTAYMGNIQYLMQCKCGVNTAEDWLNPAAIREVFEARALRMAVNCAQNINKAPSQEEGFY 518

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
            ELS DL+E AVAH Q+I+V+KFIEKL+QDIPG GVK+QL  L  +Y+LYL+HKH GDFLS
Sbjct: 519  ELSPDLLEVAVAHIQLIIVTKFIEKLEQDIPGEGVKEQLCILCNVYALYLVHKHLGDFLS 578

Query: 500  TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAA 321
            TG IT +Q +LAN+QL  LY  VRPNAVALVDAFNYTDH+L S+LGRYDGNVYP LYE A
Sbjct: 579  TGSITARQGALANEQLGKLYAQVRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEA 638

Query: 320  WKDPLNESVVPDGYHEYIRPLLKQQLRMARL 228
            WKDPLN++ VPDGY E++RPLLKQQL+++RL
Sbjct: 639  WKDPLNDTDVPDGYQEHLRPLLKQQLKLSRL 669



>pir|T04418|T04418 probable acyl-CoA oxidase (EC 1.3.3.6), peroxisomal
            - barley>gb:HVACYLCOA_1682228 Hordeum vulgare mRNA for
            putative acyl-CoA oxidase.
          Length = 643

 Score =  269 bits (687), Expect = 6e-71
 Identities = 125/187 (66%), Positives = 160/187 (85%)
 Frame = -3

Query: 788  MNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
            +NP+AV E +EARA RM  +CA+N++   S E+GF+ELS DL+EAAVAH Q+I+V+KFIE
Sbjct: 457  VNPAAVKEVFEARALRMAVNCAQNISKAPSQEEGFSELSPDLLEAAVAHVQLIIVTKFIE 516

Query: 608  KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
            K+++DIPG GVK+QL+ L  IY+L+L+HKH GD LSTGC+T +Q +LAN+QL  LY  VR
Sbjct: 517  KIEEDIPGPGVKEQLQKLCSIYALHLLHKHLGDSLSTGCVTARQGALANEQLGKLYAQVR 576

Query: 428  PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
            PNAVALVDAF+YTDH+L S+LGRYDG+VYP LYE AWKDPLNE+VVPDGY E++RPLLKQ
Sbjct: 577  PNAVALVDAFDYTDHYLGSVLGRYDGDVYPALYEEAWKDPLNETVVPDGYQEHLRPLLKQ 636

Query: 248  QLRMARL 228
            QL+++RL
Sbjct: 637  QLKLSRL 643



>gb:AJ719574_2501761 Gallus gallus mRNA for hypothetical protein,
            clone 3h19.
          Length = 662

 Score =  148 bits (373), Expect = 1e-34
 Identities = 78/180 (43%), Positives = 117/180 (65%), Gaps = 4/180 (2%)
 Frame = -3

Query: 785  NPSAVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIVVSK 618
            +P +++EAY+ARAAR++ + AKNL    N+  S ED +   S DLV A+ AHC  ++V  
Sbjct: 480  DPVSLVEAYKARAARLVEAAAKNLQAELNHRKSKEDAWNRTSVDLVRASEAHCHYVIVKL 539

Query: 617  FIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYT 438
            F  KL + I    V   L  L  +Y+LY I K+ GDFL  G +T  Q +  N +++ L  
Sbjct: 540  FTAKLSEVINA-AVCAVLTELCLLYALYGISKNAGDFLQAGILTDAQITQVNQRVKELLA 598

Query: 437  LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            ++RPNAVALVD+F++ D  L S+LGRYDGNVY  ++E A K PLN++ V + +H++++P+
Sbjct: 599  VIRPNAVALVDSFDFHDVHLGSVLGRYDGNVYENMFEWAKKSPLNKTEVHESFHKHLKPM 658



>gb:BC089698_2566246 Xenopus tropicalis cDNA clone MGC:108278
            IMAGE:7020769, complete cds.
          Length = 661

 Score =  144 bits (363), Expect = 2e-33
 Identities = 81/193 (41%), Positives = 121/193 (62%), Gaps = 6/193 (3%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFAS----SEDGFAELSSDLVEAA 651
            RS V+   D  N   ++EAY+ RAA ++ + AKN+N  +      ED + + S DLV A+
Sbjct: 471  RSLVKDINDIQN---LVEAYKQRAAWLVVAAAKNVNTDSKRGKRKEDAWNKNSVDLVRAS 527

Query: 650  VAHCQVIVVSKFIEKLKQ--DIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQ 477
             AHC  +VV  F +KL +  D+  + +   L +L   Y+L+ I K+ GDFL  G +T  Q
Sbjct: 528  EAHCHYVVVKLFADKLSEVLDVAAHRI---LSSLCLFYALHGISKNTGDFLQAGLLTTLQ 584

Query: 476  ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNES 297
              L   +++ L  ++RPNAVALVDAF+Y+D  L S+LGRYDGNVY  ++E A K PLN++
Sbjct: 585  VDLVQQRVKDLLAVIRPNAVALVDAFDYSDTQLGSVLGRYDGNVYENMFEWAKKSPLNKT 644

Query: 296  VVPDGYHEYIRPL 258
             V + +H+Y++PL
Sbjct: 645  QVHESFHKYLKPL 657



>pir|B29328|OXRTA2 acyl-CoA oxidase (EC 1.3.3.6) chain A, peroxisomal
            splice form II - rat
          Length = 661

 Score =  144 bits (362), Expect = 3e-33
 Identities = 83/174 (47%), Positives = 108/174 (62%), Gaps = 4/174 (2%)
 Frame = -3

Query: 767  EAYEARAARMIASCAKNLNNFAS----SEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLK 600
            EAY+ RAAR++   AKNL    S     E  +   S DLV A+ AHC  +VV  F +KL 
Sbjct: 485  EAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFSDKLP 544

Query: 599  QDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNA 420
            + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L TL+RPNA
Sbjct: 545  K-IQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIRPNA 603

Query: 419  VALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            VALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V + YH++++PL
Sbjct: 604  VALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPL 657



>sp|P07872|CAO1_RAT Acyl-coenzyme A oxidase 1, peroxisomal (EC
            1.3.3.6) (Palmitoyl-CoA oxidase) (AOX).>pir|A29328|OXRTA1
            acyl-CoA oxidase (EC 1.3.3.6) chain A, peroxisomal splice
            form I - rat>gb:BC085743_2109314 Rattus norvegicus
            acyl-Coenzyme A oxidase 1, palmitoyl, mRNA (cDNA clone
            MGC:93508 IMAGE:7109722), complete
            cds.>gb:RATACOA1_2131375 Rat acyl-coA oxidase mRNA,
            complete cds.
          Length = 661

 Score =  144 bits (362), Expect = 3e-33
 Identities = 83/174 (47%), Positives = 108/174 (62%), Gaps = 4/174 (2%)
 Frame = -3

Query: 767  EAYEARAARMIASCAKNLNNFAS----SEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLK 600
            EAY+ RAAR++   AKNL    S     E  +   S DLV A+ AHC  +VV  F +KL 
Sbjct: 485  EAYKLRAARLVEIAAKNLQTHVSHRKSKEVAWNLTSVDLVRASEAHCHYVVVKVFSDKLP 544

Query: 599  QDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNA 420
            + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L TL+RPNA
Sbjct: 545  K-IQDKAVQAVLRNLCLLYSLYGISQKGGDFLEGSIITGAQLSQVNARILELLTLIRPNA 603

Query: 419  VALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            VALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V + YH++++PL
Sbjct: 604  VALVDAFDFKDMTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKHLKPL 657



>sp|Q9Z1N0|CAO1_CAVPO Acyl-coenzyme A oxidase 1, peroxisomal (EC
            1.3.3.6) (Palmitoyl-CoA oxidase)
            (AOX).>gb:CPAJ5112_2111834 Cavia porcellus mRNA for
            palmitoyl-CoA oxidase 1, complete CDS.
          Length = 661

 Score =  142 bits (359), Expect = 6e-33
 Identities = 82/183 (44%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIV 627
            D  NP ++ E Y+ RAAR+I   AK+L    ++  S E  +   S  LV A  AHC  +V
Sbjct: 476  DINNPDSLTEIYKLRAARLIDIAAKSLQGEMSHRKSKEVAWNLTSVGLVRATDAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F +KL + I    ++  L NLF +YSLY I +  GDFL    +T  Q +  N ++  
Sbjct: 536  VKLFADKLLK-IQDKTIQAVLRNLFLLYSLYGISQKAGDFLQGNIMTGSQITQVNQRVLE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYI 267
            L  ++RPNAVALVDAF+Y D  L S+LGRYDGNVY  L+E A K PLN++ V + YH+Y+
Sbjct: 595  LLAVIRPNAVALVDAFDYKDITLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYHKYL 654

Query: 266  RPL 258
            +PL
Sbjct: 655  KPL 657



>sp|Q8HYL8|CAO1_PHACI Acyl-coenzyme A oxidase 1, peroxisomal (EC
            1.3.3.6) (Palmitoyl-CoA oxidase)
            (AOX).>gb:AF463453_1420783 Phascolarctos cinereus
            acyl-CoA oxidase type 1 mRNA, complete cds.
          Length = 661

 Score =  142 bits (358), Expect = 8e-33
 Identities = 82/204 (40%), Positives = 119/204 (58%), Gaps = 10/204 (4%)
 Frame = -3

Query: 839  LQQLLQCRSNVQQAKDWM------NPSAVLEAYEARAARMIASCAKNLN----NFASSED 690
            L  L   R   QQ   W       NP ++ EAY+ RAAR++ + A+NL     +  S E 
Sbjct: 455  LNDLPSQRIQPQQVAAWPAMVDINNPDSLTEAYKHRAARLVEAAARNLQAEMKHRKSKEI 514

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             +   S DLV A+ AHC  +VV  F   L + I    ++  L NL  +Y+LY I ++ GD
Sbjct: 515  AWNFTSVDLVRASEAHCHYVVVKLFSGNLSK-IDDKPIQAVLTNLCLLYALYGISQNSGD 573

Query: 509  FLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
            FL  G +T  Q +  N +++ L TL+RP + ALVDAF++ D  L S+LGRYDGN+Y  ++
Sbjct: 574  FLQGGILTESQLTQVNQRVKELLTLIRPESAALVDAFDFQDVSLGSVLGRYDGNIYENMF 633

Query: 329  EAAWKDPLNESVVPDGYHEYIRPL 258
            E A K PLN+S V + YH++++PL
Sbjct: 634  EWAKKSPLNKSEVHESYHKHLKPL 657



>gb:BC063727_2553580 Xenopus laevis hypothetical protein MGC68531,
            mRNA (cDNA clone MGC:68531 IMAGE:4030997), complete cds.
          Length = 661

 Score =  139 bits (350), Expect = 7e-32
 Identities = 77/186 (41%), Positives = 116/186 (62%), Gaps = 6/186 (3%)
 Frame = -3

Query: 797  KDWMNPSAVLEAYEARAARMIASCAKNLNNFAS----SEDGFAELSSDLVEAAVAHCQVI 630
            KD  +   ++EAY+ RAA ++ + AKN+N         ED + + S DLV A+ AHC  +
Sbjct: 475  KDINDIQNLVEAYKQRAAWLVVAAAKNVNADTKRGKRKEDAWNKNSVDLVRASEAHCHYV 534

Query: 629  VVSKFIEKLKQ--DIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQ 456
            VV  F EKL +  D+  + +   L +L   Y+L+ I K+ GDFL  G +T  Q      +
Sbjct: 535  VVRLFAEKLSEVLDVAAHRI---LSSLCLFYALHGISKNTGDFLQAGLLTALQVDQVQQR 591

Query: 455  LRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYH 276
            ++ L  ++RPNA+ALVDAF+Y+D  L S+LGRYDGNVY  ++E A K PLN++ V + +H
Sbjct: 592  VKDLLAVIRPNALALVDAFDYSDTQLGSVLGRYDGNVYENMFEWAKKSPLNKTQVHESFH 651

Query: 275  EYIRPL 258
            +Y++PL
Sbjct: 652  KYLKPL 657



>gb:AF463454_1420784 Phascolarctos cinereus acyl-CoA oxidase type 2
            mRNA, complete cds.
          Length = 661

 Score =  139 bits (350), Expect = 7e-32
 Identities = 81/204 (39%), Positives = 118/204 (57%), Gaps = 10/204 (4%)
 Frame = -3

Query: 839  LQQLLQCRSNVQQAKDWM------NPSAVLEAYEARAARMIASCAKNLN----NFASSED 690
            L  L   R   QQ   W       NP ++ EAY+ RAAR++ + A+NL     +  S E 
Sbjct: 455  LNDLPSQRIQPQQVAAWPAMVDINNPDSLTEAYKHRAARLVEAAARNLQAEMKHRKSKEI 514

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             +   S DLV A+ AHC  +VV  F   L + I    ++  L NL  +Y+ Y I ++ GD
Sbjct: 515  AWNFTSVDLVRASGAHCHYVVVKLFSGNLSK-IDDKPIQAVLTNLCLLYAPYGISQNSGD 573

Query: 509  FLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
            FL  G +T  Q +  N +++ L TL+RP + ALVDAF++ D  L S+LGRYDGN+Y  ++
Sbjct: 574  FLQGGILTESQLTQVNQRVKELLTLIRPESAALVDAFDFQDVSLGSVLGRYDGNIYENMF 633

Query: 329  EAAWKDPLNESVVPDGYHEYIRPL 258
            E A K PLN+S V + YH++++PL
Sbjct: 634  EWAKKSPLNKSEVHESYHKHLKPL 657



>gb:AB034914_2044925 Mus musculus muspaox mRNA for peroxisomal
            acyl-CoA oxidase, complete cds.
          Length = 661

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query: 776  AVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
            ++ EAY+ RAAR++   AKNL    ++  S E  +   S DLV A+ AHC  + V  F +
Sbjct: 482  SLTEAYKLRAARLVEIAAKNLQAQVSHRKSKEVAWNLTSVDLVRASEAHCHYVTVKVFAD 541

Query: 608  KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
            KL + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L T+ R
Sbjct: 542  KLPK-IQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQMSQVNSRILELLTVTR 600

Query: 428  PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            PNAVALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V + Y+++++PL
Sbjct: 601  PNAVALVDAFDFKDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYYKHLKPL 657



>gb:AK040566_1165673 Mus musculus 0 day neonate thymus cDNA, RIKEN
            full-length enriched library, clone:A430106N22
            product:acyl-Coenzyme A oxidase 1, palmitoyl, full insert
            sequence.>gb:BC056448_2102385 Mus musculus cDNA clone
            MGC:66986 IMAGE:5704873, complete cds.
          Length = 661

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query: 776  AVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
            ++ EAY+ RAAR++   AKNL    ++  S E  +   S DLV A+ AHC  + V  F +
Sbjct: 482  SLTEAYKLRAARLVEIAAKNLQAQVSHRKSKEVAWNLTSVDLVRASEAHCHYVTVKVFAD 541

Query: 608  KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
            KL + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L T+ R
Sbjct: 542  KLPK-IQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQMSQVNSRILELLTVTR 600

Query: 428  PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            PNAVALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V + Y+++++PL
Sbjct: 601  PNAVALVDAFDFKDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYYKHLKPL 657



>gb:AK028876_1161210 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732465K19
           product:acyl-Coenzyme A oxidase 1, palmitoyl, full
           insert sequence.
          Length = 647

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/177 (45%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query: 776 AVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
           ++ EAY+ RAAR++   AKNL    ++  S E  +   S DLV A+ AHC  + V  F +
Sbjct: 468 SLTEAYKLRAARLVEIAAKNLQAQVSHRKSKEVAWNLTSVDLVRASEAHCHYVTVKVFAD 527

Query: 608 KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
           KL + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L T+ R
Sbjct: 528 KLPK-IQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQMSQVNSRILELLTVTR 586

Query: 428 PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
           PNAVALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V + Y+++++PL
Sbjct: 587 PNAVALVDAFDFKDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHESYYKHLKPL 643



>sp|Q9R0H0|CAO1_MOUSE Acyl-coenzyme A oxidase 1, peroxisomal (EC
            1.3.3.6) (Palmitoyl-CoA oxidase)
            (AOX).>gb:AF006688_2050364 Mus musculus peroxisomal
            acyl-CoA oxidase (muspaox) mRNA, complete cds.
          Length = 661

 Score =  137 bits (346), Expect = 2e-31
 Identities = 80/177 (45%), Positives = 109/177 (61%), Gaps = 4/177 (2%)
 Frame = -3

Query: 776  AVLEAYEARAARMIASCAKNL----NNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
            ++ EAY+ RAAR++   AKNL    ++  S E  +   S DLV A+ AHC  + V  F +
Sbjct: 482  SLTEAYKLRAARLVEIAAKNLQAQVSHRKSKEVAWNLTSVDLVRASEAHCHYVTVKVFAD 541

Query: 608  KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
            KL + I    V+  L NL  +YSLY I +  GDFL    IT  Q S  N ++  L T+ R
Sbjct: 542  KLPK-IQDRAVQAVLRNLCLLYSLYGISQKGGDFLEGNIITGAQMSQVNSRILELLTVTR 600

Query: 428  PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            PNAVALVDAF++ D  L S+LGRYDGNVY  L+E A K PLN++ V   Y+++++PL
Sbjct: 601  PNAVALVDAFDFKDVTLGSVLGRYDGNVYENLFEWAKKSPLNKTEVHQSYYKHLKPL 657



>gb:S69189_2041030 Homo sapiens peroxisomal acyl-coenzyme A oxidase
            mRNA, complete cds.
          Length = 661

 Score =  136 bits (342), Expect = 6e-31
 Identities = 78/183 (42%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYI 267
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + YH+++
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYHKHL 654

Query: 266  RPL 258
            + L
Sbjct: 655  KSL 657



>gb:BC083524_2563325 Danio rerio zgc:92584, mRNA (cDNA clone MGC:92584
            IMAGE:5913089), complete cds.
          Length = 660

 Score =  135 bits (341), Expect = 8e-31
 Identities = 74/177 (41%), Positives = 110/177 (62%), Gaps = 4/177 (2%)
 Frame = -3

Query: 776  AVLEAYEARAARMIASCAKNLN----NFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIE 609
            +++EAY+ RAA+++   AKNL     +  S+ED +   S DLV A+ AHC  +VV  F  
Sbjct: 481  SLVEAYKFRAAKLVEVAAKNLQLELQHSKSNEDAWNNTSIDLVRASDAHCHYVVVKLFAA 540

Query: 608  KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVR 429
            KL + I    V   L  L  +Y+L+ + ++ GDFL  G ++  Q    + +L+ L   +R
Sbjct: 541  KLSE-IGDKAVHSVLSTLALLYALHGVAQNSGDFLKAGLLSVSQLDQISQRLKGLLLEIR 599

Query: 428  PNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
            PNAVALVDAF+Y D  L+S LGRYDGNVY  ++E A K PLN + V + +++Y++PL
Sbjct: 600  PNAVALVDAFDYRDEMLNSSLGRYDGNVYEHMFEWAKKSPLNHTEVHESHNKYLKPL 656



>gb:CR859802_1183905 Pongo pygmaeus mRNA; cDNA DKFZp469D1734 (from
            clone DKFZp469D1734).
          Length = 660

 Score =  131 bits (329), Expect = 2e-29
 Identities = 77/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DIHSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L NL  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRNLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>gb:CR858463_1182636 Pongo pygmaeus mRNA; cDNA DKFZp468K0611 (from
            clone DKFZp468K0611).
          Length = 660

 Score =  131 bits (329), Expect = 2e-29
 Identities = 77/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DIHSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L NL  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRNLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>pir|I38095|I38095 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal -
            human>gb:HSPACO_2019395 H.sapiens mRNA for peroxisomal
            acyl-CoA oxidase.
          Length = 660

 Score =  129 bits (325), Expect = 6e-29
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDATLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>gb:HSM805675_2017979 Homo sapiens mRNA; cDNA DKFZp686L1882 (from
            clone DKFZp686L1882); complete cds.
          Length = 666

 Score =  129 bits (324), Expect = 7e-29
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 482  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 541

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 542  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 600

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 601  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 656



>gb:BC010425_1972625 Homo sapiens acyl-Coenzyme A oxidase 1,
            palmitoyl, transcript variant 1, mRNA (cDNA clone
            MGC:15225 IMAGE:3357409), complete cds.
          Length = 660

 Score =  129 bits (324), Expect = 7e-29
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>gb:BC008767_1971567 Homo sapiens acyl-Coenzyme A oxidase 1,
            palmitoyl, transcript variant 1, mRNA (cDNA clone
            MGC:1198 IMAGE:3051501), complete cds.
          Length = 660

 Score =  129 bits (324), Expect = 7e-29
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>sp|Q15067|CAO1_HUMAN Acyl-coenzyme A oxidase 1, peroxisomal (EC
            1.3.3.6) (Palmitoyl-CoA oxidase) (AOX).
          Length = 660

 Score =  129 bits (324), Expect = 7e-29
 Identities = 76/176 (43%), Positives = 106/176 (60%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AHC  +V
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVV 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>gb:AX155023_1462750 Sequence 69 from Patent WO0138484.
          Length = 162

 Score =  124 bits (311), Expect = 2e-27
 Identities = 67/150 (44%), Positives = 98/150 (65%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
           T AY+G ++QL      V Q  DW+N S +LEA+EAR+AR  A+ A  L   + SE  F 
Sbjct: 13  TAAYLGNIKQLSTQNCKVSQGHDWLNTSVLLEAFEARSARQAAAVALRLAKGSGSEAEFQ 72

Query: 680 ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
           E + +LVE+A AHCQ+I+VSKFIE+L+   P  G+++QLE L   Y+   +  + GDFL+
Sbjct: 73  ENTPELVESARAHCQLILVSKFIEQLQTGTP-EGIRKQLEVLCYTYAFSQLIDNAGDFLA 131

Query: 500 TGCITPKQASLANDQLRALYTLVRPNAVAL 411
           TG +T  Q +LA ++L+ ++  +R NAVAL
Sbjct: 132 TGYVTGNQIALAKEELKHMFDKIRTNAVAL 161



>gb:HSU07866_2021846 Human peroxisomal fatty acyl-coA oxidase mRNA,
            complete cds.
          Length = 660

 Score =  121 bits (304), Expect = 1e-26
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AH    +
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHLHYGL 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>pir|A54942|A54942 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal splice
            form I - human>gb:HSAOX15_2010558 Human acyl-CoA oxidase
            (AOX) gene, exon 14.
          Length = 660

 Score =  121 bits (304), Expect = 1e-26
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AH    +
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHLHYGL 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>pir|B54942|B54942 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal splice
            form II - human>gb:HSAOX15_2010559 Human acyl-CoA oxidase
            (AOX) gene, exon 14.
          Length = 660

 Score =  121 bits (304), Expect = 1e-26
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIV 627
            D  +P ++ EAY+ RAAR++   AKNL        S E  +   S DLV A+ AH    +
Sbjct: 476  DINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHLHYGL 535

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F EKL + I    ++  L +L  +YSLY I ++ GDFL    +T  Q +  N +++ 
Sbjct: 536  VKLFSEKLLK-IQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKE 594

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGY 279
            L TL+R +AVALVDAF++ D  L S+LGRYDGNVY  L+E A   PLN++ V + Y
Sbjct: 595  LLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESY 650



>gb:BC068891_2555387 Xenopus laevis hypothetical protein MGC83074,
            mRNA (cDNA clone MGC:83074 IMAGE:6316509), complete cds.
          Length = 670

 Score =  114 bits (284), Expect = 3e-24
 Identities = 69/188 (36%), Positives = 107/188 (56%), Gaps = 4/188 (2%)
 Frame = -3

Query: 794  DWMNPSAVLEAYEARAARMIASCA---KNLNNFASSE-DGFAELSSDLVEAAVAHCQVIV 627
            D++NP   ++AY+ RA R+IAS A   +NL  F   + D +   S +LV+A++AH   I+
Sbjct: 481  DFLNPEVYIKAYQHRAHRLIASAAFKMRNLVQFGMEQYDAWNSTSVELVKASIAHSHYII 540

Query: 626  VSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRA 447
            V  F +          +K+ L++L  +++L+ I    GDFL  G ++  Q  +  +   +
Sbjct: 541  VKLFADVTGSLSSSPEIKKLLKSLCDLHALHGIFTSSGDFLQDGHLSGHQLEMVTEAYLS 600

Query: 446  LYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYI 267
            L TL+R +AV LVDAF+Y D  L S LG YDGNVY  L E A K+P N+  V   +  Y+
Sbjct: 601  LLTLIRRDAVLLVDAFDYADQQLLSALGSYDGNVYHNLLECAQKNPDNKK-VNAVFENYL 659

Query: 266  RPLLKQQL 243
            +P L+  +
Sbjct: 660  KPHLQSNI 667



>gb:CR859705_1183809 Pongo pygmaeus mRNA; cDNA DKFZp469P0525 (from
            clone DKFZp469P0525).
          Length = 667

 Score =  107 bits (266), Expect = 4e-22
 Identities = 65/193 (33%), Positives = 103/193 (53%), Gaps = 4/193 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNF----ASSEDGFAELSSDLVEAA 651
            R   Q+A D++ P     A+   AAR+I    ++L       A   + + + +   ++AA
Sbjct: 470  RCPAQRAADFLCPELYTTAWAHVAARLIKDSVQHLQTLMQSGADQHEAWNQTTVIHLQAA 529

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
             AHC  + V  F E L++      ++Q L+ L  +++++ I  + GDFL    ++  Q  
Sbjct: 530  KAHCYYVTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGDQVD 589

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A      L  L+R +A+ L DAF++TD  L+S LG YDGNVY +L++ A K P N    
Sbjct: 590  MARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQEN 649

Query: 290  PDGYHEYIRPLLK 252
            P  Y EYIRPLL+
Sbjct: 650  P-AYEEYIRPLLQ 661



>gb:BC021339_2093379 Mus musculus acyl-Coenzyme A oxidase 2, branched
            chain, mRNA (cDNA clone MGC:29247 IMAGE:5052291),
            complete cds.
          Length = 681

 Score =  104 bits (259), Expect = 2e-21
 Identities = 65/193 (33%), Positives = 102/193 (52%), Gaps = 4/193 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSE----DGFAELSSDLVEAA 651
            R   Q A D+  P     A+   +AR+I    ++      S     D + + S   ++AA
Sbjct: 484  RCPAQTAADFRCPEVYTTAWAYVSARLIRDATQHTQTLMRSGVDQYDAWNQTSVIHLQAA 543

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
             AHC  + V  F E +++      +++ L+NL  +Y+L  I  + GDFL  G ++  Q  
Sbjct: 544  KAHCYFLTVRNFKEAVEKLDNEPEIQRVLQNLCDLYALNGILTNSGDFLHDGFLSGAQVD 603

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A      L  L+R +A+ L DAF+++DH L+S LG YDG+VY +L+E A K P N    
Sbjct: 604  MARTAFLDLLPLIRKDAILLTDAFDFSDHCLNSALGCYDGHVYQRLFEWAQKSPANTQEN 663

Query: 290  PDGYHEYIRPLLK 252
            P  Y +YIRPL++
Sbjct: 664  P-AYKKYIRPLMQ 675



>sp|P97562|CAO2_RAT Acyl-coenzyme A oxidase 2, peroxisomal (EC
            1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox)
            (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA
            oxidase).>gb:RNTHCOX_2136595 R.norvegicus mRNA for
            Trihydroxycoprostanoyl-CoA Oxidase.
          Length = 681

 Score =  104 bits (259), Expect = 2e-21
 Identities = 63/192 (32%), Positives = 101/192 (52%), Gaps = 4/192 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASS----EDGFAELSSDLVEAA 651
            R + Q A D+  P     A+   + R+I   A        S     D + + +   ++AA
Sbjct: 484  RCSAQTAADFRCPDVYTTAWAYVSTRLIRDAAHRTQTLMKSGVDQHDAWNQTTVIHLQAA 543

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
             AHC  I V  F E +++      +++ L+ L  +Y+L+ +  + GDFL  G ++  Q  
Sbjct: 544  KAHCYFITVKNFKEAVEKLDKEPEIQRVLQRLCDLYALHGVLTNSGDFLHDGFLSGAQVD 603

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A +    L  L+R +A+ L DAF+++DH L+S LG YDG+VY +L+E A K P N    
Sbjct: 604  MAREAFLDLLPLIRKDAILLTDAFDFSDHCLNSALGCYDGHVYERLFEWAQKYPANTQEN 663

Query: 290  PDGYHEYIRPLL 255
            P  Y +YIRPL+
Sbjct: 664  P-AYKKYIRPLM 674



>sp|Q9QXD1|CAO2_MOUSE Acyl-coenzyme A oxidase 2, peroxisomal (EC
            1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox)
            (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA
            oxidase).>gb:MMU238492_2119381 Mus musculus mRNA for
            trihydroxycoprostanoyl-CoA oxidase encoded by ACOX2 gene.
          Length = 681

 Score =  104 bits (259), Expect = 2e-21
 Identities = 65/193 (33%), Positives = 102/193 (52%), Gaps = 4/193 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSE----DGFAELSSDLVEAA 651
            R   Q A D+  P     A+   +AR+I    ++      S     D + + S   ++AA
Sbjct: 484  RCPAQTAADFRCPEVYTTAWAYVSARLIRDATQHTQTLMRSGVDQYDAWNQTSVIHLQAA 543

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
             AHC  + V  F E +++      +++ L+NL  +Y+L  I  + GDFL  G ++  Q  
Sbjct: 544  KAHCYFLTVRNFKEAVEKLDNEPEIQRVLQNLCDLYALNGILTNSGDFLHDGFLSGAQVD 603

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A      L  L+R +A+ L DAF+++DH L+S LG YDG+VY +L+E A K P N    
Sbjct: 604  MARTAFLDLLPLIRKDAILLTDAFDFSDHCLNSALGCYDGHVYQRLFEWAQKSPANTQEN 663

Query: 290  PDGYHEYIRPLLK 252
            P  Y +YIRPL++
Sbjct: 664  P-AYKKYIRPLMQ 675



>sp|Q99424|CAO2_HUMAN Acyl-coenzyme A oxidase 2, peroxisomal (EC
            1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox)
            (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA
            oxidase).>gb:BC047700_1983969 Homo sapiens acyl-Coenzyme
            A oxidase 2, branched chain, mRNA (cDNA clone MGC:51950
            IMAGE:5759226), complete cds.>gb:HSBRCOX_2011112
            H.sapiens mRNA for Branched chain Acyl-CoA
            Oxidase.>gb:HSCOA123_2011543 Homo sapiens peroxisomal
            branched chain acyl-CoA oxidase gene, exons 1, 2, 3 &
            joined CDS.
          Length = 681

 Score =  103 bits (258), Expect = 3e-21
 Identities = 63/193 (32%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASS----EDGFAELSSDLVEAA 651
            R   Q+A D++ P     A+   A R+I    ++L     S     + + + +   ++AA
Sbjct: 484  RCPAQRAADFLCPELYTTAWAHVAVRLIKDSVQHLQTLTQSGADQHEAWNQTTVIHLQAA 543

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
              HC  + V  F E L++      ++Q L+ L  +++++ I  + GDFL    ++  Q  
Sbjct: 544  KVHCYYVTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVD 603

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A      L  L+R +A+ L DAF++TD  L+S LG YDGNVY +L++ A K P N    
Sbjct: 604  MARTAYLDLLRLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFQWAQKSPTNTQEN 663

Query: 290  PDGYHEYIRPLLK 252
            P  Y EYIRPLL+
Sbjct: 664  P-AYEEYIRPLLQ 675



>sp|O02767|CAO2_RABIT Acyl-coenzyme A oxidase 2, peroxisomal (EC
            1.3.3.6) (Branched-chain acyl-CoA oxidase) (BRCACox)
            (Trihydroxycoprostanoyl-CoA oxidase) (THCCox) (THCA-CoA
            oxidase) (3alpha,7alpha, 12alpha-trihydroxy-5beta-
            cholestanoyl-CoA oxidase).>gb:OCTHCA_1442317 Oryctolagus
            cuniculus mRNA for 3alfa, 7alfa,
            12alfa-trihydroxy-5beta-cholestanoyl-CoA oxidase.
          Length = 681

 Score =  102 bits (253), Expect = 1e-20
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = -3

Query: 818  RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNF----ASSEDGFAELSSDLVEAA 651
            R   Q A D+  P+    A+   AAR+      +L       A   + + + +   ++AA
Sbjct: 484  RCPAQTAADFFCPALYTAAWAHVAARLTKDSVHHLQALRQSGADEHEAWNQTTIIHLQAA 543

Query: 650  VAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQAS 471
             AHC  I V  F E L++      ++Q L+ L  +++L+ I  + GDFL  G ++  Q  
Sbjct: 544  KAHCYYISVKSFKEALEKLENEPAIQQVLKRLCDLHALHGILTNSGDFLHDGFLSGAQVD 603

Query: 470  LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVV 291
            +A      L  L+R +A+ L DAF++TD  L+S LG YDGNVY +L+E A + P N    
Sbjct: 604  MARTAYMDLLPLIRKDAILLTDAFDFTDQCLNSALGCYDGNVYERLFEWAQRSPTNTQEN 663

Query: 290  PDGYHEYIRPLLK 252
            P  Y +YI+PLL+
Sbjct: 664  P-AYKKYIQPLLQ 675



>gb:AY069799_1294529 Drosophila melanogaster SD03592 full length cDNA.
          Length = 677

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/187 (28%), Positives = 92/187 (49%), Gaps = 4/187 (2%)
 Frame = -3

Query: 791  WMNPSAVLEAYEARAARM-IASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
            W N    ++   A   ++   S +K ++   +  +       +  +AA  H +  V S F
Sbjct: 491  WENMVKAMQYAAANRTQLAFRSLSKRMSRGETEANAANHTGIEFTQAAELHGRAFVFSAF 550

Query: 614  IEKL---KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRAL 444
             E +   +         + LENL  +Y +       G  L    +T    S   D+L  +
Sbjct: 551  YEAVTGPQSKTRSANFNRVLENLLELYLVKETLNQMGHLLRFINLTDTDLSGLQDRLETV 610

Query: 443  YTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIR 264
             T +RP+AVA+VD F+++D  L+S LG YDGN Y ++++AA K+P+N+  VP  +HE +R
Sbjct: 611  LTKLRPDAVAIVDGFDFSDLQLNSTLGSYDGNAYERIFDAALKNPMNQKAVPKYFHEILR 670

Query: 263  PLLKQQL 243
            P +K  +
Sbjct: 671  PFMKSNI 677



>gb:AE013599_1133112 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003453_1210411 Drosophila melanogaster
            chromosome 2R, section 61 of 74 of the complete sequence.
          Length = 677

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 54/187 (28%), Positives = 92/187 (49%), Gaps = 4/187 (2%)
 Frame = -3

Query: 791  WMNPSAVLEAYEARAARM-IASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
            W N    ++   A   ++   S +K ++   +  +       +  +AA  H +  V S F
Sbjct: 491  WENMVKAMQYAAANRTQLAFRSLSKRMSRGETEANAANHTGIEFTQAAELHGRAFVFSAF 550

Query: 614  IEKL---KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRAL 444
             E +   +         + LENL  +Y +       G  L    +T    S   D+L  +
Sbjct: 551  YEAVTGPQSKTRSANFNRVLENLLELYLVKETLNQMGHLLRFINLTDTDLSGLQDRLETV 610

Query: 443  YTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIR 264
             T +RP+AVA+VD F+++D  L+S LG YDGN Y ++++AA K+P+N+  VP  +HE +R
Sbjct: 611  LTKLRPDAVAIVDGFDFSDLQLNSTLGSYDGNAYERIFDAALKNPMNQKAVPKYFHEILR 670

Query: 263  PLLKQQL 243
            P +K  +
Sbjct: 671  PFMKSNI 677



>pir|T23010|T23010 hypothetical protein F59F4.1 - Caenorhabditis
           elegans>gb:CEF59F4_1364895 Caenorhabditis elegans cosmid
           F59F4, complete sequence.
          Length = 667

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 49/148 (33%), Positives = 80/148 (54%)
 Frame = -3

Query: 695 EDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQ 516
           ED +  +S +L +A+  H ++ +V   + K+   I    +K  L ++  +Y+  +I    
Sbjct: 516 EDAWNSVSVELAKASRWHVRLYLVKNLLHKVS--IAPQDLKIVLFDVARLYAYDIITSSI 573

Query: 515 GDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
           G FL  G ++  Q +   + +    + +RPNAV LVD ++Y D  L S+LGR DGNVYP 
Sbjct: 574 GAFLEDGYMSSNQMNEVKEGIYKCLSNMRPNAVGLVDCWDYDDKELKSVLGRRDGNVYPA 633

Query: 335 LYEAAWKDPLNESVVPDGYHEYIRPLLK 252
           L + A    LN S V   Y +Y+ P++K
Sbjct: 634 LLQWAQNSQLNRSEVLPAYEKYLGPMMK 661



>gb:AE013599_1133113 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003453_1210412 Drosophila melanogaster
            chromosome 2R, section 61 of 74 of the complete
            sequence.>gb:AY070539_1294684 Drosophila melanogaster
            LD22081 full length cDNA.
          Length = 677

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 52/184 (28%), Positives = 92/184 (50%), Gaps = 7/184 (3%)
 Frame = -3

Query: 773  VLEAYEARAARMIASCAKNLNNFASS--EDGFAELSS--DLVEAAVAHCQVIVVSKFIEK 606
            +++A +  AA       +NL N  +S    G A  ++  +L  AA  H +  V   F+E+
Sbjct: 494  IIKALQYTAAHKTRIAFENLANRMASGQSQGVAANNTGIELTRAAELHGRQFVCQTFLEQ 553

Query: 605  L---KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTL 435
            +   K       + + LEN+  ++ +  +  +  D L    ++         +L      
Sbjct: 554  ITGAKAQKRSPALNKILENVLELFLVQTVLNNLNDILRFIKLSDADLRSLQKRLEDSLAQ 613

Query: 434  VRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLL 255
             RPNAVA+ D F + D  L+S+LG YDGNVYP+L+++A +  +N+  V   +  Y++PL+
Sbjct: 614  FRPNAVAICDGFEFHDRVLNSVLGSYDGNVYPRLFDSAKRSTMNQKPVQTSFETYLKPLM 673

Query: 254  KQQL 243
            K +L
Sbjct: 674  KAKL 677



>gb:CR382131_1664596 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.>gb:YLACO4_1727884 Yarrowia
            lipolytica ACO4 gene.
          Length = 701

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 52/208 (25%), Positives = 99/208 (47%), Gaps = 4/208 (1%)
 Frame = -3

Query: 857  TAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSED 690
            T Y+ R ++L   + N +  +D   P  ++EA+EA +A  I +        +    S ++
Sbjct: 486  TKYLSRSKELANAKRNGRSLED---PKLLVEAWEAVSAGAINAATDAYEELSKQGVSVDE 542

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             F ++S +  +AA  H +  ++  F  ++        VK  L  L  +++L+ I +    
Sbjct: 543  CFEQVSQERFQAARIHTRRALIEAFYSRIAT--ADEKVKPHLIPLANLFALWSIEEDSAL 600

Query: 509  FLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
            FL+ G   P+        +     +VR N +   DAFN +D+F+++ +GRYDG+VY   +
Sbjct: 601  FLAEGYFEPEDIIEVTSLVNKYCGIVRKNVIGYTDAFNLSDYFINAAIGRYDGDVYKNYF 660

Query: 329  EAAWKDPLNESVVPDGYHEYIRPLLKQQ 246
            E   +    E   P  Y + ++P L ++
Sbjct: 661  EKVKQQYPPEGGKPHYYEDVMKPFLHRE 688



>gb:CR382132_1665395 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.>gb:YLACO2_1727882 Yarrowia
            lipolytica ACO2 gene.
          Length = 700

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 51/204 (25%), Positives = 94/204 (46%), Gaps = 4/204 (1%)
 Frame = -3

Query: 854  AYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCA----KNLNNFASSEDG 687
            +Y+ R + L   + N +   D   P  ++EA+E  A  +I        K +    +++  
Sbjct: 486  SYLKRYKDLANAKLNGRSLTD---PKVLVEAWEVAAGNIINRATDQYEKLIGEGLNADQA 542

Query: 686  FAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDF 507
            F  LS    +AA  H +  +++ F  ++  +  G  +KQ L NL  +++L+ I +  G F
Sbjct: 543  FEVLSQQRFQAAKVHTRRHLIAAFFSRIDTEA-GEAIKQPLLNLALLFALWSIEEDSGLF 601

Query: 506  LSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
            L  G + PK      + +    T VR   +   DAFN +D+F+++ +G YDG+ Y   ++
Sbjct: 602  LREGFLEPKDIDTVTELVNKYCTTVREEVIGYTDAFNLSDYFINAPIGCYDGDAYRHYFQ 661

Query: 326  AAWKDPLNESVVPDGYHEYIRPLL 255
               +        P  Y   ++P L
Sbjct: 662  KVNEQNPARDPRPPYYASTLKPFL 685



>gb:AY060596_1292401 Drosophila melanogaster GH01266 full length
           cDNA.
          Length = 669

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 3/105 (2%)
 Frame = -3

Query: 548 IYSLYLIH---KHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFL 378
           +  LYL+       GDFL    +T +  +    +L       RPNAV+LVD+F+  D  L
Sbjct: 565 VLELYLVDACLNRIGDFLRFIDLTDQDVTKLEVRLENCLKRFRPNAVSLVDSFDLHDRVL 624

Query: 377 DSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQQL 243
           DS LG YDGNVY  ++E+  K+PLN+  V   +H+Y++P +K  L
Sbjct: 625 DSALGAYDGNVYEHIFESTKKNPLNKEPVNGAFHKYLKPFMKAHL 669



>gb:AE013599_1132496 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003802_1225242 Drosophila melanogaster
           chromosome 2R, section 48 of 74 of the complete
           sequence.>gb:AF145642_1244701 Drosophila melanogaster
           clone GH07485 BcDNA.GH07485 (BcDNA.GH07485) mRNA,
           complete cds.
          Length = 669

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 41/105 (39%), Positives = 60/105 (57%), Gaps = 3/105 (2%)
 Frame = -3

Query: 548 IYSLYLIH---KHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFL 378
           +  LYL+       GDFL    +T +  +    +L       RPNAV+LVD+F+  D  L
Sbjct: 565 VLELYLVDACLNRIGDFLRFIDLTDQDVTKLEVRLENCLKRFRPNAVSLVDSFDLHDRVL 624

Query: 377 DSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQQL 243
           DS LG YDGNVY  ++E+  K+PLN+  V   +H+Y++P +K  L
Sbjct: 625 DSALGAYDGNVYEHIFESTKKNPLNKEPVNGAFHKYLKPFMKAHL 669



>pir|T20569|T20569 hypothetical protein F08A8.3 - Caenorhabditis
           elegans>gb:CEF08A8_1362047 Caenorhabditis elegans cosmid
           F08A8, complete sequence.
          Length = 660

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 48/153 (31%), Positives = 83/153 (54%), Gaps = 2/153 (1%)
 Frame = -3

Query: 701 SSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLK--QDIPGNGVKQQLENLFGIYSLYLI 528
           S E  + + + +L  A+  H ++ ++  F+ ++   +DIP   V   L +L   Y L  +
Sbjct: 510 SREVAWNKSAVELTRASRLHTRLFIIEAFMRRVSRIEDIPVKEVLTDLLHLHVNYELLDV 569

Query: 527 HKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGN 348
             +  +F+S+      Q     DQL      +RP+AV+LVD+F  +D  L S+LGR DGN
Sbjct: 570 ATYALEFMSS-----TQLDYIRDQLYLYLEKIRPSAVSLVDSFQISDMQLRSVLGRRDGN 624

Query: 347 VYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
           VY  L++ A   PLN+S V     +Y++P++++
Sbjct: 625 VYENLFKWAKSSPLNKSDVLPSVDKYLKPMMEK 657



>pir|T20570|T20570 hypothetical protein F08A8.4 - Caenorhabditis
           elegans>gb:CEF08A8_1362048 Caenorhabditis elegans cosmid
           F08A8, complete sequence.
          Length = 662

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 49/160 (30%), Positives = 85/160 (53%), Gaps = 2/160 (1%)
 Frame = -3

Query: 722 KNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLK--QDIPGNGVKQQLENLFG 549
           K + +  S E  + + + +L  A+  H ++ ++  F+ ++   +DIP   V   L +L  
Sbjct: 505 KLMESGESREIAWNKSTVELTRASRLHTRLFIIEAFMRRVSRIEDIPVKEVLTDLLHLHV 564

Query: 548 IYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
            Y L  +  +  +F+S+      Q     DQL      +RP+AV+LVD+F  +D  L S+
Sbjct: 565 NYELLDVATYALEFMSS-----TQLDYIRDQLYLYLEKIRPSAVSLVDSFQISDMQLRSV 619

Query: 368 LGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
           LGR DGNVY  L++ A   PLN+S V     +Y+ P++++
Sbjct: 620 LGRRDGNVYENLFKWAKSSPLNKSDVLPSVDKYLMPMMEK 659



>pir|T20568|T20568 hypothetical protein F08A8.2 - Caenorhabditis
           elegans>gb:CEF08A8_1362046 Caenorhabditis elegans cosmid
           F08A8, complete sequence.
          Length = 679

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 48/160 (30%), Positives = 84/160 (52%), Gaps = 2/160 (1%)
 Frame = -3

Query: 722 KNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLK--QDIPGNGVKQQLENLFG 549
           K + +  S E  + + + +L  A+  H ++ ++  F+ ++   +DIP   V   L +L  
Sbjct: 522 KLMESGESREVAWNKSAVELTRASRLHTRLFIIEAFMRRVSRIEDIPVKEVLTDLLHLHV 581

Query: 548 IYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
            Y L  +  +  +F+S       Q     DQL      +RPNAV+LVD+F  +D  L S+
Sbjct: 582 NYELLDVATYALEFMSF-----TQLDYVRDQLYLYLEKIRPNAVSLVDSFQISDMQLRSV 636

Query: 368 LGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
           LGR DG+VY  L++ A   PLN + V     +Y++P++++
Sbjct: 637 LGRRDGHVYENLFKWAKSSPLNNADVLPSVEKYLKPMMEK 676



>sp|P34355|CAOP_CAEEL Probable acyl-coenzyme A oxidase, peroxisomal
           (EC 1.3.3.6) (Acyl-CoA oxidase) (AOX).>pir|S40722|S40722
           probable acyl-CoA oxidase (EC 1.3.3.6) C48B4.1,
           peroxisomal - Caenorhabditis elegans>gb:CEC48B4_1361384
           Caenorhabditis elegans cosmid C48B4, complete sequence.
          Length = 659

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 45/143 (31%), Positives = 73/143 (51%)
 Frame = -3

Query: 686 FAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDF 507
           FA  S D  +AA AH ++ +   F++ + Q++    V   L  L  +Y  Y + +   D 
Sbjct: 515 FANHSVDWTKAARAHTKLFIARGFVKSV-QEVSDEAVHDVLTTLAELYLSYELIEMSADL 573

Query: 506 LSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
            + G ++         Q+       R NAV++VD+F+  D  L S+LGR DG+VY  LY+
Sbjct: 574 TANGYLSESDVQQIRHQIYDSMRKTRRNAVSIVDSFDICDRELRSVLGRRDGHVYENLYK 633

Query: 326 AAWKDPLNESVVPDGYHEYIRPL 258
            A   PLNE  +P    +Y++P+
Sbjct: 634 WAQMSPLNERNLPH-VEKYLKPM 655



>gb:CR382131_1663732 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 689

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 47/181 (25%), Positives = 81/181 (44%), Gaps = 4/181 (2%)
 Frame = -3

Query: 785  NPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIVVSK 618
            +P  ++ A+E  +  +I          A    S+   + ELS         H ++ +V  
Sbjct: 495  DPKVMIGAWETVSRALINRTTDEFEVLAKKGLSTAQAYEELSQQRFLCTRIHTRLYMVKN 554

Query: 617  FIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYT 438
            F E++ ++      K+ L  L  +Y+ + + +  G FL  G ITP++    + ++R    
Sbjct: 555  FYERIAEE-GTEFTKEPLTRLANLYAFWSVEEEAGIFLREGYITPQELKYISAEIRKQLL 613

Query: 437  LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
             VR + +   DAFN  D FL+S +GR DG+VY   ++        +   P  Y   IRP 
Sbjct: 614  EVRKDVIGYTDAFNVPDFFLNSAIGRADGDVYKNYFKVVNTQNPPQDPRPPYYESVIRPF 673

Query: 257  L 255
            L
Sbjct: 674  L 674



>gb:CEF08A8_1362045 Caenorhabditis elegans cosmid F08A8, complete
           sequence.
          Length = 562

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 44/156 (28%), Positives = 83/156 (53%)
 Frame = -3

Query: 716 LNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSL 537
           + N    E  + + S +L  A+  H ++ +V  F  ++ + I    +K+ L +L  ++  
Sbjct: 402 MENGEKREIAWNKSSVELNRASRLHTRLFIVEAFARRVNE-IGDITIKEALSDLLHLHVN 460

Query: 536 YLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           Y +       L  G ++  Q     DQL      +RPNAV+L+D++ ++D  L S+LGR 
Sbjct: 461 YELLDVATYALEDGFMSSTQLDYVRDQLYFYLQKIRPNAVSLLDSWEFSDRELRSVLGRR 520

Query: 356 DGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
           DG+VY  L++ A + PLN++ V      Y++P++++
Sbjct: 521 DGHVYENLFKWAKESPLNKTDVLPSVDTYLKPMMEK 556



>pir|T20571|T20571 hypothetical protein F08A8.1 - Caenorhabditis
           elegans>gb:CEF08A8_1362044 Caenorhabditis elegans cosmid
           F08A8, complete sequence.
          Length = 674

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 44/156 (28%), Positives = 83/156 (53%)
 Frame = -3

Query: 716 LNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSL 537
           + N    E  + + S +L  A+  H ++ +V  F  ++ + I    +K+ L +L  ++  
Sbjct: 514 MENGEKREIAWNKSSVELNRASRLHTRLFIVEAFARRVNE-IGDITIKEALSDLLHLHVN 572

Query: 536 YLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           Y +       L  G ++  Q     DQL      +RPNAV+L+D++ ++D  L S+LGR 
Sbjct: 573 YELLDVATYALEDGFMSSTQLDYVRDQLYFYLQKIRPNAVSLLDSWEFSDRELRSVLGRR 632

Query: 356 DGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
           DG+VY  L++ A + PLN++ V      Y++P++++
Sbjct: 633 DGHVYENLFKWAKESPLNKTDVLPSVDTYLKPMMEK 668



>gb:YLACO1_1727881 Yarrowia lipolytica ACO1 gene.
          Length = 689

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 45/181 (24%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = -3

Query: 788  MNPSAVLEAYEARAARMIASCAKNLNNFASS---EDGFAELSSDLVEAAVAHCQVIVVSK 618
            ++P  ++EA+   +   I            +   +  F ELS    + A  H +  ++S 
Sbjct: 497  LSPEFLVEAFRTASRNNILRTTDKYQELVKTLNPDQAFEELSQQRFQCARIHTRQHLISS 556

Query: 617  FIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYT 438
            F  ++      + +K  L  L  +++L+ I +  G FL    +TP    L N  +  L  
Sbjct: 557  FYARIAT--AKDDIKPHLLKLANLFALWSIEEDTGIFLRENILTPGDIDLINSLVDELCV 614

Query: 437  LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
             VR   + L DAF  +D F+++ +G YDGNVY K +    +     +  P  Y   ++P 
Sbjct: 615  AVRDQVIGLTDAFGLSDFFINAPIGSYDGNVYEKYFAKVNQQNPATNPRPPYYESTLKPF 674

Query: 257  L 255
            L
Sbjct: 675  L 675



>gb:CR382131_1664825 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 677

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 45/181 (24%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = -3

Query: 788  MNPSAVLEAYEARAARMIASCAKNLNNFASS---EDGFAELSSDLVEAAVAHCQVIVVSK 618
            ++P  ++EA+   +   I            +   +  F ELS    + A  H +  ++S 
Sbjct: 485  LSPEFLVEAFRTASRNNILRTTDKYQELVKTLNPDQAFEELSQQRFQCARIHTRQHLISS 544

Query: 617  FIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYT 438
            F  ++      + +K  L  L  +++L+ I +  G FL    +TP    L N  +  L  
Sbjct: 545  FYARIAT--AKDDIKPHLLKLANLFALWSIEEDTGIFLRENILTPGDIDLINSLVDELCV 602

Query: 437  LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEYIRPL 258
             VR   + L DAF  +D F+++ +G YDGNVY K +    +     +  P  Y   ++P 
Sbjct: 603  AVRDQVIGLTDAFGLSDFFINAPIGSYDGNVYEKYFAKVNQQNPATNPRPPYYESTLKPF 662

Query: 257  L 255
            L
Sbjct: 663  L 663



>pir|T21329|T21329 hypothetical protein F25C8.1 - Caenorhabditis
           elegans>gb:CEF25C8_1362909 Caenorhabditis elegans cosmid
           F25C8, complete sequence.
          Length = 601

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 46/143 (32%), Positives = 78/143 (54%), Gaps = 3/143 (2%)
 Frame = -3

Query: 674 SSDLVEAAVAHCQVIVVSKFIEKL---KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFL 504
           S +L +AA  H ++ +V  F++K+    +D+    V + L NL+ I+ L + +K  G F+
Sbjct: 457 SIELCKAARWHVRLYIVRNFLQKVCTAPKDL--QPVLRALSNLY-IFDLQVSNK--GHFM 511

Query: 503 STGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEA 324
             G +T +Q       +    + +RP+AV++VD F   +  L S+LGR DGNVYP L+E 
Sbjct: 512 ENGYMTSQQIDQLKMGINESLSTIRPDAVSIVDGFAIHEFELKSVLGRRDGNVYPGLFEW 571

Query: 323 AWKDPLNESVVPDGYHEYIRPLL 255
                LN   V   + +Y+ P++
Sbjct: 572 TKHSQLNNKEVHPAFDKYLTPIM 594



>gb:CR382130_1663339 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.>gb:YLACO3_1727883 Yarrowia
            lipolytica ACO3 gene.
          Length = 700

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 48/185 (25%), Positives = 80/185 (43%), Gaps = 4/185 (2%)
 Frame = -3

Query: 797  KDWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVI 630
            +D  +P  ++EA+E  A   I               S +  F ELS    + A  H +  
Sbjct: 502  RDLKDPKVLIEAWEKVANGAIQRATDKFVELTKGGLSPDQAFEELSQQRFQCAKIHTRKH 561

Query: 629  VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLR 450
            +V+ F E++      + VK  L NL  +++L+ I +  G FL  G + PK      + + 
Sbjct: 562  LVTAFYERINASAKAD-VKPYLINLANLFTLWSIEEDSGLFLREGFLQPKDIDQVTELVN 620

Query: 449  ALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDGYHEY 270
                 VR       DAF  +D F+++ +G YDG+VY   +    +    ++  P  Y   
Sbjct: 621  HYCKEVRDQVAGYTDAFGLSDWFINAPIGNYDGDVYKHYFAKVNQQNPAQNPRPPYYEST 680

Query: 269  IRPLL 255
            +RP L
Sbjct: 681  LRPFL 685



>gb:CR380947_1649149 Candida glabrata strain CBS138 chromosome A
            complete sequence.
          Length = 748

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 52/178 (29%), Positives = 85/178 (47%), Gaps = 13/178 (7%)
 Frame = -3

Query: 722  KNLNNFASSEDGFAEL---SSDLVEAAVAHCQVIVVSKFIEKLKQD----IPGNGVKQQL 564
            K L + A   D   +L   S  LV  +  H   ++++ + EKL       +     K+QL
Sbjct: 560  KLLRHIAKQVDSTKDLDGASKLLVLVSKFHALYVMLNTYYEKLNSPTDSYVTCPKTKEQL 619

Query: 563  ENLFGIYSLYLIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTD 387
             N++ ++SLY I KH G+F     ++P Q S +   +L  L   +R   ++L D+F + D
Sbjct: 620  WNVYKLFSLYFIDKHAGEFQQFKILSPDQISQVVQPRLLKLLPEIRKECISLTDSFKWPD 679

Query: 386  HFLDSILGRYDGNVYPKLYEAAWKDPLNESVVPDG-----YHEYIRPLLKQQLRMARL 228
              L++ +G YDG++Y   +    K   N  V  DG     YHE +  +L +    ARL
Sbjct: 680  GMLNAPIGYYDGDIYHNYFNEVVK---NNPVEKDGAGIPPYHELLANMLTRGDEFARL 734



>gb:AE014298_1124607 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003439_1209789 Drosophila melanogaster
           chromosome X, section 23 of 74 of the complete
           sequence.>gb:AY118566_1300288 Drosophila melanogaster
           LD40103 full insert cDNA.
          Length = 677

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 46/147 (31%), Positives = 72/147 (48%), Gaps = 6/147 (4%)
 Frame = -3

Query: 665 LVEAAVAHCQVIVVSKFIEKL-----KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
           L  AA+AH         +E++     K D+  N V   L  L  ++ +    +  G  L 
Sbjct: 532 LTSAAIAHAHAFFTRNALEQVEALRKKGDLSPN-VSLILGQLVELFVIDTFLRQSGCVLR 590

Query: 500 -TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEA 324
               IT  Q      +   L   +RPNAVALVD F++ D  L S LG +DG VY +L E 
Sbjct: 591 WNNGITGTQLRFVERRFEELLAKLRPNAVALVDGFDFHDRVLGSTLGCHDGRVYERLMEE 650

Query: 323 AWKDPLNESVVPDGYHEYIRPLLKQQL 243
           A ++P+N+  V   +H ++ P+++ +L
Sbjct: 651 ARRNPINQEPVNSSFHNHLLPMMRGKL 677



>gb:AE017347_1757659 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 702

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 56/187 (29%), Positives = 86/187 (45%), Gaps = 9/187 (4%)
 Frame = -3

Query: 779  SAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQVIVVSKFI 612
            S +  A+   AA +I   A+   ++     S E      S     AA  H    + + F 
Sbjct: 483  SDIKRAWNCVAANVIKKAAEEYVSYLKAGKSKEVAMEMCSQSRFIAAKVHTVGYIFTMFK 542

Query: 611  EKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLV 432
            E + +D+  +   + L  +  +Y L+ I + QG FL  G  T +Q       +  L   V
Sbjct: 543  EAV-EDMEESAETEILRTVAKLYGLWQIEEQQGYFLKYGYFTAEQMDKVQTSVDGLCAEV 601

Query: 431  RPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY-EAAWKDPLNESVVPDGYHEY----I 267
            R  AV LVDAF  +DH L+S LG+YDG+VY   + +    +PL +       H Y    I
Sbjct: 602  RTIAVPLVDAFALSDHILNSPLGKYDGSVYESYFSQVQAANPLPKE------HPYFTRLI 655

Query: 266  RPLLKQQ 246
            +PLL++Q
Sbjct: 656  KPLLERQ 662



>gb:CR382129_1662276 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.>gb:YLACO5_1727885 Yarrowia
            lipolytica ACO5 gene.
          Length = 699

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 56/208 (26%), Positives = 92/208 (44%), Gaps = 9/208 (4%)
 Frame = -3

Query: 851  YMGRLQQLLQCRSNVQQA----KDWMNPSAVLEAYEARAARMIA----SCAKNLNNFASS 696
            ++G+  + LQ R  +Q A    K   +P+ ++ A+E  A   I     S  K      S 
Sbjct: 481  HVGKSVEYLQRRDELQNARVDNKPLTDPAVLITAWEKVACEAINRATDSFIKLTQEGLSP 540

Query: 695  EDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQ 516
            +  F ELS    E A  H +  +++ F  ++ +      VK  L  L  +++++ I +  
Sbjct: 541  DQAFEELSQQRFECARIHTRKHLITSFYARISK--AKARVKPHLTVLANLFAVWSIEEDS 598

Query: 515  GDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            G FL  GC  P +       +  L    R   +   DAFN +D F+++ +GR+DG+ Y K
Sbjct: 599  GLFLREGCFEPAEMDEITALVDELCCEAREQVIGFTDAFNLSDFFINAPIGRFDGDAY-K 657

Query: 335  LYEAAWKDPLNESVVPDGYHE-YIRPLL 255
             Y    K   N       Y+E  +RP L
Sbjct: 658  HYMDEVKAANNPRNTHAPYYETKLRPFL 685



>gb:CR382136_1669397 Debaryomyces hansenii chromosome D of strain
            CBS767 of Debaryomyces hansenii.
          Length = 706

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/176 (23%), Positives = 84/176 (47%), Gaps = 2/176 (1%)
 Frame = -3

Query: 851  YMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELS 672
            ++   +Q L     ++   D  +   VL A E    R+    ++ L     ++  F  + 
Sbjct: 488  FLNNTEQYLNEEPVLRSVDDLKDLKKVLLAIEVAIIRVAYQASQTLKE---NKGDFDTVG 544

Query: 671  SDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQGDFLSTG 495
            +++V  +  +    ++S+F++++        +   LE++  +YS  ++  K  GDFL+ G
Sbjct: 545  AEMVTLSKLNAHHFMLSEFLDRM-DSFESKQLVPYLESVAKLYSATIVLEKFAGDFLAQG 603

Query: 494  CITPK-QASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
               PK    L +  +  L   +RPN +AL D+F  +D  ++S +G YDGN+Y   +
Sbjct: 604  VFPPKLNGELNSKHIPELCKEIRPNVIALTDSFQQSDMMINSAIGSYDGNIYENYF 659



>gb:YSCPOX1_1730332 Yeast (S.cerevisiae) acyl-coenzyme A oxidase
            (POX1) gene, complete cds.
          Length = 748

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 9/150 (6%)
 Frame = -3

Query: 677  LSSDLVEAAVAHCQVIVVSKFIEKLKQ---DIPGNGVKQQLENLFGIYSLYLIHKHQGDF 507
            +S  LV  +  H    ++  + +KL      I     K+ + N++ ++SLY I KH G+F
Sbjct: 578  VSKLLVLVSKFHALRCMLKTYYDKLNSRDSHISDEITKESMWNVYKLFSLYFIDKHSGEF 637

Query: 506  LSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
                  TP Q S +   QL AL  +VR + + L D+F   D  L+S +G +DG++Y   +
Sbjct: 638  QQFKIFTPDQISKVVQPQLLALLPIVRKDCIGLTDSFELPDAMLNSPIGYFDGDIYHNYF 697

Query: 329  EAAWKDPLNESVVPDG-----YHEYIRPLL 255
                +   N  V  DG     YH  +  +L
Sbjct: 698  NEVCR---NNPVEADGAGKPSYHALLSSML 724



>gb:SCYGL204C_1712132 S.cerevisiae chromosome VII reading frame ORF
           YGL204c.
          Length = 456

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 9/150 (6%)
 Frame = -3

Query: 677 LSSDLVEAAVAHCQVIVVSKFIEKLKQ---DIPGNGVKQQLENLFGIYSLYLIHKHQGDF 507
           +S  LV  +  H    ++  + +KL      I     K+ + N++ ++SLY I KH G+F
Sbjct: 286 VSKLLVLVSKFHALRCMLKTYYDKLNSRDSHISDEITKESMWNVYKLFSLYFIDKHSGEF 345

Query: 506 LSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
                 TP Q S +   QL AL  +VR + + L D+F   D  L+S +G +DG++Y   +
Sbjct: 346 QQFKIFTPDQISKVVQPQLLALLPIVRKDCIGLTDSFELPDAMLNSPIGYFDGDIYHNYF 405

Query: 329 EAAWKDPLNESVVPDG-----YHEYIRPLL 255
               +   N  V  DG     YH  +  +L
Sbjct: 406 NEVCR---NNPVEADGAGKPSYHALLSSML 432



>sp|P13711|CAO_YEAST Acyl-coenzyme A oxidase (EC 1.3.3.6) (Acyl-CoA
            oxidase).>pir|S64224|S64224 acyl-CoA oxidase (EC
            1.3.3.6), peroxisomal - yeast  (Saccharomyces
            cerevisiae)>gb:SCYGL205W_1712134 S.cerevisiae chromosome
            VII reading frame ORF YGL205w.
          Length = 748

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 9/150 (6%)
 Frame = -3

Query: 677  LSSDLVEAAVAHCQVIVVSKFIEKLKQ---DIPGNGVKQQLENLFGIYSLYLIHKHQGDF 507
            +S  LV  +  H    ++  + +KL      I     K+ + N++ ++SLY I KH G+F
Sbjct: 578  VSKLLVLVSKFHALRCMLKTYYDKLNSRDSHISDEITKESMWNVYKLFSLYFIDKHSGEF 637

Query: 506  LSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
                  TP Q S +   QL AL  +VR + + L D+F   D  L+S +G +DG++Y   +
Sbjct: 638  QQFKIFTPDQISKVVQPQLLALLPIVRKDCIGLTDSFELPDAMLNSPIGYFDGDIYHNYF 697

Query: 329  EAAWKDPLNESVVPDG-----YHEYIRPLL 255
                +   N  V  DG     YH  +  +L
Sbjct: 698  NEVCR---NNPVEADGAGKPSYHALLSSML 724



>gb:AY766151_1433735 Ovibos moschatus acyl-CoA oxidase gene, partial
           cds.
          Length = 135

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 42/112 (37%), Positives = 59/112 (52%), Gaps = 4/112 (3%)
 Frame = -3

Query: 800 AKDWMNPSAVLEAYEARAARMIASCAKNLNNFA----SSEDGFAELSSDLVEAAVAHCQV 633
           A D  +  ++ EAY+ RAAR++   AKNL N      S E  +   S DLV A+ AHC  
Sbjct: 22  AVDLNSSDSLTEAYKLRAARLVEIAAKNLQNEVIRRKSKEVAWNLTSIDLVRASEAHCHY 81

Query: 632 IVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQ 477
           + V  F EK+ Q I    ++  L  L  +YSL+ I ++ GDFL    +T  Q
Sbjct: 82  VAVKLFTEKVLQ-IQEKSIQAVLRRLCLLYSLFGISQNAGDFLQGSIMTESQ 132



>gb:AE016818_1748502 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 721

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 37/137 (27%), Positives = 68/137 (49%), Gaps = 3/137 (2%)
 Frame = -3

Query: 743 RMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQD---IPGNGVK 573
           + +  CA+ + +    E     +S  LV  A  H    ++ +F  KL  D   +     K
Sbjct: 550 KYLKRCAETVRDNNDPES----VSKLLVSIAKFHAFYSMLQEFHRKLASDQSHVGDAATK 605

Query: 572 QQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNY 393
           + L  ++ + SLY I K  G+F     ++P Q +   +Q+ A+   ++ +A+ L DAF+ 
Sbjct: 606 EVLWKVYKLSSLYFIDKFSGEFQQLKVMSPDQMTNVQEQMLAILPEIKTHAIRLTDAFHL 665

Query: 392 TDHFLDSILGRYDGNVY 342
            D  ++S +G YDG++Y
Sbjct: 666 PDAVINSSIGNYDGDIY 682



>gb:YSAPOX5_1728151 Candida tropicalis acyl-coenzyme A oxidase I
           precursor, gene, complete cds.
          Length = 662

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 1/157 (0%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
           D  +P+ +++A++      ++  A+++   A  + GF      LV  +  +    ++  F
Sbjct: 470 DLDDPAKLVKAFD----HALSGLARDIGAVAEDK-GFDITGPSLVLVSKLNAHRFLIDGF 524

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQA-SLANDQLRALYT 438
            +++  +       + L  L  +Y+ +++      FL  G ITP  +  ++++   AL  
Sbjct: 525 FKRITPEW-----SEVLRPLGFLYADWILTNFGATFLQYGIITPDVSRKISSEHFPALCA 579

Query: 437 LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
            VRPN V L D FN TD   ++ +GRYDGNVY   +E
Sbjct: 580 KVRPNVVGLTDGFNLTDMMTNAAIGRYDGNVYEHYFE 616



>pir|B25123|OXCKX5 acyl-CoA oxidase (EC 1.3.3.6) POX5, peroxisomal -
           yeast  (Candida tropicalis)
          Length = 662

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 1/157 (0%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
           D  +P+ +++A++      ++  A+++   A  + GF      LV  +  +    ++  F
Sbjct: 470 DLDDPAKLVKAFD----HALSGLARDIGAVAEDK-GFDITGPSLVLVSKLNAHRFLIDGF 524

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQA-SLANDQLRALYT 438
            +++  +       + L  L  +Y+ +++      FL  G ITP  +  ++++   AL  
Sbjct: 525 FKRITPEW-----SEVLRPLGFLYADWILTNFGATFLQYGIITPDVSRKISSEHFPALCA 579

Query: 437 LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
            VRPN V L D FN TD   ++ +GRYDGNVY   +E
Sbjct: 580 KVRPNVVGLTDGFNLTDMMTNAAIGRYDGNVYEHYFE 616



>sp|P08790|CAO1_CANTR Acyl-coenzyme A oxidase I (EC 1.3.3.6)
           (Acyl-CoA oxidase) (PXP-5).
          Length = 661

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 1/157 (0%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
           D  +P+ +++A++      ++  A+++   A  + GF      LV  +  +    ++  F
Sbjct: 469 DLDDPAKLVKAFD----HALSGLARDIGAVAEDK-GFDITGPSLVLVSKLNAHRFLIDGF 523

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQA-SLANDQLRALYT 438
            +++  +       + L  L  +Y+ +++      FL  G ITP  +  ++++   AL  
Sbjct: 524 FKRITPEW-----SEVLRPLGFLYADWILTNFGATFLQYGIITPDVSRKISSEHFPALCA 578

Query: 437 LVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
            VRPN V L D FN TD   ++ +GRYDGNVY   +E
Sbjct: 579 KVRPNVVGLTDGFNLTDMMTNAAIGRYDGNVYEHYFE 615



>pir|A27331|OXCKP2 acyl-CoA oxidase (EC 1.3.3.6) PXP2, peroxisomal -
            yeast  (Candida tropicalis)>gb:YSAPOX2_1728149
            C.tropicalis POX2 gene encoding PXP-2 protein, complete
            cds.
          Length = 724

 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 50/208 (24%), Positives = 98/208 (47%), Gaps = 4/208 (1%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNP-SAVLEAYEARAARMIASCAKNLNNFASSEDGF 684
            T  ++    +L + +  V + +D ++    VL+A     A +I+  +K+L     S   +
Sbjct: 503  TLEFLNAAPELSKAKKAVIRIRDHVDDVDRVLKAI----AGLISKFSKDL--IPISYQSW 556

Query: 683  AELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNG-VKQQLENLFGIYSLY-LIHKHQGD 510
              + +  V  +   C   ++  F E+L   I      +  LEN+  +Y +  ++     +
Sbjct: 557  DSIGAQRVILSKLRCHYYLLETFNERLNDKIKAKSPARPHLENIIKLYYVTNILGPFIDE 616

Query: 509  FLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
            FL  G I+P+ A  +  +  + L   +RP  + L D+F   D+F++S++G+YDGN+Y   
Sbjct: 617  FLRFGVISPQVAKYITYEYPQKLCANIRPYVIGLTDSFQQPDNFINSLIGKYDGNIYTNY 676

Query: 332  YEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
             E+  KD  + S     Y E +  +L +
Sbjct: 677  LESV-KDVNDPSNYKAPYSEALEAMLNR 703



>sp|P11356|CAO4_CANTR Acyl-coenzyme A oxidase PXP-2 (EC 1.3.3.6)
            (Acyl-CoA oxidase).
          Length = 723

 Score = 59.7 bits (143), Expect = 7e-08
 Identities = 50/208 (24%), Positives = 98/208 (47%), Gaps = 4/208 (1%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNP-SAVLEAYEARAARMIASCAKNLNNFASSEDGF 684
            T  ++    +L + +  V + +D ++    VL+A     A +I+  +K+L     S   +
Sbjct: 502  TLEFLNAAPELSKAKKAVIRIRDHVDDVDRVLKAI----AGLISKFSKDL--IPISYQSW 555

Query: 683  AELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNG-VKQQLENLFGIYSLY-LIHKHQGD 510
              + +  V  +   C   ++  F E+L   I      +  LEN+  +Y +  ++     +
Sbjct: 556  DSIGAQRVILSKLRCHYYLLETFNERLNDKIKAKSPARPHLENIIKLYYVTNILGPFIDE 615

Query: 509  FLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
            FL  G I+P+ A  +  +  + L   +RP  + L D+F   D+F++S++G+YDGN+Y   
Sbjct: 616  FLRFGVISPQVAKYITYEYPQKLCANIRPYVIGLTDSFQQPDNFINSLIGKYDGNIYTNY 675

Query: 332  YEAAWKDPLNESVVPDGYHEYIRPLLKQ 249
             E+  KD  + S     Y E +  +L +
Sbjct: 676  LESV-KDVNDPSNYKAPYSEALEAMLNR 702



>gb:HVCDR29_1682305 H.vulgare cdr29 gene.
          Length = 275

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 24/46 (52%), Positives = 33/46 (71%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCA 723
           T AYMG +  L+QC+S V  A+DW+NP+ V + +EARA RM  +CA
Sbjct: 90  TVAYMGNIHHLMQCKSAVNTAEDWLNPATVKKVFEARALRMAVNCA 135



>pir|T04480|T04480 acyl-CoA oxidase homolog - barley (fragment)
          Length = 275

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 24/46 (52%), Positives = 33/46 (71%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCA 723
           T AYMG +  L+QC+S V  A+DW+NP+ V + +EARA RM  +CA
Sbjct: 90  TVAYMGNIHHLMQCKSAVNTAEDWLNPATVKKVFEARALRMAVNCA 135



>gb:CR382126_1658796 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 736

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 5/137 (3%)
 Frame = -3

Query: 677 LSSDLVEAAVAHCQVIVVSKFIEKLKQD----IPGNGVKQQLENLFGIYSLYLIHKHQGD 510
           LS  LV+ +  H    ++  + +KL  +    +     K  L  L+ ++SLY I +H G+
Sbjct: 566 LSKTLVQISKFHAIHSMLLTYQDKLNNESEASVKDAYTKGYLWKLYELFSLYFIDQHLGE 625

Query: 509 FLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
           FL    +T  Q S +   +L  L   +R   +AL DAF   D  +++ +G YDG++Y   
Sbjct: 626 FLLLKVVTSDQMSQVLQPRLLQLLPEIRKECIALTDAFKLPDAMINAPIGYYDGDIYHNY 685

Query: 332 YEAAWKDPLNESVVPDG 282
           +        N  + PDG
Sbjct: 686 FNEVTN---NNKLEPDG 699



>sp|Q00468|CAO2_CANMA Acyl-coenzyme A oxidase POX2 (EC 1.3.3.6)
           (Acyl-CoA oxidase) (AOX).>pir|JC4563|JC4563 acyl-CoA
           oxidase (EC 1.3.3.6) - yeast (Candida
           maltosa)>gb:YSAACO_1728054 Candida maltosa gene for acyl
           coA oxidase, complete cds.
          Length = 724

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 3/138 (2%)
 Frame = -3

Query: 746 ARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNG-VKQ 570
           A +I+  AK+L     S   +  +    V  +   C   ++  F E+L   I      + 
Sbjct: 538 AGLISKYAKDL--IPVSYQSWDSIGPQRVVLSKFRCHYYLLETFNERLNDRIKAKSPARP 595

Query: 569 QLENLFGIYSLY-LIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFN 396
            LEN+  +Y +  ++     +FL  G I+P  A  +  +  + L   +RP  + L D+F 
Sbjct: 596 HLENIIKLYYVTNVLGPFIDEFLRFGVISPSVAKYITTEYPQKLCAAIRPYVIGLTDSFQ 655

Query: 395 YTDHFLDSILGRYDGNVY 342
             D+F++S++GRYDGNVY
Sbjct: 656 QPDNFINSLIGRYDGNVY 673



>gb:CR858922_1183065 Pongo pygmaeus mRNA; cDNA DKFZp469G0723 (from
            clone DKFZp469G0723).
          Length = 700

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 6/183 (3%)
 Frame = -3

Query: 854  AYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAEL 675
            AY G L Q  +    V    D ++ +  L AY+     ++    + LN    S     E 
Sbjct: 491  AYPGILDQKFE----VSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEA 546

Query: 674  SSDLVEA-----AVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             +    +     A+A  ++ VV +F E + Q      ++  L  L  +Y+L+ + +H   
Sbjct: 547  RNKCQVSHGRPLALAFVELTVVQRFHEHVHQPCVPPSLRAVLGRLSALYALWSLSRHAAL 606

Query: 509  FLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
                G  + +QA  +    + AL + ++ +AVALVD     D  LDS +GR DG +Y  L
Sbjct: 607  LYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFILDSPIGRADGELYKNL 666

Query: 332  YEA 324
            + A
Sbjct: 667  WGA 669



>gb:AB013395_1512157 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.
          Length = 692

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 3/137 (2%)
 Frame = -3

Query: 785 NPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELS---SDLVEAAVAHCQVIVVSKF 615
           +P   L+A+  R +R++ + A  L   + +  GF   +   + L+  A +H + ++++KF
Sbjct: 535 DPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHLLTLAESHIETVILAKF 594

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTL 435
           IE +K + P    K  L+    +Y+L  I K  G + +   + P +A   +     L   
Sbjct: 595 IEAVK-NCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLTEYLSFQ 653

Query: 434 VRPNAVALVDAFNYTDH 384
           VR  A  LVDAF   DH
Sbjct: 654 VRNVAKELVDAFELPDH 670



>pir|T52120|T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal
           [validated] - Arabidopsis thaliana>gb:AF057043_1764769
           Arabidopsis thaliana acyl-CoA oxidase (ACX2) mRNA,
           complete cds.
          Length = 692

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 3/137 (2%)
 Frame = -3

Query: 785 NPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELS---SDLVEAAVAHCQVIVVSKF 615
           +P   L+A+  R +R++ + A  L   + +  GF   +   + L+  A +H + ++++KF
Sbjct: 535 DPKFQLDAFRYRTSRLLQNVAARLQKHSKTLGGFGAWNRCLNHLLTLAESHIETVILAKF 594

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTL 435
           IE +K + P    K  L+    +Y+L  I K  G + +   + P +A   +     L   
Sbjct: 595 IEAVK-NCPDPSAKAALKLACDLYALDRIWKDIGTYRNVDYVAPNKAKAIHKLTEYLSFQ 653

Query: 434 VRPNAVALVDAFNYTDH 384
           VR  A  LVDAF   DH
Sbjct: 654 VRNVAKELVDAFELPDH 670



>sp|O15254|CAO3_HUMAN Acyl-coenzyme A oxidase 3, peroxisomal (EC
            1.3.3.6) (Pristanoyl-CoA oxidase).>gb:HSPRCOX_2019711
            H.sapiens mRNA for pristanoyl-CoA oxidase.
          Length = 700

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 48/187 (25%), Positives = 83/187 (44%), Gaps = 6/187 (3%)
 Frame = -3

Query: 854  AYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAEL 675
            AY G L Q  +    V    D ++ +  L AY+     ++    + LN    S     E 
Sbjct: 491  AYPGILDQKFE----VSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEA 546

Query: 674  SSDLVEA-----AVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             +    +     A+A  ++ VV +F E + Q      ++  L  L  +Y+L+ + +H   
Sbjct: 547  RNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLKRHAAL 606

Query: 509  FLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
                G  + +QA  +    + AL + ++ +AVALVD     D  LDS +GR DG +Y  L
Sbjct: 607  LYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNL 666

Query: 332  YEAAWKD 312
            + A  ++
Sbjct: 667  WGAVLQE 673



>gb:AE016822_341096 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 688

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 40/139 (28%), Positives = 68/139 (48%), Gaps = 6/139 (4%)
 Frame = -3

Query: 791 WM-NPSAVLEAYEARAARMIASCAKNLNNFA-----SSEDGFAELSSDLVEAAVAHCQVI 630
           W+ +P+   E    R   MI+  A +L   +     ++ + F    ++L+EAA AH +++
Sbjct: 506 WLQDPATQRELLTDRVETMISQIAGHLRPASKLDRKAAAELFNSQQNELIEAAQAHGELL 565

Query: 629 VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLR 450
               F + L+Q     G KQ L  L  ++   LI K    +L  G ++P++       + 
Sbjct: 566 QWESFTDALEQTRDA-GTKQVLTWLRDLFGFGLIEKRLAWYLVNGRLSPQRGQAVTAYIG 624

Query: 449 ALYTLVRPNAVALVDAFNY 393
            L T +RP+A+ LVDAF Y
Sbjct: 625 RLLTRIRPHAIDLVDAFGY 643



>gb:AY071328_1295412 Drosophila melanogaster RE34879 full length cDNA.
          Length = 657

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 44/190 (23%), Positives = 76/190 (40%), Gaps = 6/190 (3%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            T +++  +  +LQ +   +   + ++P  +L A        + +  K +           
Sbjct: 445  TVSFLKDMDTILQSKGQERTPAEVLDPLNLLNALNWLTVWQLDTTVKRVEEQQREGKDAF 504

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIE----KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQG 513
            E  +++   A     +I   + I     K    +P +  K+ L+ +   Y  +L+ K+  
Sbjct: 505  ETRNNIQVFAAQKLSIIYGERTIYYVFYKFVIGLPDSAEKKVLQQVLSFYGAHLVTKYSA 564

Query: 512  DFLSTGCI--TPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYP 339
             F   G       Q  L    + AL  L++  A+ALVDA   TD  L+S LG  DGNVY 
Sbjct: 565  AFYRGGYFRENSNQLELYEQGILALLPLLKNEAIALVDAIAPTDFILNSPLGMSDGNVYQ 624

Query: 338  KLYEAAWKDP 309
             L       P
Sbjct: 625  HLQRTLVSTP 634



>gb:AE014134_1127829 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003613_1217936 Drosophila melanogaster
            chromosome 2L, section 22 of 83 of the complete sequence.
          Length = 703

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 44/190 (23%), Positives = 76/190 (40%), Gaps = 6/190 (3%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            T +++  +  +LQ +   +   + ++P  +L A        + +  K +           
Sbjct: 491  TVSFLKDMDTILQSKGQERTPAEVLDPLNLLNALNWLTVWQLDTTVKRVEEQQREGKDAF 550

Query: 680  ELSSDLVEAAVAHCQVIVVSKFIE----KLKQDIPGNGVKQQLENLFGIYSLYLIHKHQG 513
            E  +++   A     +I   + I     K    +P +  K+ L+ +   Y  +L+ K+  
Sbjct: 551  ETRNNIQVFAAQKLSIIYGERTIYYVFYKFVIGLPDSAEKKVLQQVLSFYGAHLVTKYSA 610

Query: 512  DFLSTGCI--TPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYP 339
             F   G       Q  L    + AL  L++  A+ALVDA   TD  L+S LG  DGNVY 
Sbjct: 611  AFYRGGYFRENSNQLELYEQGILALLPLLKNEAIALVDAIAPTDFILNSPLGMSDGNVYQ 670

Query: 338  KLYEAAWKDP 309
             L       P
Sbjct: 671  HLQRTLVSTP 680



>pir|T28847|T28847 hypothetical protein F58F9.7 - Caenorhabditis
           elegans>gb:U58756_1405381 Caenorhabditis elegans cosmid
           F58F9, complete sequence.
          Length = 667

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 40/150 (26%), Positives = 69/150 (46%), Gaps = 1/150 (0%)
 Frame = -3

Query: 773 VLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQD 594
           +L+   A A R+ AS     N+F    +     + +L  A   H  +  V +F+++++  
Sbjct: 496 LLQTTSAEAYRLKAS---GKNSFEVRNEIQIHRAVNLSVAYTEHTMIHWVQQFLKEIEDQ 552

Query: 593 IPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITP-KQASLANDQLRALYTLVRPNAV 417
                VK  L+ +  ++SL+L+ +H      TG  +  K      ++LR     ++P A+
Sbjct: 553 ----SVKPVLQKVLNLFSLFLLERHLATLYITGYASGGKFGEDLREKLRLAVAELKPEAI 608

Query: 416 ALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
           ALVD+    D  L S LG  DG  Y  + E
Sbjct: 609 ALVDSIAPDDFILHSALGASDGKAYEHIME 638



>gb:BC054613_2551023 Danio rerio zgc:64087, mRNA (cDNA clone MGC:64087
            IMAGE:6794774), complete cds.
          Length = 692

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 44/187 (23%), Positives = 81/187 (43%), Gaps = 10/187 (5%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFA 681
            T  ++  +  +LQ +  V   ++ MN +  L AY+     ++    K L    SS  G  
Sbjct: 477  TVNFLDDMSSILQSKFTVGSVEECMNSAVPLAAYKWLVCFLLGESQKKLFEEKSSGLGDF 536

Query: 680  ELSSDLV-----EAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKH- 519
            E  ++         A+A  +  V+ +F + ++ +     ++  L  L  +Y L+ +  H 
Sbjct: 537  EARNNSQVYYCRSLAIAFIEHTVLQRFHDLIQDEQTPAVLRSVLGRLCALYGLWTLTNHM 596

Query: 518  ----QGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDG 351
                QG + S G    +        +  L   ++ +AVALVD F   D  L+S +G+ DG
Sbjct: 597  AILYQGGYFSGG----QPVDFIQTAILTLCGQLKDDAVALVDVFAPPDFILNSPIGKSDG 652

Query: 350  NVYPKLY 330
             +Y  L+
Sbjct: 653  ELYKNLW 659



>sp|Q63448|CAO3_RAT Acyl-coenzyme A oxidase 3, peroxisomal (EC
            1.3.3.6) (Pristanoyl-CoA oxidase).>gb:RNPRCOX_2136246
            R.norvegicus mRNA for Pristanoyl-CoA Oxidase.
          Length = 700

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 49/183 (26%), Positives = 77/183 (42%), Gaps = 6/183 (3%)
 Frame = -3

Query: 854  AYMGRLQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIA-SCAKNLNNFASSEDGFAE 678
            AY G L Q     S      DW++  A L AY      ++  S  +      S    F  
Sbjct: 491  AYPGILGQKFMASSKA----DWLDSEAPLAAYRWLVCYLLRESHQRYCQEKKSRGSDFEA 546

Query: 677  LSSDLVEA----AVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGD 510
             ++  V      A+A  ++ V+ +F E          ++  L  L  +Y L+ + +H   
Sbjct: 547  RNNSQVYGCRPLALAFMELTVMQRFHEHTHSSSVPPSLRTVLGRLSMLYGLWCLSQHTAL 606

Query: 509  FLSTGCITPKQASLA-NDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKL 333
                G I+ +Q   A  D +  L   ++ +AVALVDA   +D  L S +GR DG +Y  L
Sbjct: 607  LYRGGYISGEQTGKAMEDAILMLCVQLKDDAVALVDAIAPSDFVLGSPIGRADGELYKNL 666

Query: 332  YEA 324
            + A
Sbjct: 667  WAA 669



>gb:YSAAOX_1728068 Candida tropicalis peroxisomal fatty acyl-CoA
            oxidase (AOx) gene, complete cds.
          Length = 709

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
            +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 487  STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 541

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
             F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 542  SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 600

Query: 512  DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
             FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 601  VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 660

Query: 335  LYE 327
             ++
Sbjct: 661  YFD 663



>gb:CTPOX42_1674227 Candida tropicalis mRNA fragment for
           acyl-coenzyme A oxidase.
          Length = 308

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
           +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 86  STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 140

Query: 689 GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
            F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 141 SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 199

Query: 512 DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 200 VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 259

Query: 335 LYE 327
            ++
Sbjct: 260 YFD 262



>gb:CTPOX42_1674226 Candida tropicalis mRNA fragment for
           acyl-coenzyme A oxidase.
          Length = 396

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
           +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 174 STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 228

Query: 689 GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
            F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 229 SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 287

Query: 512 DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 288 VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 347

Query: 335 LYE 327
            ++
Sbjct: 348 YFD 350



>pir|A29047|OXCKX acyl-CoA oxidase (EC 1.3.3.6) AOx, peroxisomal -
            yeast  (Candida tropicalis)
          Length = 709

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
            +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 487  STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 541

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
             F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 542  SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 600

Query: 512  DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
             FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 601  VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 660

Query: 335  LYE 327
             ++
Sbjct: 661  YFD 663



>pir|A28584|OXCKAX acyl-CoA oxidase (EC 1.3.3.6) POX4-2, peroxisomal
           - yeast  (Candida tropicalis) (fragment)
          Length = 502

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
           +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 280 STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 334

Query: 689 GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
            F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 335 SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 393

Query: 512 DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 394 VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 453

Query: 335 LYE 327
            ++
Sbjct: 454 YFD 456



>sp|P11355|CAO3_CANTR Acyl-coenzyme A oxidase POX4-2 (EC 1.3.3.6)
           (Acyl-CoA oxidase) (Fragment).>gb:CTPOX42_1674225
           Candida tropicalis mRNA fragment for acyl-coenzyme A
           oxidase.
          Length = 502

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860 TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
           +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 280 STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 334

Query: 689 GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
            F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 335 SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 393

Query: 512 DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 394 VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 453

Query: 335 LYE 327
            ++
Sbjct: 454 YFD 456



>sp|P06598|CAO2_CANTR Acyl-coenzyme A oxidase II (EC 1.3.3.6)
            (Acyl-CoA oxidase) (PXP-4) (Peroxisomal fatty acyl-CoA
            oxidase).
          Length = 708

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 40/183 (21%), Positives = 88/183 (48%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
            +TA++ +L++     S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 486  STAFLNQLKEYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 540

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
             F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 541  SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKELAPYLITLGKLYAATIVLDRFAG 599

Query: 512  DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
             FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 600  VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 659

Query: 335  LYE 327
             ++
Sbjct: 660  YFD 662



>gb:CR382135_1667744 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 704

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 41/166 (24%), Positives = 79/166 (47%), Gaps = 2/166 (1%)
 Frame = -3

Query: 818 RSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHC 639
           R  + Q +D  +   VL A E    R        L+  A  ED +  + ++LV+ +    
Sbjct: 497 RDVILQNEDMNDTRKVLHAVEVAIIRASNQALTTLD--AHGED-WDFIGANLVQLSKLLA 553

Query: 638 QVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQGDFLSTGCITPKQASLAN 462
              ++  F++K+   I    +   L+ L  +YS  +I  +  G FL+   ++ +  S+  
Sbjct: 554 HFFLLKAFLDKV-DSIEEKELVPVLDKLAQLYSATIILEEFSGIFLTYSVVSTESISILT 612

Query: 461 DQ-LRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
           DQ +  L   +RP+ + L D+F  +D  ++S LG Y+G++Y   ++
Sbjct: 613 DQHIPKLCKDLRPHVIPLTDSFQLSDMMINSSLGSYNGDIYENYFK 658



>gb:AF013216_468779 Myxococcus xanthus Dog (dog), isocitrate lyase
           (icl), Mls (mls), Ufo (ufo), fumarate hydratase (fhy),
           and proteosome major subunit (clpP) genes, complete cds;
           and acyl-CoA oxidase (aco) gene, partial cds.
          Length = 433

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 37/140 (26%), Positives = 67/140 (47%), Gaps = 4/140 (2%)
 Frame = -3

Query: 770 LEAYEARAARMIASCA----KNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKL 603
           L A   R   ++A+ +    K L+    + + F ++   L+E A AH + +V+ +F++ +
Sbjct: 289 LRALRFREEELLATVSQRIRKRLSAGVEAFEAFNQVQVHLLELAHAHVERLVLEQFLKGV 348

Query: 602 KQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPN 423
             D+   G+K  L  L  +Y L  +    G F   G +   +      ++  L   +RP+
Sbjct: 349 A-DVKDPGLKTVLGRLCDLYGLSCLESANGWFQEHGWLEGTKVKAIRKEVTRLCAELRPD 407

Query: 422 AVALVDAFNYTDHFLDSILG 363
           AVALV+AF   D  L + +G
Sbjct: 408 AVALVNAFGVPDTCLAAPIG 427



>pir|T07901|T07901 acyl CoA oxidase homolog -
           cucurbit>gb:AF002016_1760560 Cucurbita sp. cv. Kurokawa
           Amakuri acyl CoA oxidase homolog mRNA, complete cds.
          Length = 690

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 36/144 (25%), Positives = 67/144 (46%), Gaps = 3/144 (2%)
 Frame = -3

Query: 806 QQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELS---SDLVEAAVAHCQ 636
           + A    +P   L+A++ R +R++ S A  L     +   F   +   + L+  A +H +
Sbjct: 526 ESADHLRDPKFQLDAFQYRTSRLLQSVAVRLRKHTKNLGSFGAWNRCLNHLLTLAESHIE 585

Query: 635 VIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQ 456
            +++++FIE + Q  P    +  L+ +  +Y+L  I    G + +   + P +A   +  
Sbjct: 586 SVILAQFIESV-QRCPNANTQATLKLVCDLYALDRIWNDIGTYRNVDYVAPNKAKAIHKL 644

Query: 455 LRALYTLVRPNAVALVDAFNYTDH 384
              L   VR  A  LVDAF+  DH
Sbjct: 645 TEYLCFQVRNIAQELVDAFDLPDH 668



>gb:AB031272_1518608 Candida tropicalis POX4 gene for acyl-CoA
           oxidase, complete cds, strain:M1210A3.
          Length = 709

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 533 LIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           ++ K  G FL+    +P+  + LA+ Q+  L   VRPN VA  D+F  +D  ++S +G+Y
Sbjct: 594 VLDKFAGVFLTFNVASPQAITDLASTQIPKLCAEVRPNVVAYTDSFQQSDMVINSAIGKY 653

Query: 356 DGNVYPKLYE 327
           DG+VY   ++
Sbjct: 654 DGDVYENYFD 663



>gb:AB031271_1518607 Candida tropicalis POX4 gene for acyl-CoA
           oxidase, complete cds, strin:1098.>gb:CMPOX4_1648047
           Candida maltosa POX4 gene for peroxiomal acyl CoA
           oxidase (AOX, EC 1.3.99.3).
          Length = 709

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 533 LIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           ++ K  G FL+    +P+  + LA+ Q+  L   VRPN VA  D+F  +D  ++S +G+Y
Sbjct: 594 VLDKFAGVFLTFNVASPQAITDLASTQIPKLCAEVRPNVVAYTDSFQQSDMVINSAIGKY 653

Query: 356 DGNVYPKLYE 327
           DG+VY   ++
Sbjct: 654 DGDVYENYFD 663



>pir|A25123|OXCKX4 acyl-CoA oxidase (EC 1.3.3.6) POX4, peroxisomal -
            yeast  (Candida tropicalis)>gb:YSAPOX4_1728150 Yeast
            (C.tropicalis) POX4 gene encoding acyl-coenzyme A oxidase
            II (PXP-4), complete cds.
          Length = 709

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 40/183 (21%), Positives = 87/183 (47%), Gaps = 5/183 (2%)
 Frame = -3

Query: 860  TTAYMGRLQQLLQCRSN---VQQAKDWMNPSAVLEAYEARAARMIASCAKNLNNFASSED 690
            +TA++ +L+      S+   +    D  +   V++A E    R+    A  +      ++
Sbjct: 487  STAFLNQLKDYTGSNSSKVVLNTVADLDDIKTVIKAIEVAIIRLSQEAASIVK-----KE 541

Query: 689  GFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLI-HKHQG 513
             F  + ++LV+ +       +++++I ++        +   L  L  +Y+  ++  +  G
Sbjct: 542  SFDYVGAELVQLSKLKAHHYLLTEYIRRI-DTFDQKDLVPYLITLGKLYAATIVLDRFAG 600

Query: 512  DFLSTGCITPKQ-ASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
             FL+    + +   +LA+ Q+  L   VRPN VA  D+F  +D  ++S +GRYDG++Y  
Sbjct: 601  VFLTFNVASTEAITALASVQIPKLCAEVRPNVVAYTDSFQQSDMIVNSAIGRYDGDIYEN 660

Query: 335  LYE 327
             ++
Sbjct: 661  YFD 663



>pir|A29441|OXCKPM acyl-CoA oxidase (EC 1.3.3.6) PXP4, peroxisomal -
           yeast  (Candida maltosa)
          Length = 709

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 533 LIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           ++ K  G FL+    +P+  + LA+ Q+  L   VRPN VA  D+F  +D  ++S +G+Y
Sbjct: 594 VLDKFAGVFLTFNVASPQAITDLASTQIPKLCAEVRPNVVAYTDSFQQSDMVINSAIGKY 653

Query: 356 DGNVYPKLYE 327
           DG+VY   ++
Sbjct: 654 DGDVYENYFD 663



>sp|P05335|CAO4_CANMA Acyl-coenzyme A oxidase POX4 (EC 1.3.3.6)
           (Acyl-CoA oxidase) (AOX).
          Length = 708

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 1/70 (1%)
 Frame = -3

Query: 533 LIHKHQGDFLSTGCITPKQAS-LANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRY 357
           ++ K  G FL+    +P+  + LA+ Q+  L   VRPN VA  D+F  +D  ++S +G+Y
Sbjct: 593 VLDKFAGVFLTFNVASPQAITDLASTQIPKLCAEVRPNVVAYTDSFQQSDMVINSAIGKY 652

Query: 356 DGNVYPKLYE 327
           DG+VY   ++
Sbjct: 653 DGDVYENYFD 662



>gb:AF202987_1776546 Petroselinum crispum acyl-CoA oxidase (ACO)
           gene, complete cds.
          Length = 694

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 34/145 (23%), Positives = 69/145 (47%), Gaps = 3/145 (2%)
 Frame = -3

Query: 785 NPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELS---SDLVEAAVAHCQVIVVSKF 615
           +P   L+A+  R +R++ S A  L   + +  GF   +   + L+  A +H + +++  F
Sbjct: 533 DPKFQLDAFRYRTSRLLQSAAVRLQKHSKNLGGFGAWNRCLNHLLTLAESHIESVILETF 592

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTL 435
           I+ +K + P    +  L+ +  +Y++  I    G + +   + P +A   +     L   
Sbjct: 593 IKAVK-NCPDASSRAALKLVCDLYAMDRIWNDIGTYRNVDYMAPNKAKAIHKLTEYLSFQ 651

Query: 434 VRPNAVALVDAFNYTDHFLDSILGR 360
           VR     LVDAF+  DH + + +G+
Sbjct: 652 VRNITRELVDAFDMPDHVIRAPIGK 676



>gb:BC055019_2101891 Mus musculus acyl-Coenzyme A oxidase 3,
           pristanoyl, mRNA (cDNA clone MGC:62553 IMAGE:4162223),
           complete cds.
          Length = 700

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 39/163 (23%), Positives = 70/163 (42%), Gaps = 6/163 (3%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLV-----EAAVAHCQVI 630
           DWM+ +A L AY      ++    +       S     E  ++         A+A  ++ 
Sbjct: 507 DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELT 566

Query: 629 VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLA-NDQL 453
           V+ +F E +        ++  L  L  +Y L+ + +H       G I+ +Q   A  D +
Sbjct: 567 VMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAI 626

Query: 452 RALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEA 324
             L   ++ +AVALVD    +D  L+S + + DG +Y  L+ A
Sbjct: 627 LTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLWAA 669



>sp|Q9EPL9|CAO3_MOUSE Acyl-coenzyme A oxidase 3, peroxisomal (EC
           1.3.3.6) (Pristanoyl-CoA oxidase).>gb:MMU278430_2120140
           Mus musculus mRNA for pristanoyl-CoA oxidase (Acox3
           gene).
          Length = 700

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 38/161 (23%), Positives = 70/161 (43%), Gaps = 6/161 (3%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSD-----LVEAAVAHCQVI 630
           DWM+ +A L AY      ++    +       S     E  ++     +   A+A  ++ 
Sbjct: 507 DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGVRPLALAFMELT 566

Query: 629 VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLA-NDQL 453
           V+ +F E +        ++  L  L  +Y L+ + +H       G I+ +Q   A  D +
Sbjct: 567 VMQRFHEHIHSSGLSPSLRTVLGRLSSVYGLWCLSQHMALSYRGGYISGEQTGRAMEDAI 626

Query: 452 RALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLY 330
             L   ++ +AVALVD    +D  L+S + + DG +Y  L+
Sbjct: 627 LTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLW 667



>gb:BC044725_2099008 Mus musculus acyl-Coenzyme A oxidase 3,
           pristanoyl, mRNA (cDNA clone MGC:51353 IMAGE:5374281),
           complete cds.
          Length = 700

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 39/163 (23%), Positives = 70/163 (42%), Gaps = 6/163 (3%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLV-----EAAVAHCQVI 630
           DWM+ +A L AY      ++    +       S     E  ++         A+A  ++ 
Sbjct: 507 DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELT 566

Query: 629 VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLA-NDQL 453
           V+ +F E +        ++  L  L  +Y L+ + +H       G I+ +Q   A  D +
Sbjct: 567 VMQRFHEHIYSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAI 626

Query: 452 RALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEA 324
             L   ++ +AVALVD    +D  L+S + + DG +Y  L+ A
Sbjct: 627 LTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGELYKNLWAA 669



>gb:AE017234_412806 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 8 of 16 of the complete
           genome.>gb:AE016958_1056210 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 650

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 37/154 (24%), Positives = 71/154 (46%), Gaps = 7/154 (4%)
 Frame = -3

Query: 839 LQQLLQCRSNVQQAKDWMNPSAVLEAYEARAARMIASCAKNL---NNFASSEDGFAELSS 669
           +Q ++  R + ++     N    ++ +E R   ++AS A+ L   +   S  D F  +  
Sbjct: 479 IQTIVDARQDSEEEGSLFNRGTQIKMFEDREEYLLASVARRLQAKSKEMSEFDAFNSVQD 538

Query: 668 DLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCI 489
            ++ AA AH   +V+  F+  +    P    ++ L  L  +Y+L +I   +  ++    +
Sbjct: 539 HVLHAASAHIDRVVLEAFVAGI-DGCPDEQARELLGILCDLYALSVIEDDKAWYIEHRYL 597

Query: 488 TPKQASLA----NDQLRALYTLVRPNAVALVDAF 399
           + ++A       ND+ RAL    RP+A  LVD F
Sbjct: 598 STERAKAVTRGINDRCRAL----RPHAQTLVDGF 627



>gb:AF133102_1770901 Pichia pastoris acyl-coenzyme A oxidase (POX1)
            gene, complete cds.
          Length = 719

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 33/157 (21%), Positives = 71/157 (45%), Gaps = 3/157 (1%)
 Frame = -3

Query: 710  NFASSEDGFAELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYL 531
            N  S +  + ++++  V  +  +  + ++   + K+KQ       KQ L  +  +++   
Sbjct: 543  NIGSKKSTWDDIAAQRVVLSKLNAVLYMLQHLVLKIKQLGDEEAHKQYLVQIAALFATSQ 602

Query: 530  IHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDG 351
            I  +   +            +A D +  L   VR   + L D+F ++D+F++S LG + G
Sbjct: 603  IEMNFASYFLQFKAIDSLEPVA-DVVSELCLSVRDQVIGLTDSFQFSDYFINSALGSHSG 661

Query: 350  NVYPKLYEAAWKDPLNESVVPDG---YHEYIRPLLKQ 249
            ++Y   ++    + LN   V DG   Y E +  +L++
Sbjct: 662  DIYNTYFDTV--NNLNNPQVRDGKAAYSEALEAMLRR 696



>gb:AK028818_1161179 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732458N10
           product:acyl-Coenzyme A oxidase 3, pristanoyl, full
           insert sequence.
          Length = 697

 Score = 43.1 bits (100), Expect = 0.007
 Identities = 37/156 (23%), Positives = 66/156 (42%), Gaps = 6/156 (3%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLV-----EAAVAHCQVI 630
           DWM+ +A L AY      ++    +       S     E  ++         A+A  ++ 
Sbjct: 507 DWMDSAAPLAAYRWLVCYLLQESHRRYCQEKKSRGSDFEARNNSQVYGCRPLALAFMELT 566

Query: 629 VVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQASLA-NDQL 453
           V+ +F E +        ++  L  L  +Y L+ + +H       G I+ +Q   A  D +
Sbjct: 567 VMQRFHEHIHSSGLSPSLRTVLGRLSTLYGLWCLSQHMALLYRGGYISGEQTGRAMEDAI 626

Query: 452 RALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNV 345
             L   ++ +AVALVD    +D  L+S + + DG V
Sbjct: 627 LTLCEQLKDDAVALVDVIAPSDFVLNSPIAKADGEV 662



>gb:AP003574_1831122 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0526E12.
          Length = 685

 Score = 42.0 bits (97), Expect = 0.015
 Identities = 30/104 (28%), Positives = 54/104 (51%)
 Frame = -3

Query: 680 ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLS 501
           +L+ DL   A A  +  ++  F+E  K +IP   +K  L  L  +Y +  I +    FL 
Sbjct: 572 QLAEDL---ARAFTERTILQIFLEDEK-NIPTGSLKDILGLLRSLYVMVCIDE-SASFLR 626

Query: 500 TGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
            GC++ +  + A  ++  L + +RP+A+A+V +F   D FL  +
Sbjct: 627 YGCLSRENVAAARKEVMTLCSELRPHALAIVSSFGIPDAFLSPL 670



>gb:CR382136_1669394 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 706

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 33/158 (20%), Positives = 67/158 (42%), Gaps = 2/158 (1%)
 Frame = -3

Query: 794 DWMNPSAVLEAYEARAARMIASCAKNLNNFASSEDGFAELSSDLVEAAVAHCQVIVVSKF 615
           D  + S V +A E    R+       L +  S ++ +  +S   V  +   C   ++  F
Sbjct: 507 DLQDLSLVFKALEVLICRLANQSIDVLES--SGDNNWDLVSYQRVVLSKLRCHHYLLQNF 564

Query: 614 IEKLKQDIPGNGVKQQLENLFGIYSLY-LIHKHQGDFLSTGCITPKQASLANDQLRALYT 438
           + ++  D      K  L+++   Y+   ++     + LS    +PK  +     +   Y 
Sbjct: 565 MSRI--DSADESTKPMLKDVAKTYAYTSILENFSAELLSLNVTSPKFINRLKSSVIPTYL 622

Query: 437 L-VRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYE 327
             +R  A+ L D+F   D  L+S +G Y+G++Y   ++
Sbjct: 623 KKLRNQAITLTDSFQQPDMVLNSAIGNYNGDIYEDYFK 660



>gb:BA000030_701593 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 673

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 25/93 (26%), Positives = 43/93 (46%)
 Frame = -3

Query: 566 LENLFGIYSLYLIHKHQGDFLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTD 387
           L +L  ++ L  +  H GD L+ G +T          L ++Y  + P+ + LVDAF++  
Sbjct: 581 LRSLCRLFLLRRLRDHTGDLLAEGHLTADHVRALPRALDSVYDDLAPHLMTLVDAFDFPA 640

Query: 386 HFLDSILGRYDGNVYPKLYEAAWKDPLNESVVP 288
             L +I     G +   L ++A + PL     P
Sbjct: 641 EMLSAIPIASGGTIVRTLEQSAEEWPLVSPASP 673



>gb:AX155025_1462751 Sequence 71 from Patent WO0138484.
          Length = 157

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = -3

Query: 509 FLSTGCITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
           FL  G + PKQ+ L + ++ +L   +RP AV LVDAF     FL  I
Sbjct: 97  FLRYGYLLPKQSQLISTEVASLCGELRPQAVNLVDAFGIPQAFLGPI 143



>gb:BC048717_2099797 Mus musculus acyl-Coenzyme A oxidase-like, mRNA
           (cDNA clone MGC:59516 IMAGE:6334753), complete cds.
          Length = 352

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 31/120 (25%), Positives = 54/120 (45%)
 Frame = -3

Query: 653 AVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQA 474
           ++AH   + + +F   ++Q  P    +  L     +Y   L+ + +G +L    +TPK +
Sbjct: 226 SLAHIHRVALEQFTTAVRQ-CPNREDQALLMKFCLLYGTKLVFQERGWYLEHKYLTPKAS 284

Query: 473 SLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESV 294
            L   QL  L   V+ +A+ ++ AFN   H   +I     G   P   EAA+  P+   V
Sbjct: 285 MLIRAQLLNLCESVKDDALKVISAFN-IPHI--TIRAPKTGIPNPGAAEAAYPAPMQPLV 341



>gb:AK004775_1152585 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200014P05
           product:hypothetical Acyl-CoA dehydrogenase containing
           protein, full insert sequence.
          Length = 632

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 31/120 (25%), Positives = 54/120 (45%)
 Frame = -3

Query: 653 AVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTGCITPKQA 474
           ++AH   + + +F   ++Q  P    +  L     +Y   L+ + +G +L    +TPK +
Sbjct: 506 SLAHIHRVALEQFTTAVRQ-CPNREDQALLMKFCLLYGTKLVFQERGWYLEHKYLTPKAS 564

Query: 473 SLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPKLYEAAWKDPLNESV 294
            L   QL  L   V+ +A+ ++ AFN   H   +I     G   P   EAA+  P+   V
Sbjct: 565 MLIRAQLLNLCESVKDDALKVISAFN-IPHI--TIRAPKTGIPNPGAAEAAYPAPMQPLV 621



>gb:AP006618_558875 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 643

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 36/173 (20%), Positives = 76/173 (43%), Gaps = 4/173 (2%)
 Frame = -3

Query: 842 RLQQLLQCRSNVQQAK-DWMNPSAVLEAYEARAARMIASCAKNLNNFASSE---DGFAEL 675
           +L Q L+ RS+    + D    S  L+ +  R   ++ + A  L   A      +GF   
Sbjct: 472 QLIQTLRDRSDESVDEGDLSRRSTQLQLFADREDYLVRTAAHRLRARAEDTTPFEGFNNA 531

Query: 674 SSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTG 495
              ++ A  AH   +V+  FIE +  +I     +   E +  ++   L+ ++   ++   
Sbjct: 532 QDHILAAGSAHIDRLVLEAFIEGI-GEIEDPEARALAETVCDLFVYTLLEENLAWYIMHR 590

Query: 494 CITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSILGRYDGNVYPK 336
            ++ ++A      +  L   +RP+A+ LV+A    +  L + +  +D +VY +
Sbjct: 591 FMSVERAKAVRRGVNELVDRLRPHALTLVEAMGVPEEMLHAAM-LHDASVYQR 642



>gb:DME276483_1379125 Drosophila melanogaster putative sar1 gene for
           Sar1 protein, exons 1-5.
          Length = 197

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = -3

Query: 680 ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSL 537
           EL S L + A+++C V+++   I+K     PG   + +L N+FG+Y L
Sbjct: 125 ELDSLLTDEALSNCPVLILGNKIDK-----PGAASEDELRNVFGLYQL 167



>gb:AE014297_1140779 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003738_1222772 Drosophila melanogaster
           chromosome 3R, section 76 of 118 of the complete
           sequence.>gb:AY060423_1292335 Drosophila melanogaster
           LD39266 full length cDNA.
          Length = 155

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = -3

Query: 680 ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSL 537
           EL S L + A+++C V+++   I+K     PG   + +L N+FG+Y L
Sbjct: 71  ELDSLLTDEALSNCPVLILGNKIDK-----PGAASEDELRNVFGLYQL 113



>gb:AE014297_1140775 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1140776 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE014297_1140777
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1140778 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003738_1222768
           Drosophila melanogaster chromosome 3R, section 76 of 118
           of the complete sequence.>gb:AE003738_1222769 Drosophila
           melanogaster chromosome 3R, section 76 of 118 of the
           complete sequence.>gb:AE003738_1222770 Drosophila
           melanogaster chromosome 3R, section 76 of 118 of the
           complete sequence.>gb:AE003738_1222771 Drosophila
           melanogaster chromosome 3R, section 76 of 118 of the
           complete sequence.>gb:BT001745_1356518 Drosophila
           melanogaster RE74312 full insert cDNA.
          Length = 193

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = -3

Query: 680 ELSSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSL 537
           EL S L + A+++C V+++   I+K     PG   + +L N+FG+Y L
Sbjct: 109 ELDSLLTDEALSNCPVLILGNKIDK-----PGAASEDELRNVFGLYQL 151



>gb:AF055922_474077 Streptomyces fradiae dipeptidil carboxypeptidase
           (ddcA), tylosin resistance protein (tlrB),
           glycosyltransferase (tylN), methyltransferase (tylE),
           4-ketoreductase (tylD), ferredoxin (tylH2), cytochrome
           P450 (tylH1), macrocin O-methyltransferase (tylF),
           epimerase (tylJ), acyl-CoA oxydase (tylP), and
           butyrolactone receptor (tylQ) genes, complete cds.
          Length = 658

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 27/102 (26%), Positives = 42/102 (41%)
 Frame = -3

Query: 674 SSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTG 495
           SS  VE   AH  +      +E       G   +Q L  L  ++ L  +  H GD L+ G
Sbjct: 537 SSAAVEMVRAHAVLQAAGSLLEAAGH-ADGAAPRQLLVWLSRLFMLRHLAPHTGDLLAEG 595

Query: 494 CITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
            +T  Q       +  +   + P+ + LV+AF+    FL  I
Sbjct: 596 RMTADQVRALPGSVDEVIAGLAPHMMTLVEAFDLPGEFLGGI 637



>pir|T44585|T44585 acyl-CoA oxidase homolog [imported] -
           Streptomyces fradiae>gb:AF145049_483121 Streptomyces
           fradiae tylosin-biosynthetic regulatory gene cluster,
           complete sequence.
          Length = 641

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 27/102 (26%), Positives = 42/102 (41%)
 Frame = -3

Query: 674 SSDLVEAAVAHCQVIVVSKFIEKLKQDIPGNGVKQQLENLFGIYSLYLIHKHQGDFLSTG 495
           SS  VE   AH  +      +E       G   +Q L  L  ++ L  +  H GD L+ G
Sbjct: 520 SSAAVEMVRAHAVLQAAGSLLEAAGH-ADGAAPRQLLVWLSRLFMLRHLAPHTGDLLAEG 578

Query: 494 CITPKQASLANDQLRALYTLVRPNAVALVDAFNYTDHFLDSI 369
            +T  Q       +  +   + P+ + LV+AF+    FL  I
Sbjct: 579 RMTADQVRALPGSVDEVIAGLAPHMMTLVEAFDLPGEFLGGI 620



>gb:AF077536_1239218 Caenorhabditis elegans cosmid C16A11, complete
           sequence.
          Length = 643

 Score = 33.5 bits (75), Expect = 5.4
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +3

Query: 468 ERGLLRGDAAGGEEVSLVFVDEVERVDPEKILQLLLHAIPRNILLQLFDKLGN 626
           E   ++ + AGGEE  L    ++E    EKI     H     I+ QL DKL N
Sbjct: 589 EETSVQAEPAGGEEEMLDVTKQIEEAKEEKIRLKAEHDANERIIQQLLDKLAN 641



>pir|T33346|T33346 hypothetical protein C16A11.5 - Caenorhabditis
           elegans
          Length = 646

 Score = 33.5 bits (75), Expect = 5.4
 Identities = 19/53 (35%), Positives = 25/53 (47%)
 Frame = +3

Query: 468 ERGLLRGDAAGGEEVSLVFVDEVERVDPEKILQLLLHAIPRNILLQLFDKLGN 626
           E   ++ + AGGEE  L    ++E    EKI     H     I+ QL DKL N
Sbjct: 592 EETSVQAEPAGGEEEMLDVTKQIEEAKEEKIRLKAEHDANERIIQQLLDKLAN 644


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 861,010,725
Number of Sequences: 1806583
Number of extensions: 17629789
Number of successful extensions: 45219
Number of sequences better than 10.0: 123
Number of HSP's better than 10.0 without gapping: 43776
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45147
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58632447358
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)