BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig3008
         (907 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BX294144_768769 Pirellula sp. strain 1 complete genome; segme...    35   2.6     
sp|Q7UPT7|DEOC_RHOBA|DEOC_RHOBA Deoxyribose-phosphate aldolase (EC 4.1.2.4)...    35   2.6     Rhodopirellula baltica
gb:AB190570_16977 Burkholderia andropogonis gene for DNA gyrase ...    34   3.4     
pir|A72553|A72553 hypothetical protein APE1709 - Aeropyrum perni...    34   4.4     Aeropyrum pernix
gb:CP000025_879071 Campylobacter jejuni RM1221, complete genome.       33   5.8     
sp|Q9PN98|GATB_CAMJE|GATB_CAMJE Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransf...    33   5.8     
gb:AB007196_1110 Flavobacterium sp., plasmid pFL1, complete sequ...    33   9.9     


>gb:BX294144_768769 Pirellula sp. strain 1 complete genome; segment
           12/24.
          Length = 260

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 22/94 (23%), Positives = 41/94 (43%)
 Frame = +2

Query: 383 KIVEQDLVDPTLLLIFDAGGMKVSLLKTIEFLSAKLCILQTFLEECDTKMNDGDTRCITT 562
           K+++  L+ PTL       G+ +++   +    A +CIL  +L+ C  K+     +  TT
Sbjct: 30  KMIDHSLLPPTLTEADLDSGIDLAIAYEV----ASVCILPYYLKRCAAKLAGTGVKASTT 85

Query: 563 ISFLHDAIRSRISSSYYENEIEYKLRRVYLAANV 664
           I F H    + I  +  E  I+     +    N+
Sbjct: 86  IGFPHGGHTTAIKKAEAEQAIQDGCEELDFVVNI 119



>sp|Q7UPT7|DEOC_RHOBA Deoxyribose-phosphate aldolase (EC 4.1.2.4)
           (Phosphodeoxyriboaldolase) (Deoxyriboaldolase) (DERA).
          Length = 241

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 22/94 (23%), Positives = 41/94 (43%)
 Frame = +2

Query: 383 KIVEQDLVDPTLLLIFDAGGMKVSLLKTIEFLSAKLCILQTFLEECDTKMNDGDTRCITT 562
           K+++  L+ PTL       G+ +++   +    A +CIL  +L+ C  K+     +  TT
Sbjct: 11  KMIDHSLLPPTLTEADLDSGIDLAIAYEV----ASVCILPYYLKRCAAKLAGTGVKASTT 66

Query: 563 ISFLHDAIRSRISSSYYENEIEYKLRRVYLAANV 664
           I F H    + I  +  E  I+     +    N+
Sbjct: 67  IGFPHGGHTTAIKKAEAEQAIQDGCEELDFVVNI 100



>gb:AB190570_16977 Burkholderia andropogonis gene for DNA gyrase
           subunit B, partial cds, strain: ATCC
           23061.>gb:AB190571_16978 Burkholderia andropogonis gene
           for DNA gyrase subunit B, partial cds, strain: ATCC
           19311.>gb:AB190572_16979 Burkholderia andropogonis gene
           for DNA gyrase subunit B, partial cds, strain: MAFF
           311215.
          Length = 267

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 20/65 (30%), Positives = 33/65 (50%)
 Frame = +2

Query: 554 ITTISFLHDAIRSRISSSYYENEIEYKLRRVYLAANVKGYVFEATQASEELHQTLKHVVR 733
           I  +SFL++ +R R+       E +Y       A  VKG+V    +A + LH T+ H V 
Sbjct: 90  IRELSFLNNGVRIRLQDKRSGKEDDYAF-----AGGVKGFVEYINRAKQVLHPTIFHAVG 144

Query: 734 DIEHV 748
           + ++V
Sbjct: 145 EKDNV 149



>pir|A72553|A72553 hypothetical protein APE1709 - Aeropyrum pernix
           (strain K1)>gb:BA000002_652454 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 130

 Score = 33.9 bits (76), Expect = 4.4
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = -2

Query: 546 VSPSFILVSHSSKKVCRMQSFADRNSIVLSSDTFIPPASKIKSSVGSTRSCSTILI 379
           +SPSF  +S SS+++    SF   +SI     +   PAS   S++ S  SC +  +
Sbjct: 60  ISPSFARLSASSRRLLAWSSFPRTSSIAACISSVSTPASLAFSAISSISSCKSFTL 115



>gb:CP000025_879071 Campylobacter jejuni RM1221, complete genome.
          Length = 472

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 9/130 (6%)
 Frame = +2

Query: 485 KLCILQTFLEECDTKMNDGDTRCITTIS---------FLHDAIRSRISSSYYENEIEYKL 637
           KL  +  FL+  D  M +G  RC   +S         +    I++  S  + +  IEY++
Sbjct: 168 KLHSIIRFLDISDANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEV 227

Query: 638 RRVYLAANVKGYVFEATQASEELHQTLKHVVRDIEHVEEWILAGKKRTALDPEKENITVW 817
           +R   A     Y  E  Q +  L  T   V R +   EE   A + R   DP+   + + 
Sbjct: 228 KRQSEAWEDGTYEQEVVQET-RLFDTTNLVTRSMRGKEE---AAEYRYFPDPDLLPVLLK 283

Query: 818 DTYQNALVPE 847
           D + +  +PE
Sbjct: 284 DEFLDIKIPE 293



>sp|Q9PN98|GATB_CAMJE Aspartyl/glutamyl-tRNA(Asn/Gln)
           amidotransferase subunit B (EC 6.3.5.-) (Asp/Glu-ADT
           subunit B).>pir|G81325|G81325 Glu-tRNAGln
           amidotransferase chain B Cj1197c [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X4_847570 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 4/6.
          Length = 472

 Score = 33.5 bits (75), Expect = 5.8
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 9/130 (6%)
 Frame = +2

Query: 485 KLCILQTFLEECDTKMNDGDTRCITTIS---------FLHDAIRSRISSSYYENEIEYKL 637
           KL  +  FL+  D  M +G  RC   +S         +    I++  S  + +  IEY++
Sbjct: 168 KLHSIIRFLDISDANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEV 227

Query: 638 RRVYLAANVKGYVFEATQASEELHQTLKHVVRDIEHVEEWILAGKKRTALDPEKENITVW 817
           +R   A     Y  E  Q +  L  T   V R +   EE   A + R   DP+   + + 
Sbjct: 228 KRQSEAWEDGTYEQEVVQET-RLFDTTNLVTRSMRGKEE---AAEYRYFPDPDLLPVLLK 283

Query: 818 DTYQNALVPE 847
           D + +  +PE
Sbjct: 284 DEFLDIKIPE 293



>gb:AB007196_1110 Flavobacterium sp., plasmid pFL1, complete
           sequence.
          Length = 328

 Score = 32.7 bits (73), Expect = 9.9
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 1/100 (1%)
 Frame = +2

Query: 572 LHDAIRSRISSSYYENEIEYKLRRVYLAANVKGYVFEATQASEELHQTLKHVVRDIEHVE 751
           LH+AI  RIS  Y   +           A  K  V   T      H+ +K +  D E  +
Sbjct: 57  LHEAIEKRISEGYKGEK-----------AIRKDAVKYCTHVLTGSHEKMKEIFADKEKSK 105

Query: 752 EWILAGKKRTALDPEKENITVWDTYQNALVPE-NEVTITM 868
           EWI    K  A +  KENI  +  + +   P  + VTI +
Sbjct: 106 EWIQDNYKFLAKEFGKENIVRFTLHLDEKTPHLHAVTIPL 145


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 876,061,697
Number of Sequences: 1806583
Number of extensions: 17325292
Number of successful extensions: 35719
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 34624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35705
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 63348597891
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)