BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2949
         (924 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:SLU32444_1715382 Solanum lycopersicum phytochrome F (PHYF) ge...   242   9e-63   
gb:TAE295224_1724303 Triticum aestivum phyC gene for phytochrome...   188   1e-46   
gb:AY672999_1621337 Triticum aestivum cultivar Soleil phytochrom...   188   1e-46   
gb:AY672998_1621336 Triticum aestivum cultivar Soleil putative n...   188   1e-46   
gb:AY672997_1621335 Triticum aestivum cultivar Saitama 27 Touris...   188   1e-46   
gb:AY672995_1621333 Triticum aestivum cultivar Chinese Spring To...   188   1e-46   
gb:AY672994_1621332 Triticum aestivum subsp. spelta cultivar Gre...   188   1e-46   
gb:AY673000_1621338 Triticum aestivum cultivar Soleil phytochrom...   187   2e-46   
gb:AF406643_1796904 Hordeum vulgare phytochrome C mRNA, partial ...   187   2e-46   
gb:AF141942_1771608 Oryza sativa phytochrome C (phyC) gene, comp...   186   4e-46   
gb:AY234829_1591779 Zea mays cultivar B73 phytochrome C1 apoprot...   185   1e-45   
sp|Q9ZWI9|PHYC_ORYSA|PHYC_ORYSA Phytochrome C.>gb:AB018442_1513952 Oryza sa...   185   1e-45   Oryza sativa [red rice]
gb:AY466463_1608079 Sorghum arundinaceum voucher IS14567 phytoch...   184   2e-45   
gb:AY466467_1608083 Sorghum arundinaceum voucher PI302233 phytoc...   184   2e-45   
gb:AY466466_1608082 Sorghum arundinaceum voucher PI225905 phytoc...   184   2e-45   
gb:AY466460_1608076 Sorghum arundinaceum voucher IS14569 phytoch...   184   2e-45   
gb:AY466458_1608074 Sorghum bicolor phytochrome C (PHYC) gene, c...   184   2e-45   
gb:AY466455_1608071 Sorghum bicolor voucher PI229835 phytochrome...   184   2e-45   
gb:AY466453_1608069 Sorghum bicolor voucher PI267380 phytochrome...   184   2e-45   
gb:AY466452_1608068 Sorghum propinquum phytochrome C (PHYC) gene...   184   2e-45   
sp|P93528|PHYC_SORBI|PHYC_SORBI Phytochrome C.>pir|T14803|T14803 phytochrom...   184   2e-45   Sorghum bicolor [broomcorn]
gb:ATPHYCG_1553851 A.thaliana phyC gene.                              182   1e-44   
gb:AY394847_1604783 Arabidopsis thaliana ecotype Kas-1 phytochro...   181   1e-44   
gb:AY234830_1591780 Zea mays cultivar B73 phytochrome C2 apoprot...   181   1e-44   
sp|P14714|PHYC_ARATH|PHYC_ARATH Phytochrome C.>pir|C33473|FKMUC phytochrome...   181   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AF544029_1810404 Stellaria longipes ecotype prairie phytochro...   179   7e-44   
sp|Q01549|PHY1_SELMA|PHY1_SELMA Phytochrome 1.>pir|S31280|S31280 phytochrom...   164   2e-39   Selaginella martensii
sp|Q40762|PHY_PICAB|PHY_PICAB Phytochrome.>pir|T14842|T14842 phytochrome -...   164   3e-39   Picea abies
gb:AY123147_1580015 Physcomitrella patens phytochrome (phy2) gen...   162   7e-39   
sp|Q39557|PHY2_CERPU|PHY2_CERPU Phytochrome 2.>gb:CPU56698_1648919 Ceratodo...   159   6e-38   Ceratodon purpureus
gb:CPU72993_1648925 Ceratodon purpureus phytochrome photorecepto...   159   7e-38   
gb:AB022917_1515300 Marchantia paleacea var. diptera PhyMpd mRNA...   158   1e-37   
sp|P36505|PHY1_PHYPA|PHY1_PHYPA Phytochrome 1.>pir|S37206|S37206 phytochrom...   156   5e-37   Physcomitrella patens
gb:AY123146_1580014 Physcomitrella patens phytochrome (phy1) gen...   156   6e-37   
gb:AY123148_1580016 Physcomitrella patens phytochrome (phy3) gen...   155   8e-37   
gb:AY123145_1580013 Physcomitrella patens phytochrome (phy4) gen...   155   1e-36   
gb:AY123149_1580017 Ceratodon purpureus phytochrome (phy3) gene,...   152   7e-36   
gb:PSY271627_1702601 Pinus sylvestris partial mRNA for phytochro...   150   3e-35   
sp|Q41046|PHY_PINSY|PHY_PINSY Phytochrome.>pir|T09701|T09701 phytochrome -...   150   3e-35   Pinus sylvestris [Scotch pine]
gb:PNPHY_1700910 P.nudum mRNA for phytochrome.                        149   1e-34   
pir|S37158|S37158 phytochrome - whisk fern (Psilotum nudum) (fra...   149   1e-34   Psilotum nudum
gb:AB016232_1512790 Adiantum capillus-veneris PHY2 mRNA for phyt...   141   2e-32   
sp|P42499|PHYB_SOYBN|PHYB_SOYBN Phytochrome B.>pir|T07756|T07756 phytochrom...   140   3e-32   Glycine max [soybeans]
gb:AF069305_1765685 Pisum sativum phytochrome B (PHYB) mRNA, par...   140   5e-32   
gb:TOBPHYTCRB_1725490 Tobacco phytochrome B (phyB) mRNA, 3' end.      136   5e-31   
sp|P33529|PHY_MOUSC|PHY_MOUSC Phytochrome.>gb:MSPHYTOCH_1687219 M.scalaris...   136   5e-31   Mougeotia scalaris
sp|P29130|PHYB_TOBAC|PHYB_TOBAC Phytochrome B.>pir|T03668|T03668 phytochrom...   136   5e-31   Nicotiana tabacum [American tobacco]
sp|P06592|PHYA_CUCPE|PHYA_CUCPE Phytochrome A.>pir|S00099|FKPUZ phytochrome...   136   7e-31   Cucurbita pepo
pir|T16973|T16973 phytochrome B - curled-leaved tobacco>gb:NPPHY...   135   9e-31   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AB036763_1519047 Armoracia rusticana ArPHYA16 mRNA for phytoc...   133   6e-30   
pir|S62714|S62714 phytochrome 1b - Mesotaenium caldariorum>gb:MC...   132   9e-30   Mesotaenium caldariorum
gb:AF544028_1810403 Stellaria longipes ecotype prairie phytochro...   132   1e-29   
gb:AB036764_1519048 Armoracia rusticana ArPHYA23 mRNA for phytoc...   131   2e-29   
pir|A33473|FKMUA phytochrome A - Arabidopsis thaliana>gb:ATPHYA_...   131   2e-29   
sp|P14712|PHYA_ARATH|PHYA_ARATH Phytochrome A.>pir|D86229|D86229 phytochrom...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AB036762_1519046 Armoracia rusticana phyA mRNA for phytochrom...   130   3e-29   
gb:AY741180_1626329 Arabidopsis lyrata phytochrome B (PHYB) gene...   127   3e-28   
gb:AY741195_1626344 Arabidopsis halleri phytochrome D (PHYD) gen...   125   9e-28   
gb:AY741194_1626343 Arabidopsis thaliana Ita-0 phytochrome D (PH...   125   9e-28   
gb:AY741192_1626341 Arabidopsis thaliana Aua/Rhon phytochrome D ...   125   9e-28   
gb:AY741191_1626340 Arabidopsis thaliana Kondara phytochrome D (...   125   9e-28   
gb:AY741189_1626338 Arabidopsis thaliana Ler-0 phytochrome D (PH...   125   9e-28   
gb:AY741188_1626337 Arabidopsis thaliana Gre-0 phytochrome D (PH...   125   9e-28   
gb:AY741185_1626334 Arabidopsis thaliana Bensheim phytochrome D ...   125   9e-28   
gb:AY741183_1626332 Arabidopsis thaliana No-0 phytochrome D (PHY...   125   9e-28   
gb:AY741182_1626331 Arabidopsis thaliana Lip-0 phytochrome D (PH...   125   9e-28   
gb:AY741181_1626330 Arabidopsis thaliana Br-0 phytochrome D (PHY...   125   9e-28   
gb:AY348569_1601424 Monotropastrum globosum phytochrome A (phyA)...   125   9e-28   
gb:AY133697_1581517 Arabidopsis thaliana clone C103212 putative ...   125   9e-28   
gb:ATPHYD_1553854 A.thaliana phyD gene.                               125   9e-28   
sp|P42497|PHYD_ARATH|PHYD_ARATH Phytochrome D.>pir|B71429|B71429 phytochrom...   125   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY741179_1626328 Arabidopsis thaliana Kondara phytochrome B (...   125   1e-27   
gb:AY741178_1626327 Arabidopsis thaliana RLD1 phytochrome B (PHY...   125   1e-27   
gb:AY741177_1626326 Arabidopsis thaliana Wassilewskija phytochro...   125   1e-27   
gb:AY741176_1626325 Arabidopsis thaliana Kin-0 phytochrome B (PH...   125   1e-27   
gb:AY741169_1626318 Arabidopsis thaliana Tsu-0 phytochrome B (PH...   125   1e-27   
gb:AY741167_1626316 Arabidopsis thaliana Ler-0 phytochrome B (PH...   125   1e-27   
gb:AY741166_1626315 Arabidopsis thaliana Dijon-G phytochrome B (...   125   1e-27   
gb:AY741165_1626314 Arabidopsis thaliana No-0 phytochrome B (PHY...   125   1e-27   
gb:AY741164_1626313 Arabidopsis thaliana Cvi-0 (Cape Verde Islan...   125   1e-27   
gb:AY466496_1608086 Arabidopsis thaliana phytochrome B (PHYB) ge...   125   1e-27   
sp|P34094|PHYB_SOLTU|PHYB_SOLTU Phytochrome B.>gb:STPHYB_1722851 Solanum tu...   125   1e-27   Solanum tuberosum [potatoes]
sp|P14713|PHYB_ARATH|PHYB_ARATH Phytochrome B.>pir|B33473|FKMUB phytochrome...   125   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb:LEAJ2284_1684215 Lycopersicon esculentum mRNA for phytochrome...   124   3e-27   
gb:LEAJ2282_1684213 Lycopersicon esculentum mRNA for phytochrome...   124   3e-27   
gb:LEAJ2281_1684212 Lycopersicon esculentum PHYB1 gene, complete...   124   3e-27   
gb:AY741190_1626339 Arabidopsis thaliana Dijon-G phytochrome D (...   124   3e-27   
gb:AY741175_1626324 Arabidopsis thaliana Ita-0 phytochrome B (PH...   124   3e-27   
gb:AF122901_1769855 Lycopersicon esculentum phytochrome B2 (PHYB...   123   4e-27   
gb:AY348567_1601422 Cuscuta pentagona phytochrome A (phyA) mRNA,...   123   6e-27   
gb:AY345120_1600978 Cyrtosia septentrionalis phytochrome A (phyA...   122   8e-27   
pir|S20497|S20497 phytochrome A - potato                              121   2e-26   Solanum tuberosum [potatoes]
sp|P30733|PHYA_SOLTU|PHYA_SOLTU Phytochrome A.>gb:S84872_1704643 Solanum tu...   121   2e-26   Solanum tuberosum [potatoes]
sp|P55141|PHYA_PETCR|PHYA_PETCR Phytochrome A.>pir|S52631|S52631 phytochrom...   121   2e-26   Petroselinum crispum
gb:AF309806_1785029 Populus balsamifera subsp. trichocarpa phyto...   120   3e-26   
gb:LEAJ1913_1684208 Lycopersicon esculentum phyA gene (exons 1 t...   120   5e-26   
sp|P15001|PHYA_PEA|PHYA_PEA Phytochrome A.>pir|S06856|S06856 phytochrome ...   119   8e-26   Pisum sativum [garden pea]
sp|P93673|PHYA_LATSA|PHYA_LATSA Phytochrome type A.>gb:LSU84970_1685402 Lat...   119   8e-26   Lathyrus sativus [chickling vetch]
sp|P33530|PHY1_TOBAC|PHY1_TOBAC Phytochrome A1.>gb:NTPHYA1_1691684 N.tabacu...   119   8e-26   Nicotiana tabacum [American tobacco]
gb:AY190013_1588464 Stellaria longipes PHYA2 photoreceptor (PHYA...   119   1e-25   
sp|P42496|PHY_ADICA|PHY_ADICA Phytochrome 1.>gb:AB016151_1512763 Adiantum ...   119   1e-25   Adiantum capillus-veneris [maidenhair fern]
sp|P25764|PHYB_ORYSA|PHYB_ORYSA Phytochrome B.>pir|S14065|S14065 phytochrom...   118   1e-25   Oryza sativa [red rice]
sp|P42500|PHYA_SOYBN|PHYA_SOYBN Phytochrome A.>pir|T07137|T07137 phytochrom...   118   1e-25   Glycine max [soybeans]
gb:AB109892_1526863 Oryza sativa (japonica cultivar-group) PHYB ...   117   2e-25   
pir|T14802|T14802 phytochrome B - sorghum (fragment)                  117   2e-25   Sorghum bicolor [broomcorn]
sp|P93527|PHYB_SORBI|PHYB_SORBI Phytochrome B.>gb:AF182394_1774964 Sorghum ...   117   2e-25   Sorghum bicolor [broomcorn]
gb:AF544027_1810402 Stellaria longipes ecotype prairie phytochro...   116   5e-25   
gb:AY190014_1588465 Stellaria longipes PHYA3 photoreceptor (PHYA...   115   1e-24   
gb:TAE313099_1724320 Triticum aestivum phya1 gene for phytochrom...   115   2e-24   
gb:AY190015_1588466 Stellaria longipes PHYA4 photoreceptor (PHYA...   115   2e-24   
pir|S28431|S28431 phytochrome B - potato                              115   2e-24   Solanum tuberosum [potatoes]
gb:AY234827_1591777 Zea mays cultivar B73 phytochrome B1 apoprot...   114   3e-24   
gb:AY466100_1608004 Sorghum propinquum phytochrome B (PHYB) gene...   113   5e-24   
gb:AY466099_1608003 Sorghum x drummondii voucher PI302233 phytoc...   113   5e-24   
gb:AY466098_1608002 Sorghum arundinaceum voucher PI302233 phytoc...   113   5e-24   
gb:AY466089_1607993 Sorghum bicolor isolate PHYB-Rtx430 phytochr...   113   5e-24   
gb:AY466087_1607991 Sorghum bicolor voucher PI152593 phytochrome...   113   5e-24   
gb:AY466084_1607988 Sorghum bicolor voucher PI267380 phytochrome...   113   5e-24   
pir|S00097|S00097 phytochrome 4 - oat>gb:ASAP4R_1542111 Avena sa...   112   1e-23   Avena sativa [cultivated oat]
sp|P06594|PHY4_AVESA|PHY4_AVESA Phytochrome A type 4 (AP4).                      112   1e-23   Avena sativa [cultivated oat]
sp|P55004|PHYE_PHANI|PHYE_PHANI Phytochrome E.>gb:INU39787_1683171 Ipomoea ...   111   2e-23   Ipomoea nil [qian niu]
gb:ASAP3R_1542110 Avena sativa mRNA for phytochrome (AP3).            110   5e-23   
pir|A29631|A29631 phytochrome 3 - oat>gb:ASTPHT3A_1542592 Avena ...   110   5e-23   Avena sativa [cultivated oat]
sp|P06593|PHY3_AVESA|PHY3_AVESA Phytochrome A type 3 (AP3).                      110   5e-23   Avena sativa [cultivated oat]
gb:AY234828_1591778 Zea mays cultivar B73 phytochrome B2 apoprot...   109   9e-23   
gb:AY466073_1607977 Sorghum bicolor phytochrome A (PHYA) gene, c...   108   1e-22   
gb:AY466072_1607976 Sorghum bicolor isolate PHYA-RTx430 phytochr...   108   1e-22   
gb:AY234826_1591776 Zea mays cultivar B73 phytochrome A1 apoprot...   108   1e-22   
gb:AY466083_1607987 Sorghum propinquum phytochrome A (PHYA) gene...   108   2e-22   
gb:AY466077_1607981 Sorghum arundinaceum voucher IS14567 phytoch...   108   2e-22   
gb:AY466075_1607979 Sorghum arundinaceum voucher PI213900 phytoc...   107   3e-22   
gb:AY466074_1607978 Sorghum arundinaceum voucher IS14569 phytoch...   107   3e-22   
gb:AY466071_1607975 Sorghum bicolor voucher NSL83707 phytochrome...   107   3e-22   
gb:AY466069_1607973 Sorghum bicolor voucher PI229835 phytochrome...   107   3e-22   
gb:AY466079_1607983 Sorghum arundinaceum voucher IS14485 phytoch...   107   3e-22   
gb:AY466068_1607972 Sorghum bicolor voucher PI153800 phytochrome...   107   4e-22   
sp|P93526|PHYA_SORBI|PHYA_SORBI Phytochrome a.>gb:AY466067_1607971 Sorghum ...   107   4e-22   Sorghum bicolor [broomcorn]
gb:AB109891_1526862 Oryza sativa (japonica cultivar-group) PHYA ...   106   7e-22   
sp|P10931|PHYA_ORYSA|PHYA_ORYSA Phytochrome A.>pir|S03728|S03728 phytochrom...   106   7e-22   Oryza sativa [red rice]
gb:AF178571_1774717 Lycopersicon esculentum phytochrome E (PHYE)...   105   1e-21   
sp|P19862|PHYA_MAIZE|PHYA_MAIZE Phytochrome A.>pir|JQ0382|JQ0382 phytochrom...   105   1e-21   Zea mays [maize]
gb:AY348568_1601423 Orobanche minor phytochrome A (phyA) mRNA, c...   103   4e-21   
sp|P42498|PHYE_ARATH|PHYE_ARATH Phytochrome E.>pir|S46313|S46313 phytochrom...    93   8e-18   Arabidopsis thaliana [mouse-ear cress]
sp|O49934|PHYA_POPTM|PHYA_POPTM Phytochrome A.>pir|T09835|T09835 phytochrom...    90   7e-17   Populus tremuloides
gb:AY244514_1592483 Triticum monococcum cultivar G1777 phytochro...    89   1e-16   
gb:AY741187_1626336 Arabidopsis thaliana Mh-0 phytochrome D (PHY...    87   4e-16   
gb:AY741197_1626345 Cleome hassleriana phytochrome B (PHYB) gene...    75   2e-12   
gb:AF309807_1785030 Populus balsamifera subsp. trichocarpa phyto...    67   4e-10   
gb:BX571657_777625 Wolinella succinogenes, complete genome; segm...    65   2e-09   
gb:ECU62023_134295 Erwinia carotovora subsp. carotovora sensor/r...    60   8e-08   
gb:BX950851_842306 Erwinia carotovora subsp. atroseptica SCRI104...    58   2e-07   
gb:ECEXPS_125532 Erwinia carotovora expS gene.                         58   3e-07   
gb:AY057389_587287 Serratia plymuthica putative global response ...    57   4e-07   
gb:BA000012_668843 Mesorhizobium loti MAFF303099 DNA, complete g...    57   7e-07   
pir|PN0559|PN0559 phytochrome - wild rice (strain W2025) (fragme...    55   1e-06   Oryza rufipogon [common wild rice]
gb:BX842653_825660 Bdellovibrio bacteriovorus complete genome, s...    54   4e-06   
gb:AE016824_341544 Leptospira interrogans serovar Copenhageni st...    54   4e-06   
gb:AE011611_274837 Leptospira interrogans serovar lai str. 56601...    54   4e-06   
pir|AB2017|AB2017 two-component sensor histidine kinase all1688 ...    53   7e-06   Nostoc sp. PCC 7120
gb:AE016914_356151 Chromobacterium violaceum ATCC 12472 section ...    52   1e-05   
pir|AI0860|AI0860 sensor protein [imported] - Salmonella enteric...    52   2e-05   Salmonella enterica subsp. enterica serovar Typhi
pir|PN0557|PN0557 phytochrome - wild rice (strain CP20) (fragments)    52   2e-05   Oryza rufipogon [common wild rice]
pir|PN0556|PN0556 phytochrome - wild rice (strain W180) (fragments)    52   2e-05   Oryza rufipogon [common wild rice]
gb:AE008835_244610 Salmonella typhimurium LT2, section 139 of 22...    52   2e-05   
gb:CP000026_77557 Salmonella enterica subsp. enterica serovar Pa...    52   2e-05   
gb:BX571659_778216 Wolinella succinogenes, complete genome; segm...    51   3e-05   
pir|PN0555|PN0555 phytochrome - wild rice (strain W108) (fragments)    51   3e-05   Oryza rufipogon [common wild rice]
pir|PN0552|PN0552 phytochrome - wild rice (strain W106) (fragments)    51   3e-05   Oryza rufipogon [common wild rice]
pir|PN0553|PN0553 phytochrome - wild rice (strain W2008) (fragme...    51   3e-05   Oryza rufipogon [common wild rice]
pir|PN0558|PN0558 phytochrome - wild rice (strains NE88 and NE4)...    51   3e-05   Oryza rufipogon [common wild rice]
pir|PN0560|PN0560 phytochrome - long-staminate rice (strain W144...    51   3e-05   Oryza longistaminata [long-staminate rice]
gb:D90894_124012 E.coli genomic DNA, 62.8 min.                         51   4e-05   
pir|T38457|T38457 putatve sensory transduction histidine kinase ...    51   4e-05   Schizosaccharomyces pombe
pir|G85929|G85929 hypothetical protein barA [imported] - Escheri...    51   4e-05   Escherichia coli [E. coli]
sp|P59342|BARA_SHIFL|BARA_SHIFL Sensor protein barA (EC 2.7.3.-).>gb:AE0056...    51   4e-05   Shigella flexneri
sp|P26607|BARA_ECOLI|BARA_ECOLI Sensor protein barA (EC 2.7.3.-).>pir|S2055...    51   4e-05   Escherichia coli [E. coli]
gb:AF525283_519032 Methylococcus capsulatus MmoC (mmoC) gene, pa...    50   5e-05   
gb:AE017282_427966 Methylococcus capsulatus str. Bath, complete ...    50   5e-05   
pir|S71629|S71629 sensory transduction histidine kinase dhkA - s...    50   5e-05   Dictyostelium discoideum
gb:BX571862_785767 Photorhabdus luminescens subsp. laumondii TTO...    50   6e-05   
gb:DDU42597_1377340 Dictyostelium discoideum histidine kinase A ...    49   1e-04   
gb:CR767821_116562 Ehrlichia ruminantium strain Welgevonden, com...    49   1e-04   
gb:AY263399_1314087 Dictyostelium discoideum strain Ax2 sombrero...    49   1e-04   
gb:AF362376_1265609 Dictyostelium discoideum histidine kinase Dh...    49   1e-04   
gb:BA000045_740451 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   1e-04   
gb:BA000045_740108 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   1e-04   
gb:AE017130_386752 Yersinia pestis biovar Medievalis str. 91001 ...    49   2e-04   
gb:CR925677_117469 Ehrlichia ruminantium str. Gardel, complete g...    49   2e-04   
pir|AD0149|AD0149 two component sensor kinase/response regulator...    49   2e-04   Yersinia pestis
gb:BA000032_709670 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    48   2e-04   
pir|E83443|E83443 probable sensor/response regulator hybrid PA16...    48   2e-04   Pseudomonas aeruginosa
gb:BX950851_839949 Erwinia carotovora subsp. atroseptica SCRI104...    47   4e-04   
gb:BX571869_787906 Photorhabdus luminescens subsp. laumondii TTO...    47   4e-04   
gb:BA000031_708027 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    47   5e-04   
gb:AY280634_605693 Uncultured bacterium cosmid pbiov sequence.         47   5e-04   
gb:AE011887_277414 Xanthomonas axonopodis pv. citri str. 306, se...    47   5e-04   
pir|AB2457|AB2457 two-component hybrid sensor and regulator all5...    47   5e-04   Nostoc sp. PCC 7120
gb:AF257496_1781358 Aspergillus fumigatus putative two-component...    47   7e-04   
gb:BA000040_729017 Bradyrhizobium japonicum USDA 110 DNA, comple...    47   7e-04   
gb:AF042096_472357 Bradyrhizobium japonicum UbiE (ubiE) gene, pa...    47   7e-04   
gb:CR628337_115311 Legionella pneumophila str. Lens complete gen...    46   9e-04   
pir|S75636|S75636 sensory transduction histidine kinase slr1969 ...    46   9e-04   Synechocystis sp. PCC 6803
gb:AF398464_507272 Marinomonas mediterranea protein kinase PpoS ...    46   0.001   
gb:AE017314_439814 Desulfovibrio vulgaris subsp. vulgaris str. H...    46   0.001   
gb:CP000031_84202 Silicibacter pomeroyi DSS-3, complete genome.        46   0.001   
pir|AF1829|AF1829 two-component hybrid sensor and regulator all0...    46   0.001   Nostoc sp. PCC 7120
gb:BA000045_741929 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.002   
gb:BA000045_740174 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.002   
gb:AF497904_516623 Acinetobacter baumannii GacS-like sensor kina...    45   0.002   
gb:AE017180_399563 Geobacter sulfurreducens PCA, complete genome.      45   0.002   
gb:AE016922_358464 Chromobacterium violaceum ATCC 12472 section ...    45   0.002   
gb:CR378673_96377 Photobacterium profundum SS9; segment 11/12.         45   0.002   
pir|D82696|D82696 hypothetical protein XF1330 [imported] - Xylel...    45   0.002   Xylella fastidiosa
pir|A83324|A83324 probable sensor/response regulator hybrid PA25...    45   0.002   Pseudomonas aeruginosa
pir|B82075|B82075 sensor histidine kinase/response regulator VC2...    45   0.002   Vibrio cholerae
gb:BX936398_834956 Yersinia pseudotuberculosis IP32953 genome, c...    45   0.002   
gb:AY208923_597595 Xanthomonas campestris pv. campestris SucC (s...    45   0.002   
gb:AE017340_457487 Idiomarina loihiensis L2TR, complete genome.        45   0.002   
gb:AE017180_398757 Geobacter sulfurreducens PCA, complete genome.      45   0.002   
gb:AE015830_318315 Shewanella oneidensis MR-1 section 379 of 457...    45   0.002   
gb:AE013598_296498 Xanthomonas oryzae pv. oryzae KACC10331, comp...    45   0.002   
gb:AE012425_282322 Xanthomonas campestris pv. campestris str. AT...    45   0.002   
gb:BX572597_801171 Rhodopseudomonas palustris CGA009 complete ge...    45   0.003   
gb:BA000040_735036 Bradyrhizobium japonicum USDA 110 DNA, comple...    45   0.003   
gb:AY456049_1607134 Gibberella moniliformis putative histidine k...    44   0.003   
gb:AE013496_292848 Methanosarcina mazei strain Goe1, section 278...    44   0.003   
pir|AD2580|AD2580 two component sensor kinase Atu0027 [imported]...    44   0.003   Agrobacterium fabrum str. C58
gb:BX842647_823508 Bdellovibrio bacteriovorus complete genome, s...    44   0.004   
gb:AE016827_343359 Mannheimia succiniciproducens MBEL55E, comple...    44   0.004   
gb:CR543861_104867 Acinetobacter sp. ADP1 complete genome.             44   0.004   
pir|AE2469|AE2469 two-component hybrid sensor and regulator all5...    44   0.004   Nostoc sp. PCC 7120
gb:AE017319_441301 Desulfovibrio vulgaris subsp. vulgaris str. H...    44   0.006   
gb:AE016933_361168 Bacteroides thetaiotaomicron VPI-5482, sectio...    44   0.006   
gb:AE012287_281101 Xanthomonas campestris pv. campestris str. AT...    44   0.006   
gb:XCA251547_210727 Xanthomonas campestris regulatory operon (rp...    44   0.006   
gb:CP000030_83344 Anaplasma marginale str. St. Maries, complete ...    44   0.006   
pir|S16003|S16003 rpfC protein - Xanthomonas campestris                44   0.006   Xanthomonas campestris pv. campestris str. 8004
pir|AH2036|AH2036 two-component hybrid sensor and regulator all1...    44   0.006   Nostoc sp. PCC 7120
pir|E87698|E87698 sensor histidine kinase/response regulator [im...    44   0.006   Caulobacter vibrioides
sp|P49246|RPFC_XANCP|RPFC_XANCP Sensory/regulatory protein rpfC (EC 2.7.3.-).     44   0.006   Xanthomonas campestris pv. campestris
gb:BA000045_742824 Gloeobacter violaceus PCC 7421 DNA, complete ...    43   0.008   
gb:BA000032_709760 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    43   0.008   
gb:BA000030_700083 Streptomyces avermitilis MA-4680 genomic DNA,...    43   0.008   
gb:AE016936_361908 Bacteroides thetaiotaomicron VPI-5482, sectio...    43   0.008   
gb:AE016802_336250 Vibrio vulnificus CMCP6 chromosome I section ...    43   0.008   
gb:AE013653_298844 Yersinia pestis KIM section 53 of 415 of the ...    43   0.008   
pir|A87580|A87580 sensory box histidine kinase/response regulato...    43   0.008   Caulobacter vibrioides
pir|AB0032|AB0032 two-component sensor/regulator YPO0256 [import...    43   0.008   Yersinia pestis Nepal516
gb:AE017343_1755577 Cryptococcus neoformans var. neoformans JEC2...    43   0.010   
gb:BX936398_835395 Yersinia pseudotuberculosis IP32953 genome, c...    43   0.010   
gb:BA000037_723649 Vibrio vulnificus YJ016 DNA, chromosome I, co...    43   0.010   
gb:AE017128_386156 Yersinia pestis biovar Medievalis str. 91001 ...    43   0.010   
gb:AE016985_372086 Shigella flexneri 2a str. 2457T section 8 of ...    43   0.010   
gb:AE016763_326759 Escherichia coli CFT073 section 9 of 18 of th...    43   0.010   
gb:AE013683_299137 Yersinia pestis KIM section 83 of 415 of the ...    43   0.010   
gb:AE012555_283997 Xylella fastidiosa Temecula1, section 3 of 9 ...    43   0.010   
gb:AE012344_281594 Xanthomonas campestris pv. campestris str. AT...    43   0.010   
gb:ECORCSC_130015 Escherichia coli (clone pWQ600) rcsC gene, com...    43   0.010   
gb:ECORCSBC_130013 E.coli capsule synthesis regulators B and C (...    43   0.010   
gb:D90851_123446 E.coli genomic DNA, Kohara clone #374(49.8-50.1...    43   0.010   
gb:D90850_123438 E.coli genomic DNA, Kohara clone #373(49.5-49.9...    43   0.010   
gb:AE005674_71884 Shigella flexneri 2a str. 301, complete genome.      43   0.010   
pir|AE1886|AE1886 two-component hybrid sensor and regulator all0...    43   0.010   Nostoc sp. PCC 7120
pir|A83331|A83331 probable two-component sensor PA2524 [imported...    43   0.010   Pseudomonas aeruginosa
pir|AG0410|AG0410 two-component regulatory protein (EC 2.7.3.-) ...    43   0.010   Yersinia pestis
pir|C91017|C91017 sensor for ctr capsule biosynthesis [imported]...    43   0.010   Escherichia coli O157:H7
pir|H64991|BVECCC sensor protein rcsC (EC 2.7.3.-) - Escherichia...    43   0.010   
sp|P14376|RCSC_ECOLI|RCSC_ECOLI Sensor protein rcsC (EC 2.7.3.-) (Capsular ...    43   0.010   Escherichia coli [E. coli]
gb:AY456004_1607089 Cochliobolus heterostrophus putative histidi...    42   0.013   
gb:AB120118_1527941 Cochliobolus heterostrophus BmHK3 gene for h...    42   0.013   
gb:CP000020_872258 Vibrio fischeri ES114 chromosome I, complete ...    42   0.013   
gb:BX571658_777814 Wolinella succinogenes, complete genome; segm...    42   0.013   
gb:BX294152_771032 Pirellula sp. strain 1 complete genome; segme...    42   0.013   
gb:BA000045_743811 Gloeobacter violaceus PCC 7421 DNA, complete ...    42   0.013   
gb:BA000032_708549 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    42   0.013   
gb:AY055428_587098 Vibrio cholerae STX transposon-like element a...    42   0.013   
gb:AP006841_574629 Bacteroides fragilis YCH46 DNA, complete genome.    42   0.013   
gb:AE017254_417538 Treponema denticola ATCC 35405, section 9 of ...    42   0.013   
gb:AE015879_318775 Shewanella oneidensis MR-1 section 428 of 457...    42   0.013   
gb:AE008692_241700 Zymomonas mobilis subsp. mobilis ZM4, complet...    42   0.013   
gb:CR555306_105818 Azoarcus sp. EbN1 complete genome.                  42   0.013   
pir|S74654|S74654 sensory transduction histidine kinase sll1672 ...    42   0.013   
pir|PQ0745|PQ0745 phytochrome - Mesotaenium caldariorum (fragments)    42   0.013   
sp|P54302|LUXQ_VIBHA|LUXQ_VIBHA Sensor protein luxQ (EC 2.7.3.-).>pir|S4904...    42   0.013   
gb:BX842653_825650 Bdellovibrio bacteriovorus complete genome, s...    42   0.017   
gb:BX294151_770795 Pirellula sp. strain 1 complete genome; segme...    42   0.017   
gb:AY426969_617099 Acinetobacter baumannii AdeR and AdeS genes, ...    42   0.017   
gb:AF258464_493285 Synechococcus elongatus circadian input kinas...    42   0.017   
gb:AF064527_475146 Rhodocista centenaria PPH (pph) gene, complet...    42   0.017   
gb:AE017299_435346 Leptospira interrogans serovar Copenhageni st...    42   0.017   
gb:AE012398_282076 Xanthomonas campestris pv. campestris str. AT...    42   0.017   
gb:AE011554_274230 Leptospira interrogans serovar lai str. 56601...    42   0.017   
pir|S17946|S17946 virulence sensor protein bvgS precursor - Bord...    42   0.017   
pir|S17944|S17944 virulence sensor protein bvgS precursor - Bord...    42   0.017   
pir|A40185|A40185 virulence protein bvgC - Bordetella pertussis>...    42   0.017   
sp|P16575|BVGS_BORPE|BVGS_BORPE Virulence sensor protein bvgS precursor (EC...    42   0.017   
sp|P40330|BVGS_BORPA|BVGS_BORPA Virulence sensor protein bvgS precursor (EC...    42   0.017   
sp|P26762|BVGS_BORBR|BVGS_BORBR Virulence sensor protein bvgS precursor (EC...    42   0.017   
gb:BX957222_844556 Methanococcus maripaludis S2 complete genome;...    42   0.022   
gb:BX294148_769934 Pirellula sp. strain 1 complete genome; segme...    42   0.022   
gb:BA000043_738167 Geobacillus kaustophilus HTA426 DNA, complete...    42   0.022   
gb:AY273869_604941 Pseudomonas aeruginosa PA14 pathogenicity isl...    42   0.022   
gb:AP006841_572040 Bacteroides fragilis YCH46 DNA, complete genome.    42   0.022   
gb:AF370885_505433 Acinetobacter baumannii BM4454 ade drug efflu...    42   0.022   
gb:AE017354_460268 Legionella pneumophila subsp. pneumophila str...    42   0.022   
gb:AE016913_355843 Chromobacterium violaceum ATCC 12472 section ...    42   0.022   
gb:AE012322_281389 Xanthomonas campestris pv. campestris str. AT...    42   0.022   
gb:CR628336_112003 Legionella pneumophila str. Paris complete ge...    42   0.022   
gb:CP000026_75479 Salmonella enterica subsp. enterica serovar Pa...    42   0.022   
pir|AI2195|AI2195 two-component hybrid sensor and regulator alr3...    42   0.022   
pir|H83132|H83132 probable sensor/response regulator hybrid PA41...    42   0.022   
pir|A87648|A87648 sensor histidine kinase/response regulator [im...    42   0.022   
sp|P58662|RCSC_SALTY|RCSC_SALTY Sensor protein rcsC (EC 2.7.3.-) (Capsular ...    42   0.022   
sp|Q56128|RCSC_SALTI|RCSC_SALTI Sensor protein rcsC (EC 2.7.3.-) (Capsular ...    42   0.022   
gb:ANI271843_1819447 Aspergillus nidulans tcsA gene for histidin...    41   0.029   
gb:AJ606884_1811965 Actinidia deliciosa partial phyb gene for pu...    41   0.029   
gb:AP006627_562371 Bacillus clausii KSM-K16 DNA, complete genome.      41   0.029   
gb:AE017299_435240 Leptospira interrogans serovar Copenhageni st...    41   0.029   
gb:AE016915_356542 Chromobacterium violaceum ATCC 12472 section ...    41   0.029   
gb:AE011540_274093 Leptospira interrogans serovar lai str. 56601...    41   0.029   
gb:SME591785_185043 Sinorhizobium meliloti 1021 complete chromos...    41   0.029   
gb:CR628337_115079 Legionella pneumophila str. Lens complete gen...    41   0.029   
gb:AY456035_1607120 Gibberella moniliformis putative histidine k...    41   0.038   
gb:AC116956_1206550 Dictyostelium discoideum chromosome 2 map 14...    41   0.038   
gb:BA000038_724096 Vibrio vulnificus YJ016 DNA, chromosome II, c...    41   0.038   
gb:AP008226_579180 Thermus thermophilus HB8 genomic DNA, complet...    41   0.038   
gb:AP006840_567921 Symbiobacterium thermophilum DNA, complete ge...    41   0.038   
gb:AF071215_476124 Proteus mirabilis regulator of swarming behav...    41   0.038   
gb:AE017340_457209 Idiomarina loihiensis L2TR, complete genome.        41   0.038   
gb:AE017305_436995 Thermus thermophilus HB27 section 5 of 7 of t...    41   0.038   
gb:AE017260_418981 Wolbachia endosymbiont of Drosophila melanoga...    41   0.038   
gb:AE016812_338869 Vibrio vulnificus CMCP6 chromosome II section...    41   0.038   
gb:AE013598_296024 Xanthomonas oryzae pv. oryzae KACC10331, comp...    41   0.038   
gb:AE010886_267352 Methanosarcina acetivorans str. C2A, section ...    41   0.038   
gb:SME591782_184056 Sinorhizobium meliloti 1021 complete chromos...    41   0.038   
pir|AG1928|AG1928 two-component hybrid sensor and regulator all0...    41   0.038   
pir|AF2020|AF2020 two-component hybrid sensor and regulator all1...    41   0.038   
pir|AE2192|AE2192 two-component hybrid sensor and regulator alr3...    41   0.038   
pir|T09057|T09057 probable protein-histidine kinase (EC 2.7.3.-)...    41   0.038   
gb:BX572599_801551 Rhodopseudomonas palustris CGA009 complete ge...    40   0.049   
gb:BX294153_771400 Pirellula sp. strain 1 complete genome; segme...    40   0.049   
gb:BX294138_766815 Pirellula sp. strain 1 complete genome; segme...    40   0.049   
gb:AY273869_604939 Pseudomonas aeruginosa PA14 pathogenicity isl...    40   0.049   
gb:AP006840_570492 Symbiobacterium thermophilum DNA, complete ge...    40   0.049   
gb:AF482691_514623 Pseudomonas aeruginosa strain UCBPP-PA14 prob...    40   0.049   
gb:AE017321_441763 Wolbachia endosymbiont strain TRS of Brugia m...    40   0.049   
gb:AE017229_411297 Mycobacterium avium subsp. paratuberculosis s...    40   0.049   
gb:AE017180_399600 Geobacter sulfurreducens PCA, complete genome.      40   0.049   
gb:AE015942_320890 Clostridium tetani E88, section 7 of 10 of th...    40   0.049   
gb:AE013598_295293 Xanthomonas oryzae pv. oryzae KACC10331, comp...    40   0.049   
gb:CP000031_84231 Silicibacter pomeroyi DSS-3, complete genome.        40   0.049   
gb:AY456009_1607094 Cochliobolus heterostrophus putative histidi...    40   0.064   
gb:CP000021_873776 Vibrio fischeri ES114 chromosome II, complete...    40   0.064   
gb:BX842656_826359 Bdellovibrio bacteriovorus complete genome, s...    40   0.064   
gb:BX842647_823593 Bdellovibrio bacteriovorus complete genome, s...    40   0.064   
gb:BA000038_725508 Vibrio vulnificus YJ016 DNA, chromosome II, c...    40   0.064   
gb:BA000012_669884 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.064   
gb:BA000012_668444 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.064   
gb:AY295878_606821 Xanthomonas axonopodis pv. citri strain XW47 ...    40   0.064   
gb:AE017318_440923 Desulfovibrio vulgaris subsp. vulgaris str. H...    40   0.064   
gb:AE016957_367217 Enterococcus faecalis V583, section 11 of 11 ...    40   0.064   
gb:AE016922_358552 Chromobacterium violaceum ATCC 12472 section ...    40   0.064   
gb:AE016919_357561 Chromobacterium violaceum ATCC 12472 section ...    40   0.064   
gb:AE016915_356582 Chromobacterium violaceum ATCC 12472 section ...    40   0.064   
gb:AE016811_338636 Vibrio vulnificus CMCP6 chromosome II section...    40   0.064   
gb:AE012554_283834 Xylella fastidiosa Temecula1, section 2 of 9 ...    40   0.064   
gb:AE012554_283703 Xylella fastidiosa Temecula1, section 2 of 9 ...    40   0.064   
gb:AE011969_278152 Xanthomonas axonopodis pv. citri str. 306, se...    40   0.064   
gb:AE011841_276987 Xanthomonas axonopodis pv. citri str. 306, se...    40   0.064   
gb:CR555306_107737 Azoarcus sp. EbN1 complete genome.                  40   0.064   
pir|AB2540|AB2540 two-component sensor histidine kinase all7605 ...    40   0.064   
pir|S75136|S75136 sensory transduction histidine kinase slr2104 ...    40   0.064   
sp|Q06904|SASA_SYNP7|SASA_SYNP7 Adaptive-response sensory-kinase sasA (EC 2...    40   0.064   
gb:BX957222_844373 Methanococcus maripaludis S2 complete genome;...    40   0.084   
gb:BX572593_799694 Rhodopseudomonas palustris CGA009 complete ge...    40   0.084   
gb:BA000037_722454 Vibrio vulnificus YJ016 DNA, chromosome I, co...    40   0.084   
gb:AE016934_361391 Bacteroides thetaiotaomicron VPI-5482, sectio...    40   0.084   
gb:AE016805_337263 Vibrio vulnificus CMCP6 chromosome I section ...    40   0.084   
gb:AE013598_296571 Xanthomonas oryzae pv. oryzae KACC10331, comp...    40   0.084   
gb:XORPFCGEN_210943 X.oryzae rpfC gene.                                40   0.084   
pir|AC2236|AC2236 two-component hybrid sensor and regulator alr3...    40   0.084   
pir|AB2318|AB2318 two-component hybrid sensor and regulator all4...    40   0.084   
pir|AE3506|AE3506 sensor protein chvG (EC 2.7.3.-) [imported] - ...    40   0.084   
pir|B82427|B82427 sensor protein TorS VCA0709 [imported] - Vibri...    40   0.084   
pir|C87590|C87590 sensor histidine kinase [imported] - Caulobact...    40   0.084   
sp|Q8XBY4|CUSS_ECO57|CUSS_ECO57 Sensor kinase cusS (EC 2.7.3.-).>pir|C85555...    40   0.084   
gb:CP000010_865974 Burkholderia mallei ATCC 23344 chromosome 1, ...    39   0.11    
gb:BX571965_792108 Burkholderia pseudomallei strain K96243, chro...    39   0.11    
gb:BX251410_764269 Tropheryma whipplei TW08/27, complete genome;...    39   0.11    
gb:BA000043_738100 Geobacillus kaustophilus HTA426 DNA, complete...    39   0.11    
gb:BA000031_705579 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    39   0.11    
gb:AY772188_645850 Myxococcus xanthus DZ2 red gene locus, comple...    39   0.11    
gb:AF173226_485477 Stenotrophomonas maltophilia multidrug efflux...    39   0.11    
gb:AE017227_410965 Mycobacterium avium subsp. paratuberculosis s...    39   0.11    
gb:AE016863_351640 Pseudomonas syringae pv. tomato str. DC3000 s...    39   0.11    
gb:AE016850_348570 Tropheryma whipplei str. Twist, section 1 of ...    39   0.11    
gb:AE015531_315274 Shewanella oneidensis MR-1 section 80 of 457 ...    39   0.11    
gb:AE011645_275170 Xanthomonas axonopodis pv. citri str. 306, se...    39   0.11    
pir|S75525|S75525 sensory transduction histidine kinase sll1228 ...    39   0.11    
pir|AD2215|AD2215 two-component hybrid sensor and regulator all3...    39   0.11    
pir|AD2165|AD2165 two-component hybrid sensor and regulator all2...    39   0.11    
pir|E84084|E84084 two-component sensor histidine kinase BH3477 [...    39   0.11    
pir|E83265|E83265 probable two-component sensor PA3044 [imported...    39   0.11    
pir|AI2255|AI2255 two-component sensor histidine kinase all3600 ...    39   0.11    
gb:AB036054_1518999 Emericella nidulans NHK1 mRNA, complete cds.       39   0.14    
gb:BX571657_777711 Wolinella succinogenes, complete genome; segm...    39   0.14    
gb:BX294140_767488 Pirellula sp. strain 1 complete genome; segme...    39   0.14    
gb:BA000012_669667 Mesorhizobium loti MAFF303099 DNA, complete g...    39   0.14    
gb:AP008231_581673 Synechococcus elongatus PCC 6301 DNA, complet...    39   0.14    
gb:AE016999_375559 Bacillus cereus ATCC 14579 section 2 of 18 of...    39   0.14    
gb:AE016862_351332 Pseudomonas syringae pv. tomato str. DC3000 s...    39   0.14    
gb:AE014291_309495 Brucella suis 1330 chromosome I, complete seq...    39   0.14    
gb:AE012115_279463 Xanthomonas campestris pv. campestris str. AT...    39   0.14    
gb:D90699_121258 Escherichia coli K12 genomic DNA. (12.6 - 12.9 ...    39   0.14    
pir|AF2697|AF2697 two component sensor kinase pleC [imported] - ...    39   0.14    
pir|B87365|B87365 sensor histidine kinase/response regulator [im...    39   0.14    
sp|P77485|CUSS_ECOLI|CUSS_ECOLI Sensor kinase cusS (EC 2.7.3.-).>pir|H64789...    39   0.14    
gb:CQ802951_1453430 Sequence 69 from Patent EP1415996.                 39   0.19    
gb:AF362368_1265601 Dictyostelium discoideum histidine kinase Dh...    39   0.19    
gb:AC116979_1207050 Dictyostelium discoideum chromosome 2 map 64...    39   0.19    
gb:BX842656_826392 Bdellovibrio bacteriovorus complete genome, s...    39   0.19    
gb:AP006840_568229 Symbiobacterium thermophilum DNA, complete ge...    39   0.19    
gb:AF166333_484895 Myxococcus xanthus histidine protein kinase A...    39   0.19    
gb:AE017282_428931 Methylococcus capsulatus str. Bath, complete ...    39   0.19    
gb:AE017197_402208 Rickettsia typhi str. Wilmington complete gen...    39   0.19    
gb:AE016862_351214 Pseudomonas syringae pv. tomato str. DC3000 s...    39   0.19    
gb:AE012216_280429 Xanthomonas campestris pv. campestris str. AT...    39   0.19    
gb:AE011945_277947 Xanthomonas axonopodis pv. citri str. 306, se...    39   0.19    
gb:AE011757_276215 Xanthomonas axonopodis pv. citri str. 306, se...    39   0.19    
gb:AE010879_267296 Methanosarcina acetivorans str. C2A, section ...    39   0.19    
gb:VIBGLNNTR_209894 Vibrio alginolyticus glutamine synthetase (g...    39   0.19    
gb:AE005674_70053 Shigella flexneri 2a str. 301, complete genome...    39   0.19    
pir|E97349|E97349 membrane associated sensory histidine kinase [...    39   0.19    
pir|G83109|G83109 probable two-component sensor PA4293 [imported...    39   0.19    
sp|P19906|NTRB_VIBAL|NTRB_VIBAL Nitrogen regulation protein ntrB (EC 2.7.3....    39   0.19    
gb:GCU77605_1679832 Glomerella cingulata two-component histidine...    38   0.24    
gb:AY430047_1605891 Aspergillus parasiticus histidine kinase mRN...    38   0.24    
gb:AF361475_1265564 Dictyostelium discoideum double histidine ki...    38   0.24    
gb:CP000001_855342 Bacillus cereus ZK, complete genome.                38   0.24    
gb:BX897700_828303 Bartonella quintana str. Toulouse, complete g...    38   0.24    
gb:BX842652_825186 Bdellovibrio bacteriovorus complete genome, s...    38   0.24    
gb:BX294146_769179 Pirellula sp. strain 1 complete genome; segme...    38   0.24    
gb:BA000045_740455 Gloeobacter violaceus PCC 7421 DNA, complete ...    38   0.24    
gb:BA000037_721983 Vibrio vulnificus YJ016 DNA, chromosome I, co...    38   0.24    
gb:AP008226_578272 Thermus thermophilus HB8 genomic DNA, complet...    38   0.24    
gb:AP006841_572723 Bacteroides fragilis YCH46 DNA, complete genome.    38   0.24    
gb:AE017302_436103 Thermus thermophilus HB27 section 2 of 7 of t...    38   0.24    
gb:AE017206_405046 Lactobacillus johnsonii NCC 533, section 7 of...    38   0.24    
gb:AE016807_337702 Vibrio vulnificus CMCP6 chromosome I section ...    38   0.24    
gb:CR378664_93926 Photobacterium profundum SS9; segment 2/12.          38   0.24    
gb:CP000031_84166 Silicibacter pomeroyi DSS-3, complete genome.        38   0.24    
pir|B82740|B82740 two-component system, sensor protein XF0973 [i...    38   0.24    
pir|B69439|B69439 signal-transducing histidine kinase homolog - ...    38   0.24    
pir|S75514|S75514 sensory transduction histidine kinase slr1324 ...    38   0.24    
gb:NCB23G1_1689759 Neurospora crassa DNA linkage group II BAC co...    38   0.32    
gb:CP000001_851124 Bacillus cereus ZK, complete genome.                38   0.32    
gb:BX842653_825409 Bdellovibrio bacteriovorus complete genome, s...    38   0.32    
gb:BX842646_823326 Bdellovibrio bacteriovorus complete genome, s...    38   0.32    
gb:BA000039_726683 Thermosynechococcus elongatus BP-1 DNA, compl...    38   0.32    
gb:BA000016_674232 Clostridium perfringens str. 13 DNA, complete...    38   0.32    
gb:AP006840_569587 Symbiobacterium thermophilum DNA, complete ge...    38   0.32    
gb:AE017355_461819 Bacillus thuringiensis serovar konkukian str....    38   0.32    
gb:AE017180_400609 Geobacter sulfurreducens PCA, complete genome.      38   0.32    
gb:AE016928_360022 Bacteroides thetaiotaomicron VPI-5482, sectio...    38   0.32    
gb:AE013567_293429 Methanosarcina mazei strain Goe1, section 349...    38   0.32    
gb:CR378667_94620 Photobacterium profundum SS9; segment 5/12.          38   0.32    
gb:CP000027_79147 Dehalococcoides ethenogenes 195, complete genome.    38   0.32    
pir|AI1969|AI1969 two-component sensor histidine kinase alr1308 ...    38   0.32    
pir|G72415|G72415 sensor histidine kinase - Thermotoga maritima ...    38   0.32    
pir|A82085|A82085 sensor histidine kinase FexB VC2369 [imported]...    38   0.32    
sp|Q8FK37|CUSS_ECOL6|CUSS_ECOL6 Sensor kinase cusS (EC 2.7.3.-).>gb:AE01675...    38   0.32    
gb:AY456037_1607122 Gibberella moniliformis putative histidine k...    37   0.42    
gb:AY456032_1607117 Gibberella moniliformis putative histidine k...    37   0.42    
gb:BX842655_826126 Bdellovibrio bacteriovorus complete genome, s...    37   0.42    
gb:BA000045_742702 Gloeobacter violaceus PCC 7421 DNA, complete ...    37   0.42    
gb:BA000043_739308 Geobacillus kaustophilus HTA426 DNA, complete...    37   0.42    
gb:AY359472_612995 Xanthomonas campestris putative responder (sm...    37   0.42    
gb:AP006618_556939 Nocardia farcinica IFM 10152 DNA, complete ge...    37   0.42    
gb:AE017180_400223 Geobacter sulfurreducens PCA, complete genome.      37   0.42    
gb:AE016932_360965 Bacteroides thetaiotaomicron VPI-5482, sectio...    37   0.42    
gb:AE016927_359734 Bacteroides thetaiotaomicron VPI-5482, sectio...    37   0.42    
gb:AE016916_356831 Chromobacterium violaceum ATCC 12472 section ...    37   0.42    
gb:AE013598_298185 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   0.42    
gb:AE008692_241061 Zymomonas mobilis subsp. mobilis ZM4, complet...    37   0.42    
pir|AG2471|AG2471 two-component sensor histidine kinase all5327 ...    37   0.42    
pir|AE2041|AE2041 two-component hybrid sensor and regulator alr1...    37   0.42    
pir|E83901|E83901 hypothetical protein BH2013 [imported] - Bacil...    37   0.42    
pir|A83893|A83893 two-component sensor histidine kinase BH1945 [...    37   0.42    
gb:CP000020_871795 Vibrio fischeri ES114 chromosome I, complete ...    37   0.54    
gb:BX842655_826191 Bdellovibrio bacteriovorus complete genome, s...    37   0.54    
gb:BX572098_798441 Prochlorococcus marinus MIT9313 complete geno...    37   0.54    
gb:BA000045_740793 Gloeobacter violaceus PCC 7421 DNA, complete ...    37   0.54    
gb:BA000039_725814 Thermosynechococcus elongatus BP-1 DNA, compl...    37   0.54    
gb:AL935261_552685 Lactobacillus plantarum strain WCFS1 complete...    37   0.54    
gb:AL646086_549992 Ralstonia solanacearum GMI1000 megaplasmid, c...    37   0.54    
gb:AE017355_464311 Bacillus thuringiensis serovar konkukian str....    37   0.54    
gb:AE013598_295528 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   0.54    
gb:AE013598_294399 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   0.54    
gb:AE012560_285346 Xylella fastidiosa Temecula1, section 8 of 9 ...    37   0.54    
gb:AE011944_277944 Xanthomonas axonopodis pv. citri str. 306, se...    37   0.54    


>gb:SLU32444_1715382 Solanum lycopersicum phytochrome F (PHYF) gene,
            partial cds.
          Length = 1118

 Score =  242 bits (617), Expect = 9e-63
 Identities = 120/179 (67%), Positives = 146/179 (81%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QLAK             YTEMN CEF+LGE +  V+NQ MI S+E +VQ+  D PVE S
Sbjct: 934  KQLAKIIDDTDIESIEECYTEMNSCEFNLGEVVTVVINQVMILSQERKVQVTWDSPVEVS 993

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             LYL GDNLR+QQVLSDFLTTA+LFTP FE+SSV FR+I R+E+IG KM+++HLEFRITH
Sbjct: 994  QLYLIGDNLRLQQVLSDFLTTAILFTP-FEDSSVHFRVIPRKERIGTKMYIMHLEFRITH 1052

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            P+PGIP++LIQ MF+Y +S+SREG GLYISQKL+KIM+GTVQYLREA+RSSFIIL+EFP
Sbjct: 1053 PSPGIPDDLIQHMFHYSRSISREGFGLYISQKLVKIMDGTVQYLREADRSSFIILVEFP 1111



>gb:TAE295224_1724303 Triticum aestivum phyC gene for phytochrome C,
            exons 1-4.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY672999_1621337 Triticum aestivum cultivar Soleil phytochrome C
            (PhyC-5B) gene, complete cds.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNAVEFNLEEALNTVLMQGMSLSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SIYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY672998_1621336 Triticum aestivum cultivar Soleil putative
            non-LTR retroelement and Tourist MITE, complete sequence;
            and phytochrome C (PhyC-5A) gene, complete cds.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY672997_1621335 Triticum aestivum cultivar Saitama 27 Tourist
            MITE, complete sequence; and phytochrome C (PhyC-5A)
            gene, complete cds.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY672995_1621333 Triticum aestivum cultivar Chinese Spring Tourist
            MITE, complete sequence; and phytochrome C (PhyC-5A)
            gene, complete cds.>gb:AY672996_1621334 Triticum aestivum
            cultivar Reward Tourist MITE, complete sequence; and
            phytochrome C (PhyC-5A) gene, complete cds.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY672994_1621332 Triticum aestivum subsp. spelta cultivar Grey
            Tourist MITE, complete sequence; and phytochrome C
            (PhyC-5A) gene, complete cds.
          Length = 1139

 Score =  188 bits (477), Expect = 1e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY673000_1621338 Triticum aestivum cultivar Soleil phytochrome C
            (PhyC-5D) gene, complete cds.>gb:AY673001S2_1621339
            Triticum aestivum cultivar Chinese Spring phytochrome C
            (PhyC-5D) gene, complete cds.
          Length = 1139

 Score =  187 bits (476), Expect = 2e-46
 Identities = 96/181 (53%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 944  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSLSKEKQISLDRDWPVEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 1004 SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AF406643_1796904 Hordeum vulgare phytochrome C mRNA, partial cds.
          Length = 830

 Score =  187 bits (475), Expect = 2e-46
 Identities = 101/199 (50%), Positives = 133/199 (66%), Gaps = 1/199 (0%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 627  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSLSKEKQISLDRDWPVEVS 686

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+YL+GD+LR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HLEFR+ H
Sbjct: 687  SMYLYGDDLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHLEFRVVH 745

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP- 537
            PAPG+PE LIQEMF +   +SREGLGL+ISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 746  PAPGVPEALIQEMFRHGPGVSREGLGLHISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 805

Query: 538  ASLRSDHQ*LQSSVCSPPA 594
            A L S      +S  S P+
Sbjct: 806  AQLNSKRSKPSTSKWSKPS 824



>gb:AF141942_1771608 Oryza sativa phytochrome C (phyC) gene, complete
            cds.
          Length = 1137

 Score =  186 bits (473), Expect = 4e-46
 Identities = 97/181 (53%), Positives = 123/181 (67%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             YTEM+  +F+L EA+  V+ QAM  S+E Q+ I  D P E S
Sbjct: 944  EQLKKILHDTDLESIEQCYTEMSTVDFNLEEALNTVLMQAMPQSKEKQISIDRDWPAEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             ++L GDNLR+QQVL+DFL   + FT    E  ++ ++I R E IG+ M + HLEFR+ H
Sbjct: 1004 CMHLCGDNLRLQQVLADFLACTLQFTQP-AEGPIVLQVIPRMENIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +    SREGLGLYISQKL+K M+GTVQYLREAE SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHSPGASREGLGLYISQKLVKTMSGTVQYLREAESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY234829_1591779 Zea mays cultivar B73 phytochrome C1 apoprotein
            (phyC1) gene, complete cds.
          Length = 1135

 Score =  185 bits (469), Expect = 1e-45
 Identities = 92/181 (50%), Positives = 126/181 (69%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L +A+  V+ Q +   +E Q+ I  + PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEQALNTVLMQGIPLGKEKQISIERNWPVEVS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQ+L+D+L  A+ FT    E  ++ ++++++E IG+ M + HLEFRI H
Sbjct: 1002 CMYLYGDNLRLQQILADYLACALQFTQT-AEGPIVLQVMSKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYISQKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFQHNPGVSREGLGLYISQKLVKTMSGTVQYLREADTSSFIILMEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>sp|Q9ZWI9|PHYC_ORYSA Phytochrome C.>gb:AB018442_1513952 Oryza sativa
            (japonica cultivar-group) mRNA for phytochrome C,
            complete cds.>gb:AC092556_1735450 Oryza sativa chromosome
            3 BAC OSJNBa0047E24 genomic sequence, complete
            sequence.>gb:AC135225_1742095 Oryza sativa chromosome 3
            BAC OJ1112_G08 genomic sequence, complete
            sequence.>gb:AF377947_1793306 Oryza sativa (japonica
            cultivar-group) chromosome 3, BAC clone OSJNBa0032E21,
            complete sequence.
          Length = 1137

 Score =  185 bits (469), Expect = 1e-45
 Identities = 96/181 (53%), Positives = 123/181 (67%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL K             YTEM+  +F+L EA+  V+ QAM  S+E Q+ I  D P E S
Sbjct: 944  EQLKKILHDTDLESIEQCYTEMSTVDFNLEEALNTVLMQAMPQSKEKQISIDRDWPAEVS 1003

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             ++L GDNLR+QQVL+DFL   + FT    E  ++ ++I R E IG+ M + HLEFR+ H
Sbjct: 1004 CMHLCGDNLRLQQVLADFLACMLQFTQP-AEGPIVLQVIPRMENIGSGMQIAHLEFRLVH 1062

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +    SREGLGLYISQKL+K M+GTVQYLRE+E SSFI+L+EFP 
Sbjct: 1063 PAPGVPEALIQEMFRHSPGASREGLGLYISQKLVKTMSGTVQYLRESESSSFIVLVEFPV 1122

Query: 541  S 543
            +
Sbjct: 1123 A 1123



>gb:AY466463_1608079 Sorghum arundinaceum voucher IS14567 phytochrome
            C (PHYC) gene, complete cds.>gb:AY466464_1608080 Sorghum
            arundinaceum voucher PI302105 phytochrome C (PHYC) gene,
            complete cds.>gb:AY466465_1608081 Sorghum arundinaceum
            voucher IS14485 phytochrome C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (468), Expect = 2e-45
 Identities = 97/192 (50%), Positives = 128/192 (66%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  SLRSDHQ*LQSS 576
            +  S  +   SS
Sbjct: 1121 AQLSSKRSKPSS 1132



>gb:AY466467_1608083 Sorghum arundinaceum voucher PI302233 phytochrome
            C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466466_1608082 Sorghum arundinaceum voucher PI225905 phytochrome
            C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466460_1608076 Sorghum arundinaceum voucher IS14569 phytochrome
            C (PHYC) gene, complete cds.>gb:AY466461_1608077 Sorghum
            arundinaceum voucher PI213900 phytochrome C (PHYC) gene,
            complete cds.>gb:AY466462_1608078 Sorghum arundinaceum
            voucher IS14503 phytochrome C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466458_1608074 Sorghum bicolor phytochrome C (PHYC) gene,
            complete cds.>gb:AY466459_1608075 Sorghum bicolor
            phytochrome C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466455_1608071 Sorghum bicolor voucher PI229835 phytochrome C
            (PHYC) gene, complete cds.>gb:AY466456_1608072 Sorghum
            bicolor voucher PI152593 phytochrome C (PHYC) gene,
            complete cds.>gb:AY466457_1608073 Sorghum bicolor voucher
            NSL83707 phytochrome C (PHYC) gene, complete
            cds.>gb:AY466468_1608084 Sorghum x drummondii voucher
            PI199869 phytochrome C (PHYC) gene, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466453_1608069 Sorghum bicolor voucher PI267380 phytochrome C
            (PHYC) gene, complete cds.>gb:AY466454_1608070 Sorghum
            bicolor voucher PI153800 phytochrome C (PHYC) gene,
            complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:AY466452_1608068 Sorghum propinquum phytochrome C (PHYC) gene,
            complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>sp|P93528|PHYC_SORBI Phytochrome C.>pir|T14803|T14803 phytochrome C -
            sorghum>gb:SBU56731_1704935 Sorghum bicolor phytochrome C
            (PHYC) mRNA, complete cds.
          Length = 1135

 Score =  184 bits (467), Expect = 2e-45
 Identities = 94/181 (51%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y EMN  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMEMNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEIS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +YL+GDNLR+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 RMYLYGDNLRLQQVLADYLACALQFTQP-AEGPIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYI QKL+K M+GTVQYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFRHNPEVSREGLGLYICQKLVKTMSGTVQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>gb:ATPHYCG_1553851 A.thaliana phyC gene.
          Length = 1111

 Score =  182 bits (461), Expect = 1e-44
 Identities = 95/181 (52%), Positives = 129/181 (71%), Gaps = 2/181 (1%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQLAK             Y E++C EF L E+++AVV Q M  S E +VQI CD P E S
Sbjct: 929  EQLAKVISDSDIEGIEEGYVELDCSEFGLQESLEAVVKQVMELSIERKVQISCDYPQEVS 988

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+ L+GDNLR+QQ+LS+ L +++ FTP ++   V F++IAR E IG +M  V LEFRI H
Sbjct: 989  SMRLYGDNLRLQQILSETLLSSIRFTPAWKGLCVSFKVIARIEAIGKRMKRVELEFRIIH 1048

Query: 361  PAPGIPEELIQEMFN-YKQSMSREGLGLYISQKLIKIM-NGTVQYLREAERSSFIILLEF 534
            PAPG+PE+L++EMF   ++  SREGLGL+I+QKL+K+M  GT++YLRE+E S+F+IL EF
Sbjct: 1049 PAPGLPEDLVREMFQPLRKGTSREGLGLHITQKLVKLMERGTLRYLRESEMSAFVILTEF 1108

Query: 535  P 537
            P
Sbjct: 1109 P 1109



>gb:AY394847_1604783 Arabidopsis thaliana ecotype Kas-1 phytochrome c
            (phyC) gene, complete cds.
          Length = 1111

 Score =  181 bits (460), Expect = 1e-44
 Identities = 95/181 (52%), Positives = 128/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQLAK             Y E+ C EF L E+++AVV Q M  S E +VQI CD P E S
Sbjct: 929  EQLAKVISDSDIEGIEEGYVELGCSEFGLQESLEAVVKQVMELSIERKVQISCDYPQEVS 988

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+ L+GDNLR+QQ+LS+ L +++ FTP ++   V F++IAR E IG +M  V LEFRI H
Sbjct: 989  SMRLYGDNLRLQQILSETLLSSIRFTPAWKGLCVSFKVIARIEAIGKRMKRVELEFRIIH 1048

Query: 361  PAPGIPEELIQEMFN-YKQSMSREGLGLYISQKLIKIM-NGTVQYLREAERSSFIILLEF 534
            PAPG+PE+L++EMF   ++  SREGLGL+I+QKL+K+M  GT++YLRE+E S+F+IL EF
Sbjct: 1049 PAPGLPEDLVREMFQPLRKGTSREGLGLHITQKLVKLMERGTLRYLRESEMSAFVILTEF 1108

Query: 535  P 537
            P
Sbjct: 1109 P 1109



>gb:AY234830_1591780 Zea mays cultivar B73 phytochrome C2 apoprotein
            (phyC2) gene, complete cds.
          Length = 1135

 Score =  181 bits (460), Expect = 1e-44
 Identities = 91/181 (50%), Positives = 124/181 (68%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E N  EF+L EA+  V+ Q +   +E ++ I  D PVE S
Sbjct: 942  DQLKKILHDTDLESIEQCYMETNTVEFNLEEALNTVLMQGIPLGKEKRISIERDWPVEVS 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
             +Y++GDN+R+QQVL+D+L  A+ FT    E  ++ ++I ++E IG+ M + HLEFRI H
Sbjct: 1002 HMYIYGDNIRLQQVLADYLACALQFTQP-AEGHIVLQVIPKKENIGSGMQIAHLEFRIVH 1060

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            PAPG+PE LIQEMF +   +SREGLGLYISQKL+K M+GT+QYLREA+ SSFIIL+EFP 
Sbjct: 1061 PAPGVPEALIQEMFQHNPGVSREGLGLYISQKLVKTMSGTLQYLREADTSSFIILIEFPV 1120

Query: 541  S 543
            +
Sbjct: 1121 A 1121



>sp|P14714|PHYC_ARATH Phytochrome C.>pir|C33473|FKMUC phytochrome C -
            Arabidopsis thaliana>gb:AB005236_1509389 Arabidopsis
            thaliana genomic DNA, chromosome 5, P1
            clone:MIK22.>gb:ATPHYC_1553850 Arabidopsis thaliana phyC
            mRNA for phytochrome.
          Length = 1111

 Score =  181 bits (459), Expect = 2e-44
 Identities = 95/181 (52%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQLAK             Y E++C EF L E+++AVV Q M  S E +VQI CD P E S
Sbjct: 929  EQLAKVISDSDIEGIEEGYVELDCSEFGLQESLEAVVKQVMELSIERKVQISCDYPQEVS 988

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S+ L+GDNLR+QQ+LS+ L +++ FTP      V F++IAR E IG +M  V LEFRI H
Sbjct: 989  SMRLYGDNLRLQQILSETLLSSIRFTPALRGLCVSFKVIARIEAIGKRMKRVELEFRIIH 1048

Query: 361  PAPGIPEELIQEMFN-YKQSMSREGLGLYISQKLIKIM-NGTVQYLREAERSSFIILLEF 534
            PAPG+PE+L++EMF   ++  SREGLGL+I+QKL+K+M  GT++YLRE+E S+F+IL EF
Sbjct: 1049 PAPGLPEDLVREMFQPLRKGTSREGLGLHITQKLVKLMERGTLRYLRESEMSAFVILTEF 1108

Query: 535  P 537
            P
Sbjct: 1109 P 1109



>gb:AF544029_1810404 Stellaria longipes ecotype prairie phytochrome C
            (PHYC) mRNA, complete cds.
          Length = 1114

 Score =  179 bits (454), Expect = 7e-44
 Identities = 95/180 (52%), Positives = 120/180 (66%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E +  +F+L EA+ AVV+Q M  S+E QV I  D P + S 
Sbjct: 935  QLMKIIEDTDIPSIEEGYLETSSDDFNLLEALDAVVSQVMPLSQESQVHIKHDFPSDLSP 994

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
            + LFGDN+R+QQ+LS+FLT AV FTP    SSV F + +R E +G+KM + H+EFRITHP
Sbjct: 995  VCLFGDNVRLQQILSNFLTIAVRFTPPSTGSSVKFAVSSRTEHVGSKMQMFHVEFRITHP 1054

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             PG+PE LI+EMF     MSR GL LYIS KL+KIMNGT+QYLR  + SSFI+ LEFP +
Sbjct: 1055 LPGVPENLIREMFQRSPGMSRGGLSLYISHKLVKIMNGTLQYLRGEDYSSFIVFLEFPVA 1114



>sp|Q01549|PHY1_SELMA Phytochrome 1.>pir|S31280|S31280 phytochrome -
            Martens's spike moss>gb:SMPHY1G_1715519 S.martensii phy1
            gene for phytochrome.
          Length = 1134

 Score =  164 bits (416), Expect = 2e-39
 Identities = 77/167 (46%), Positives = 121/167 (72%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y E++  EF +G  + AV++Q MI S+E  +Q++ + P E  +++L+GD +R+QQVL+DF
Sbjct: 959  YLELDTTEFMMGTVMDAVISQGMITSKEKNLQLIRETPKEIKAMFLYGDQVRLQQVLADF 1018

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            L  A+ FTP   E+ V  ++   R+++G  +HV+HLEFRITHP  G+PEEL+QEMF+  +
Sbjct: 1019 LLNAIRFTPS-SENWVGIKVATSRKRLGGVVHVMHLEFRITHPGVGLPEELVQEMFDRGR 1077

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
             M++EGLGL + +KL+K+MNG V+Y+REA ++ F++ LE P + R D
Sbjct: 1078 GMTQEGLGLSMCRKLVKLMNGEVEYIREAGKNYFLVSLELPLAQRDD 1124



>sp|Q40762|PHY_PICAB Phytochrome.>pir|T14842|T14842 phytochrome -
            Norway spruce>gb:PAU60264_1698921 Picea abies phytochrome
            mRNA, complete cds.
          Length = 1136

 Score =  164 bits (414), Expect = 3e-39
 Identities = 87/178 (48%), Positives = 120/178 (67%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E++  EF+LG  + AVV+Q MI SRE  +Q++ D P E  +
Sbjct: 954  QLVKVLDDADLESIEDGYLELDTIEFTLGTVLDAVVSQGMILSREKGLQLIRDSPEEIKT 1013

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
            + L+GD LR+QQ+LS+FL  A+ F+    E  V  +++  +  +G+ ++V+H+EFRITH 
Sbjct: 1014 MCLYGDQLRLQQILSNFLINALRFST--SEGWVGNKVVPTKRHLGSGVNVMHMEFRITHS 1071

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
              GIPEELI+EMF + Q M +EGLGLY+ Q+L+KIMNG VQYLREA RSSFII +EFP
Sbjct: 1072 GQGIPEELIKEMFVHNQDMFQEGLGLYMCQQLVKIMNGDVQYLREAGRSSFIINVEFP 1129



>gb:AY123147_1580015 Physcomitrella patens phytochrome (phy2) gene,
            complete cds.
          Length = 1130

 Score =  162 bits (411), Expect = 7e-39
 Identities = 82/192 (42%), Positives = 126/192 (65%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E++  EF +G  + AVV+Q MI SRE  +Q++ + P E  +
Sbjct: 939  QLRKILDDLDLESIEDGYLELDTTEFEMGTVMDAVVSQGMITSREKGLQLIRETPSEIKN 998

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
            + L+GD +R+QQVL+DFL  AV FTP   E  V  +++  ++++G  +HV+H+EFR+THP
Sbjct: 999  MCLYGDQVRLQQVLADFLLNAVRFTPS-SEGWVGIKVVPTKKRLGRGVHVMHVEFRVTHP 1057

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ EMF   + M++EGLGL + +KL+K+MNGTVQY+RE  +S F++ +E P +
Sbjct: 1058 GLGLPEELVHEMFGRGRGMTQEGLGLSMCRKLVKLMNGTVQYIRETGKSCFLVEVELPLA 1117

Query: 544  LRSDHQ*LQSSV 579
             R D   ++S+V
Sbjct: 1118 QRDDAGSVRSTV 1129



>sp|Q39557|PHY2_CERPU Phytochrome 2.>gb:CPU56698_1648919 Ceratodon
            purpureus phytochrome photoreceptor CERPU;PHY0;2 (PHY0;2)
            gene, complete cds.
          Length = 1121

 Score =  159 bits (403), Expect = 6e-38
 Identities = 77/185 (41%), Positives = 121/185 (65%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E++  EF +G  + AV++Q M  SRE  +QI+ + P E S
Sbjct: 933  QQLQKVLNDMDLESIEDGYLELDTAEFEMGTVMDAVISQGMTTSREKGLQIIRETPREIS 992

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            ++ LFGD +R+QQVLSDFL  A+ FTP   E  V  +++  R+++G  +HV+HLEFR++H
Sbjct: 993  TMRLFGDQIRLQQVLSDFLINAIRFTPS-SEGWVKIKVVPTRKRLGGNVHVMHLEFRVSH 1051

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            P  G+P+EL+ EM++  + M++EGLGL + +KL+++MNG VQY+RE  +  F++ +E P 
Sbjct: 1052 PGGGLPDELVLEMYDRAKGMTQEGLGLNMCRKLVRLMNGDVQYVRENAQCYFVVYVELPM 1111

Query: 541  SLRSD 555
            + R D
Sbjct: 1112 AQRDD 1116



>gb:CPU72993_1648925 Ceratodon purpureus phytochrome photoreceptor
            (CpPHY2) mRNA, complete cds.
          Length = 1121

 Score =  159 bits (402), Expect = 7e-38
 Identities = 77/185 (41%), Positives = 121/185 (65%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E++  EF +G  + AV++Q M  SRE  +QI+ + P E S
Sbjct: 933  QQLQKVLNDMDLESIEDGYLELDTAEFEMGTVMDAVISQGMTTSREKGLQIIRETPREIS 992

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            ++ LFGD +R+QQVLSDFL  A+ FTP   E  V  +++  R+++G  +HV+HLEFR++H
Sbjct: 993  TMRLFGDQIRLQQVLSDFLINAIRFTPS-SEGWVKIKVVPTRKRLGGNVHVMHLEFRVSH 1051

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            P  G+P+EL+ EM++  + M++EGLGL + +KL+++MNG VQY+RE  +  F++ +E P 
Sbjct: 1052 PGGGLPDELVLEMYDRGKGMTQEGLGLNMCRKLVRLMNGDVQYVRENAQCYFVVYVELPM 1111

Query: 541  SLRSD 555
            + R D
Sbjct: 1112 AQRDD 1116



>gb:AB022917_1515300 Marchantia paleacea var. diptera PhyMpd mRNA for
            phytochrome, complete cds.
          Length = 1126

 Score =  158 bits (400), Expect = 1e-37
 Identities = 78/167 (46%), Positives = 116/167 (69%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y E++  EF +G  + AV++Q MI SRE  +Q++ D P +  +L LFGD +R+QQVL+DF
Sbjct: 956  YLELDTAEFIMGTVMDAVISQGMITSREKGLQLIWDTPRDTKNLCLFGDQVRLQQVLADF 1015

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            L  A+ FTP   E  V  + ++ R + G  +HVVH EFR+THP  G+PEEL+QEMF+  +
Sbjct: 1016 LLNAIRFTPS-SEGWVGIKGVSSRHRQGGGVHVVHFEFRVTHPGAGLPEELVQEMFDRGR 1074

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
             M++EGLGL + +KL+K+M+G VQY+REA +  F++ +E P + R D
Sbjct: 1075 GMTQEGLGLNMCRKLLKLMSGDVQYIREAGKCYFLVNVELPIAQRDD 1121



>sp|P36505|PHY1_PHYPA Phytochrome 1.>pir|S37206|S37206 phytochrome -
            moss (Physcomitrella patens)>gb:PPMRPHYT_1701396 P.patens
            mRNA for phytochrome.
          Length = 1132

 Score =  156 bits (395), Expect = 5e-37
 Identities = 77/185 (41%), Positives = 118/185 (63%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E++  EF +G  + AV++Q M  SRE  +QI  + P E +
Sbjct: 935  QQLQKSLNDMDLESIEDGYLELDTAEFEMGTVMNAVISQGMTTSREKGLQIFRETPREIN 994

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            ++ L GD +R+QQVLSDFL   V FTP   E  V  +++  R+++G  +HVVHLEFR++H
Sbjct: 995  TMRLLGDQIRLQQVLSDFLLNTVRFTPS-PEGWVKIKVVPTRKRLGGSVHVVHLEFRVSH 1053

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            P  G+PEEL+ EM++  + M++EGLGL + +KL+++MNG V Y+REA +  F++ +E P 
Sbjct: 1054 PGAGLPEELVLEMYDRGKGMTQEGLGLNMCRKLVRLMNGDVHYVREAMQCYFVVNVELPM 1113

Query: 541  SLRSD 555
            + R D
Sbjct: 1114 AQRDD 1118



>gb:AY123146_1580014 Physcomitrella patens phytochrome (phy1) gene,
            complete cds.
          Length = 1123

 Score =  156 bits (394), Expect = 6e-37
 Identities = 77/185 (41%), Positives = 118/185 (63%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E++  EF +G  + AV++Q M  SRE  +QI  + P E +
Sbjct: 935  QQLQKVLNDMDLESIEDGYLELDTAEFEMGTVMNAVISQGMTTSREKGLQIFRETPREIN 994

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            ++ L GD +R+QQVLSDFL   V FTP   E  V  +++  R+++G  +HVVHLEFR++H
Sbjct: 995  TMRLLGDQIRLQQVLSDFLLNTVRFTPS-PEGWVKIKVVPTRKRLGGSVHVVHLEFRVSH 1053

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            P  G+PEEL+ EM++  + M++EGLGL + +KL+++MNG V Y+REA +  F++ +E P 
Sbjct: 1054 PGAGLPEELVLEMYDRGKGMTQEGLGLNMCRKLVRLMNGDVHYVREAMQCYFVVNVELPM 1113

Query: 541  SLRSD 555
            + R D
Sbjct: 1114 AQRDD 1118



>gb:AY123148_1580016 Physcomitrella patens phytochrome (phy3) gene,
            complete cds.
          Length = 1122

 Score =  155 bits (393), Expect = 8e-37
 Identities = 79/185 (42%), Positives = 119/185 (64%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL K             Y E++  EF +   + AV++Q M  SRE  +QI+ + P E  
Sbjct: 934  QQLQKVLNDLDLESIEDGYLELDTAEFEMRTVMDAVISQGMTISREKGLQIIRETPREII 993

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            ++ LFGD +R+QQVLSDFL  AV FTP   E  V  +++  R+++G   HV+HLEFR++H
Sbjct: 994  TMRLFGDQVRLQQVLSDFLLNAVRFTPS-SEGWVKIKVVPTRKRLGGNEHVMHLEFRVSH 1052

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
            P  G+PEEL+ EMF+  + M++EGLGL I +KL+++MNG VQY+REA +  F++ +E P 
Sbjct: 1053 PGAGLPEELVLEMFDKGKGMTQEGLGLNICRKLVRLMNGDVQYVREAMQCYFVLYVELPL 1112

Query: 541  SLRSD 555
            + + D
Sbjct: 1113 AQQDD 1117



>gb:AY123145_1580013 Physcomitrella patens phytochrome (phy4) gene,
            complete cds.
          Length = 1126

 Score =  155 bits (391), Expect = 1e-36
 Identities = 79/184 (42%), Positives = 119/184 (64%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E++  EF +G  + AVV+Q MI SRE  +Q++ + P E  +
Sbjct: 939  QLRKVLDDMDLESIEDGYLELDTNEFVMGTVMDAVVSQGMITSREKGLQLIRETPREIKN 998

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
            + LFGD +R+QQVL+DFL  AV FTP      V  +++  ++++G  +HV+HLEFR+TH 
Sbjct: 999  MCLFGDQVRLQQVLADFLLNAVKFTPS-SGGWVGIKVVPTKKRLGGGIHVMHLEFRVTHS 1057

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ EMF+  + M++EGLGL + +KL+K+MNG VQY+RE  +S F++ +E P +
Sbjct: 1058 GMGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMNGNVQYIRETGKSYFLVEVELPLA 1117

Query: 544  LRSD 555
             R D
Sbjct: 1118 QRDD 1121



>gb:AY123149_1580017 Ceratodon purpureus phytochrome (phy3) gene,
            complete cds.
          Length = 1126

 Score =  152 bits (385), Expect = 7e-36
 Identities = 77/184 (41%), Positives = 116/184 (63%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E+   E  LG  + AVV+Q MI SRE  +Q++ + P E + 
Sbjct: 939  QLRKILDDMDLESIEDGYLELETAESELGSMMDAVVSQGMITSREKGLQLIRETPREIND 998

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
            + LFGD +R+Q VL+DFL  AV  TP   E  V  +++  ++++G   HVVHLEFR+ HP
Sbjct: 999  MSLFGDQVRLQHVLADFLLNAVRLTPS-SEGWVGIKVVPTKKRLGGGFHVVHLEFRVAHP 1057

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ EMF+  + M++EGLGL + +KL+K+MNG V+Y+R+  +S F++ LE P +
Sbjct: 1058 GSGLPEELVHEMFDRGRGMTQEGLGLSMCRKLVKLMNGEVKYIRDTGKSYFLVNLELPLT 1117

Query: 544  LRSD 555
            +R +
Sbjct: 1118 VRDE 1121



>gb:PSY271627_1702601 Pinus sylvestris partial mRNA for phytochrome N
            (phyN gene).
          Length = 876

 Score =  150 bits (380), Expect = 3e-35
 Identities = 73/163 (44%), Positives = 111/163 (68%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y +++  EF+LG  + AV++Q MI S E  ++I  DLP E ++  L+GD  R+QQ+L++F
Sbjct: 711  YLDLDTVEFTLGALLDAVISQGMIQSEEKGLEIGYDLPREITTTGLYGDQSRLQQILANF 770

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            L T + FTP   E  V  ++   +  +G  ++V+ +EFRITHP PG+PE+L+Q+MFN+  
Sbjct: 771  LVTVIQFTPA--EKWVRIKVSPTKRHLGGGVYVIGIEFRITHPGPGLPEKLVQQMFNFDP 828

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             MS+EG GL I +KL+++MNG VQYLR    SSF+I++E   S
Sbjct: 829  DMSQEGFGLLICRKLVRLMNGDVQYLRGGGTSSFVIVVELATS 871



>sp|Q41046|PHY_PINSY Phytochrome.>pir|T09701|T09701 phytochrome -
            Scotch pine>gb:PSPHYTGEN_1702345 P.sylvestris mRNA for
            phytochrome.
          Length = 1131

 Score =  150 bits (379), Expect = 3e-35
 Identities = 74/167 (44%), Positives = 114/167 (68%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y E++  EF LG  I AVV+Q MI  RE  +Q++ ++P E  ++ L+GD ++IQQ+L+DF
Sbjct: 961  YMELDTAEFILGTVIDAVVSQGMIVLREKGLQLIREIPGEVKTMRLYGDEVKIQQILADF 1020

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            L   + FTP   E  V  ++    +Q+G  +HVVHLEFRITHP  G+P EL+Q++F+  Q
Sbjct: 1021 LLNVLRFTPS-PEGWVAIKVFPTLKQLGGGLHVVHLEFRITHPGLGLPAELVQDLFDRSQ 1079

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
              ++EG+GL + +KL+K+MNG V+Y+RE+    F++ +EFP + R D
Sbjct: 1080 WATQEGVGLSMCRKLLKLMNGDVRYIRESGICYFLVNVEFPMAQRED 1126



>gb:PNPHY_1700910 P.nudum mRNA for phytochrome.
          Length = 794

 Score =  149 bits (375), Expect = 1e-34
 Identities = 70/167 (41%), Positives = 118/167 (70%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF++G  + AV++Q MI SRE  +Q++ + PV+  ++ L+GD LR+QQVL+DFLT
Sbjct: 628  DLDTIEFTMGTVMDAVISQGMIRSREKGLQLIRETPVDIKNMRLYGDQLRLQQVLADFLT 687

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
            TAV FT    +  V  +++   + +G  +HV+  ++RI+HP  GIPE+L+Q+MF+  + +
Sbjct: 688  TAVRFTSS-SDGWVGIKVVPTMKGLGGGLHVMRFDYRISHPGKGIPEDLVQQMFDCSREI 746

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSDHQ 561
            ++EG+GL +S+KL+++MNG V Y+REA    F++ +EFP + R D Q
Sbjct: 747  TQEGMGLSVSRKLVRLMNGDVSYIREAGVCYFLVNVEFPLADRDDSQ 793



>pir|S37158|S37158 phytochrome - whisk fern (Psilotum nudum)
            (fragment)
          Length = 794

 Score =  149 bits (375), Expect = 1e-34
 Identities = 70/167 (41%), Positives = 118/167 (70%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF++G  + AV++Q MI SRE  +Q++ + PV+  ++ L+GD LR+QQVL+DFLT
Sbjct: 628  DLDTIEFTMGTVMDAVISQGMIRSREKGLQLIRETPVDIKNMRLYGDQLRLQQVLADFLT 687

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
            TAV FT    +  V  +++   + +G  +HV+  ++RI+HP  GIPE+L+Q+MF+  + +
Sbjct: 688  TAVRFTSS-SDGWVGIKVVPTMKGLGGGLHVMRFDYRISHPGKGIPEDLVQQMFDCSREI 746

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSDHQ 561
            ++EG+GL +S+KL+++MNG V Y+REA    F++ +EFP + R D Q
Sbjct: 747  TQEGMGLSVSRKLVRLMNGDVSYIREAGVCYFLVNVEFPLADRDDSQ 793



>gb:AB016232_1512790 Adiantum capillus-veneris PHY2 mRNA for
            phytochrome 2, complete cds.
          Length = 1140

 Score =  141 bits (355), Expect = 2e-32
 Identities = 68/165 (41%), Positives = 111/165 (67%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF++G  + AV++Q MI SRE  +Q++ +  VE  +  LFGD  R+QQVL+DFLT
Sbjct: 977  DLDTLEFTMGTVMDAVISQGMIRSREKGLQLIRETHVEIKNTRLFGDQYRLQQVLADFLT 1036

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
            TA+ FT    +  V  +++   + +   +H+VH EFR++HP  GIPE+L+Q+M++  Q +
Sbjct: 1037 TAIRFTSS-SDGWVGIKVVPTIKNMKDGLHIVHFEFRVSHPGSGIPEDLVQQMYDRSQEI 1095

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
            ++EG+GL +S+KL+K+MNG V+Y REA    F++ +E P     D
Sbjct: 1096 TQEGMGLSVSRKLVKLMNGDVKYTREAGVCYFLVTVELPLVQEDD 1140



>sp|P42499|PHYB_SOYBN Phytochrome B.>pir|T07756|T07756 phytochrome B -
            soybean>gb:SOYPHYB_1716075 Soybean phytochrome B (phyB)
            gene exons 1-5, complete cds.
          Length = 1156

 Score =  140 bits (353), Expect = 3e-32
 Identities = 76/164 (46%), Positives = 108/164 (65%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF LG  I AVV+Q ++  RE  +Q++ D+P E  +L ++GD LRIQQVLSDFL 
Sbjct: 990  ELEKGEFLLGNVINAVVSQVILLLRERNLQLIRDIPEEIKTLAVYGDQLRIQQVLSDFLL 1049

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
              V + P   +  V   +  R +QI   + ++H EFR+  P  G+P ELIQ+MFN  +  
Sbjct: 1050 NIVRYAPS-PDGWVEIHVRPRIKQISDGLTLLHAEFRMVCPGEGLPPELIQDMFNNSRWG 1108

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRS 552
            ++EGLGL +S+K++K+MNG VQY+REAER  F +LLE P + RS
Sbjct: 1109 TQEGLGLSMSRKILKLMNGEVQYIREAERCYFYVLLELPVTRRS 1152



>gb:AF069305_1765685 Pisum sativum phytochrome B (PHYB) mRNA, partial
            cds.
          Length = 1121

 Score =  140 bits (352), Expect = 5e-32
 Identities = 74/164 (45%), Positives = 110/164 (67%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF L   I AVV+Q M+  R+ ++Q++ D+P E  +L ++GD LRIQQVL+DFL 
Sbjct: 954  ELEKQEFLLENVINAVVSQVMLLLRDRKLQLIRDIPEEIKALAVYGDQLRIQQVLADFLM 1013

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
              V + P   +  V   +  R +QI   + ++H EFR+  P  G+P ELIQ+MF+  + +
Sbjct: 1014 NVVRYAPS-PDGWVEIHVFPRIKQISEGLTLLHAEFRMVCPGEGLPPELIQDMFHNSRWV 1072

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRS 552
            ++EGLGL +S+K+IK+MNG VQY+REAER  F++LLE P + RS
Sbjct: 1073 TQEGLGLSMSRKIIKLMNGEVQYVREAERCYFLVLLELPVTRRS 1116



>gb:TOBPHYTCRB_1725490 Tobacco phytochrome B (phyB) mRNA, 3' end.
          Length = 677

 Score =  136 bits (343), Expect = 5e-31
 Identities = 70/158 (44%), Positives = 107/158 (67%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EF LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 515 EFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 574

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
            P   +  V  ++    +QI  ++ VVH+EFRI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 575 APS-PDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPELVQDMFHSSRWVTKEGL 633

Query: 436 GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLR 549
           GL + +K++K+MNG +QY+RE+ER  F+I+L+ P + R
Sbjct: 634 GLSMCRKILKLMNGDIQYIRESERCYFLIILDLPMTRR 671



>sp|P33529|PHY_MOUSC Phytochrome.>gb:MSPHYTOCH_1687219 M.scalaris mRNA
            for phytochrome.
          Length = 1124

 Score =  136 bits (343), Expect = 5e-31
 Identities = 73/187 (39%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL +             Y E+   EFS+   + +VV+Q MI S +  +Q+ CD P +  
Sbjct: 935  KQLRRILADMDLASIEKGYLELETGEFSMATVMNSVVSQGMIQSTQKNLQLYCDTPPDFK 994

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            SL +FGD +R+QQVL+DFL  AV FTP      V  ++    +++   + V +++FR++H
Sbjct: 995  SLSVFGDQVRLQQVLADFLLNAVQFTP--PSGWVEIKVEPVVKKLPGGVSVANVDFRVSH 1052

Query: 361  PAPGIPEELIQEMFNYKQS--MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEF 534
            P  G+PE+LI +MF+   +   S+EGLGL I +KL+++MNG VQY RE ER+ F++ LE 
Sbjct: 1053 PGEGLPEDLIDQMFDRADARVKSQEGLGLSICRKLVRLMNGEVQYRREGERNFFLLQLEL 1112

Query: 535  PASLRSD 555
            P + R D
Sbjct: 1113 PLAQRDD 1119



>sp|P29130|PHYB_TOBAC Phytochrome B.>pir|T03668|T03668 phytochrome B -
            common tobacco>gb:TOBPHYB_1725489 Nicotiana tabacum type
            II phytochrome (phyB) gene, complete cds.
          Length = 1132

 Score =  136 bits (343), Expect = 5e-31
 Identities = 70/158 (44%), Positives = 107/158 (67%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 970  EFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 1029

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V  ++    +QI  ++ VVH+EFRI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 1030 APS-PDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPELVQDMFHSSRWVTKEGL 1088

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLR 549
            GL + +K++K+MNG +QY+RE+ER  F+I+L+ P + R
Sbjct: 1089 GLSMCRKILKLMNGDIQYIRESERCYFLIILDLPMTRR 1126



>sp|P06592|PHYA_CUCPE Phytochrome A.>pir|S00099|FKPUZ phytochrome -
            zucchini>gb:CUCPHT_1674295 Cucurbita pepo (zucchini)
            phytochrome mRNA, complete cds.
          Length = 1124

 Score =  136 bits (342), Expect = 7e-31
 Identities = 72/184 (39%), Positives = 114/184 (61%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +Q++K             + ++   EF+L E +   ++Q M+  +   +QI+ + P EA 
Sbjct: 940  KQISKVLDESDIDKIIDGFIDLEMDEFTLHEVLMVSISQVMLKIKGKGIQIVNETPEEAM 999

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD+LR+QQVL+DFL  +V + P   + ++   +   + Q+G  +H+VHLEFRIT+
Sbjct: 1000 SETLYGDSLRLQQVLADFLLISVSYAPSGGQLTISTDVT--KNQLGKSVHLVHLEFRITY 1057

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ EMF  ++  S EG  L IS+KL+K+MNG V+Y+REA +SSFII +E  A
Sbjct: 1058 AGGGIPESLLNEMFGSEEDASEEGFSLLISRKLVKLMNGDVRYMREAGKSSFIITVELAA 1117

Query: 541  SLRS 552
            + +S
Sbjct: 1118 AHKS 1121



>pir|T16973|T16973 phytochrome B - curled-leaved
            tobacco>gb:NPPHYGENE_1691103 Nicotiana plumbaginifolia
            phyB gene.
          Length = 1135

 Score =  135 bits (341), Expect = 9e-31
 Identities = 70/158 (44%), Positives = 107/158 (67%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 973  EFFLGSVIDAVVSQVMLLLRERSVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 1032

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V  ++    +QI  ++ VVH+EFRI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 1033 APS-PDGWVEIQLQPNMKQISDEVTVVHIEFRIVCPGEGLPPELVQDMFHSNRWVTKEGL 1091

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLR 549
            GL + +K++K+MNG +QY+RE+ER  F+I+L+ P + R
Sbjct: 1092 GLSMCRKILKLMNGEIQYIRESERCYFLIILDLPMTGR 1129



>gb:AB036763_1519047 Armoracia rusticana ArPHYA16 mRNA for phytochrome
            A, complete cds.
          Length = 1122

 Score =  133 bits (334), Expect = 6e-30
 Identities = 73/181 (40%), Positives = 110/181 (60%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL+K               ++   EFSL E + A  +Q M+ S    V+I  +   E  
Sbjct: 942  EQLSKVLDDSDLESIIEGCLDLEMKEFSLNEVLTASTSQVMMKSNGKSVRITNETGEEVM 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD++R+QQVL+DF+  +V FTP   + +V   +  R++Q+G  +H+ +LE R+TH
Sbjct: 1002 SDTLYGDSIRLQQVLADFMLMSVNFTPSGGQLTVTASL--RKDQLGRSVHLAYLEIRLTH 1059

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ +MF  ++ +S EGL L +S+KL+K+MNG VQYLR+A +SSFII  E  A
Sbjct: 1060 TGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIISAELAA 1119

Query: 541  S 543
            +
Sbjct: 1120 A 1120



>pir|S62714|S62714 phytochrome 1b - Mesotaenium
            caldariorum>gb:MCU31284_1685860 Mesotaenium caldariorum
            clone mesphy1b phytochrome gene, complete cds.
          Length = 1142

 Score =  132 bits (332), Expect = 9e-30
 Identities = 65/169 (38%), Positives = 107/169 (63%), Gaps = 2/169 (1%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y E+   EF +   + +VV+Q M+ S +  +Q+ CD P E  S+ +FGD +R+QQVL+DF
Sbjct: 971  YLELETGEFMMATVMNSVVSQGMVQSSKKGLQLFCDTPPEFKSMCVFGDQVRLQQVLADF 1030

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-- 408
            L  AV FTP      V  +++     +   + + H+EFR+TH   G+PE+L+ +MF+   
Sbjct: 1031 LMNAVQFTP--ASGWVEIKVVPNVRSLPGGITMAHMEFRVTHSGEGLPEDLVHQMFDRAD 1088

Query: 409  KQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
              S S+EGLGL + +K++++M+G V+Y+RE  +S F++LL+ P + R D
Sbjct: 1089 AHSKSQEGLGLSMCRKIVRLMSGEVRYVREPGKSYFLVLLDLPLAQRED 1137



>gb:AF544028_1810403 Stellaria longipes ecotype prairie phytochrome B
            (PHYB) mRNA, complete cds.
          Length = 1128

 Score =  132 bits (331), Expect = 1e-29
 Identities = 64/152 (42%), Positives = 103/152 (67%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I AVV+Q MIP RE ++Q++ D+P E  +L + GD +RIQQ+L++FL   V +
Sbjct: 966  EFMLGNIINAVVSQVMIPLRERELQLIRDIPEEIKTLAVCGDQIRIQQILAEFLVNMVRY 1025

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   ++ R +Q+     V ++E+R+  P  G+P +L+Q+MF+  +  ++EGL
Sbjct: 1026 APS-PDGWVEIHVLPRLKQVADGATVAYIEYRLVSPGEGLPPDLVQDMFHNSRWTTQEGL 1084

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
            GL + +K++K+MNG VQY+RE+ERS F ++LE
Sbjct: 1085 GLSMCRKILKLMNGEVQYIRESERSYFFVILE 1116



>gb:AB036764_1519048 Armoracia rusticana ArPHYA23 mRNA for phytochrome
            A, complete cds.
          Length = 1122

 Score =  131 bits (329), Expect = 2e-29
 Identities = 73/181 (40%), Positives = 109/181 (60%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQL+K               ++   EFSL E + A  +Q M+ S    V+I  +   E  
Sbjct: 942  EQLSKVLDDSDLESIIEGCLDLEMKEFSLNEVLTASTSQVMMKSNGKSVRITNETGEEVM 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD++R+QQVL+DF+  +V FTP   + +V   +  R++Q G  +H+ +LE R+TH
Sbjct: 1002 SDTLYGDSIRLQQVLADFMLMSVNFTPSGGQLTVTASL--RKDQPGRSVHLAYLEIRLTH 1059

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ +MF  ++ +S EGL L +S+KL+K+MNG VQYLR+A +SSFII  E  A
Sbjct: 1060 TGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIISAELAA 1119

Query: 541  S 543
            +
Sbjct: 1120 A 1120



>pir|A33473|FKMUA phytochrome A - Arabidopsis
            thaliana>gb:ATPHYA_1553848 Arabidopsis thaliana phyA mRNA
            for phytochrome.
          Length = 1122

 Score =  131 bits (329), Expect = 2e-29
 Identities = 72/181 (39%), Positives = 110/181 (60%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL+K               ++   EF+L E + A  +Q M+ S    V+I  +   E  
Sbjct: 942  KQLSKILDDSDLESIIEGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVM 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD++R+QQVL+DF+  AV FTP   + +V   +  R++Q+G  +H+ +LE R+TH
Sbjct: 1002 SDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASL--RKDQLGRSVHLANLEIRLTH 1059

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ +MF  ++ +S EGL L +S+KL+K+MNG VQYLR+A +SSFII  E  A
Sbjct: 1060 TGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAA 1119

Query: 541  S 543
            +
Sbjct: 1120 A 1120



>sp|P14712|PHYA_ARATH Phytochrome A.>pir|D86229|D86229 phytochrome A
            [imported] - Arabidopsis thaliana>gb:AE005172_889963
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:AC003970_1531239 Arabidopsis thaliana
            chromosome I BAC F14J9 genomic sequence contains phyA
            marker, complete sequence.>gb:ATHPHYTOA_1553301
            Arabidopsis thaliana phytochrome A (phyA) gene exons 1-5,
            complete cds.>gb:AY039520_1560235 Arabidopsis thaliana
            At1g09570/F14J9_27 mRNA, complete cds.
          Length = 1122

 Score =  131 bits (329), Expect = 2e-29
 Identities = 72/181 (39%), Positives = 110/181 (60%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL+K               ++   EF+L E + A  +Q M+ S    V+I  +   E  
Sbjct: 942  KQLSKILDDSDLESIIEGCLDLEMKEFTLNEVLTASTSQVMMKSNGKSVRITNETGEEVM 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD++R+QQVL+DF+  AV FTP   + +V   +  R++Q+G  +H+ +LE R+TH
Sbjct: 1002 SDTLYGDSIRLQQVLADFMLMAVNFTPSGGQLTVSASL--RKDQLGRSVHLANLEIRLTH 1059

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ +MF  ++ +S EGL L +S+KL+K+MNG VQYLR+A +SSFII  E  A
Sbjct: 1060 TGAGIPEFLLNQMFGTEEDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIITAELAA 1119

Query: 541  S 543
            +
Sbjct: 1120 A 1120



>gb:AB036762_1519046 Armoracia rusticana phyA mRNA for phytochrome A,
            complete cds.
          Length = 1122

 Score =  130 bits (328), Expect = 3e-29
 Identities = 72/181 (39%), Positives = 110/181 (60%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL+K               ++   EFSL E + A  +Q M+ S    V+I  +   E  
Sbjct: 942  KQLSKVLDDSDLERIIEGCLDLEMKEFSLNEVLTASTSQVMMKSNGKSVRITNETGEEVM 1001

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
            S  L+GD++R+QQVL+DF+  +V FTP   + +V   +  R++Q+G  +H+ +LE R+TH
Sbjct: 1002 SDTLYGDSIRLQQVLADFMLMSVNFTPSGGQLTVTASL--RKDQLGRSVHLAYLEIRLTH 1059

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               GIPE L+ +MF  ++ +S EGL L +S+KL+K+MNG VQYLR+A +SSFII  E  A
Sbjct: 1060 TGAGIPELLLNQMFGTEKDVSEEGLSLMVSRKLVKLMNGDVQYLRQAGKSSFIISAELAA 1119

Query: 541  S 543
            +
Sbjct: 1120 A 1120



>gb:AY741180_1626329 Arabidopsis lyrata phytochrome B (PHYB) gene,
            partial cds.
          Length = 1160

 Score =  127 bits (319), Expect = 3e-28
 Identities = 64/159 (40%), Positives = 102/159 (64%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL 
Sbjct: 982  ELKMAEFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIVVFGDQIRIQQLLAEFLL 1041

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
            + + + P  E   +    ++++   G     +  EFR+  P  G+P EL+++MF+  +  
Sbjct: 1042 SIIRYAPSQEWVEIHLSQVSKQAADG--FTAIRTEFRMACPGEGLPPELVRDMFHSSRWT 1099

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            S EGLGL + +K++K+MNG VQY+RE+ERS F I+LE P
Sbjct: 1100 SPEGLGLSVCRKILKLMNGEVQYIRESERSYFFIILELP 1138



>gb:AY741195_1626344 Arabidopsis halleri phytochrome D (PHYD) gene,
            complete cds.
          Length = 1165

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 100/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G  I AVV+Q +   RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1004 EFFIGSVINAVVSQVIFVVRERNIQLIRNIPAEIKSMAVYGDQIRLQQVLAEFLLSIVRY 1063

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             PL  E SV   +    +Q+      + LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1064 APL--EGSVELHLCPVLKQMADGFSAIRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1121

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1122 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1158



>gb:AY741194_1626343 Arabidopsis thaliana Ita-0 phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741192_1626341 Arabidopsis thaliana Aua/Rhon phytochrome D
            (PHYD) gene, complete cds.>gb:AY741193_1626342
            Arabidopsis thaliana Niederzenz phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741191_1626340 Arabidopsis thaliana Kondara phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741189_1626338 Arabidopsis thaliana Ler-0 phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741188_1626337 Arabidopsis thaliana Gre-0 phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSIAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741185_1626334 Arabidopsis thaliana Bensheim phytochrome D
            (PHYD) gene, complete cds.>gb:AY741186_1626335
            Arabidopsis thaliana Tsu-0 phytochrome D (PHYD) gene,
            complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741183_1626332 Arabidopsis thaliana No-0 phytochrome D (PHYD)
            gene, complete cds.>gb:AY741184_1626333 Arabidopsis
            thaliana RLD1 phytochrome D (PHYD) gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741182_1626331 Arabidopsis thaliana Lip-0 phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741181_1626330 Arabidopsis thaliana Br-0 phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY348569_1601424 Monotropastrum globosum phytochrome A (phyA)
            mRNA, complete cds.
          Length = 1130

 Score =  125 bits (315), Expect = 9e-28
 Identities = 68/180 (37%), Positives = 103/180 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y ++   EF+L E + A ++Q  + S    + I   L  E   
Sbjct: 946  QLTKILDDTDLDCIIDGYLDLEMVEFTLYEVLSASISQVTLKSNGKGIHIANPLQEEKMP 1005

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GDNLR+QQV++DFL+ +V FTP      ++      ++++G  + +VH+E RITH 
Sbjct: 1006 ATLYGDNLRLQQVIADFLSISVNFTP--NGGQIVASASLTKDRLGQSVQLVHVEIRITHM 1063

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PE L+ +MF      S EG+ L +S+KL+K+MNG VQYLREA +S+FII +E  A+
Sbjct: 1064 GGGVPEGLLNQMFGGDTDTSEEGISLLVSRKLVKLMNGDVQYLREAGKSTFIISVELAAA 1123



>gb:AY133697_1581517 Arabidopsis thaliana clone C103212 putative
           phytochrome D (At4g16250) mRNA, complete cds.
          Length = 496

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 335 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 394

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
            P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 395 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 452

Query: 436 GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
           GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 453 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 489



>gb:ATPHYD_1553854 A.thaliana phyD gene.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>sp|P42497|PHYD_ARATH Phytochrome D.>pir|B71429|B71429 phytochrome D -
            Arabidopsis thaliana>gb:ATCHRIV43_1545427 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            43.>gb:ATFCA5_1551675 Arabidopsis thaliana DNA chromosome
            4, ESSA I FCA contig fragment No. 5.
          Length = 1164

 Score =  125 bits (315), Expect = 9e-28
 Identities = 64/157 (40%), Positives = 99/157 (63%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTSPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741179_1626328 Arabidopsis thaliana Kondara phytochrome B (PHYB)
            gene, complete cds.
          Length = 1168

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 995  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1054

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1055 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1112

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1113 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1146



>gb:AY741178_1626327 Arabidopsis thaliana RLD1 phytochrome B (PHYB)
            gene, partial cds.
          Length = 1158

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 992  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1051

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1052 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1109

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1110 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1143



>gb:AY741177_1626326 Arabidopsis thaliana Wassilewskija phytochrome B
            (PHYB) gene, partial cds.
          Length = 1161

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 994  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1053

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1054 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1111

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1112 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1145



>gb:AY741176_1626325 Arabidopsis thaliana Kin-0 phytochrome B (PHYB)
            gene, partial cds.
          Length = 1158

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 992  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1051

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1052 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1109

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1110 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1143



>gb:AY741169_1626318 Arabidopsis thaliana Tsu-0 phytochrome B (PHYB)
            gene, complete cds.>gb:AY741170_1626319 Arabidopsis
            thaliana Aua/Rhon phytochrome B (PHYB) gene, complete
            cds.>gb:AY741171_1626320 Arabidopsis thaliana Mh-0
            phytochrome B (PHYB) gene, complete
            cds.>gb:AY741172_1626321 Arabidopsis thaliana Bensheim
            phytochrome B (PHYB) gene, complete
            cds.>gb:AY741173_1626322 Arabidopsis thaliana Br-0
            phytochrome B (PHYB) gene, complete
            cds.>gb:AY741174_1626323 Arabidopsis thaliana Niederzenz
            phytochrome B (PHYB) gene, complete cds.
          Length = 1168

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 995  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1054

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1055 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1112

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1113 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1146



>gb:AY741167_1626316 Arabidopsis thaliana Ler-0 phytochrome B (PHYB)
            gene, complete cds.>gb:AY741168_1626317 Arabidopsis
            thaliana Lip-0 phytochrome B (PHYB) gene, complete cds.
          Length = 1168

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 995  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1054

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   +    +Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1055 AP--SQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1112

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1113 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1146



>gb:AY741166_1626315 Arabidopsis thaliana Dijon-G phytochrome B (PHYB)
            gene, partial cds.
          Length = 1162

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 996  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1055

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   +    +Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1056 AP--SQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1113

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1114 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1147



>gb:AY741165_1626314 Arabidopsis thaliana No-0 phytochrome B (PHYB)
            gene, partial cds.
          Length = 1158

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 992  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1051

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   +    +Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1052 AP--SQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1109

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1110 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1143



>gb:AY741164_1626313 Arabidopsis thaliana Cvi-0 (Cape Verde Islands)
            phytochrome B (PHYB) gene, partial cds.
          Length = 1162

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 996  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1055

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   +    +Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1056 AP--SQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1113

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1114 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1147



>gb:AY466496_1608086 Arabidopsis thaliana phytochrome B (PHYB) gene,
            complete cds.
          Length = 1168

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 995  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1054

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++  Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1055 APSQEWVEIHLSQVSK--QMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1112

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1113 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1146



>sp|P34094|PHYB_SOLTU Phytochrome B.>gb:STPHYB_1722851 Solanum
            tuberosum phyB gene.
          Length = 1130

 Score =  125 bits (314), Expect = 1e-27
 Identities = 66/154 (42%), Positives = 101/154 (65%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            +F LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 968  DFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 1027

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V  ++      I   + VVH+E RI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 1028 APS-PDGWVEIQLRPSMMPISDGVTVVHIELRIICPGEGLPPELVQDMFHSSRWVTQEGL 1086

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG +QY+RE+ER  F+I+L+ P
Sbjct: 1087 GLSMCRKMLKLMNGEIQYIRESERCYFLIILDLP 1120



>sp|P14713|PHYB_ARATH Phytochrome B.>pir|B33473|FKMUB phytochrome B -
            Arabidopsis thaliana>gb:AC005724_1532957 Arabidopsis
            thaliana chromosome 2 clone MSF3 map CIC06E08, complete
            sequence.>gb:ATPHYB_1553849 Arabidopsis thaliana phyB
            mRNA for phytochrome.
          Length = 1172

 Score =  125 bits (314), Expect = 1e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 999  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1058

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V   +    +Q+      +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1059 AP--SQEWVEIHLSQLSKQMADGFAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1116

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1117 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1150



>gb:LEAJ2284_1684215 Lycopersicon esculentum mRNA for phytochrome
           B1, alternative transcript type #3.
          Length = 493

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/154 (42%), Positives = 100/154 (64%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           +F LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 331 DFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 390

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
            P   +  V  ++      I     VVH+E RI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 391 APS-PDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPELVQDMFHSSRWVTQEGL 449

Query: 436 GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
           GL + +K++K+MNG +QY+RE+ER  F+I+L+ P
Sbjct: 450 GLSMCRKMLKLMNGEIQYIRESERCYFMIILDLP 483



>gb:LEAJ2282_1684213 Lycopersicon esculentum mRNA for phytochrome
           B1, alternative transcript type #1.
          Length = 462

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/154 (42%), Positives = 100/154 (64%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           +F LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 300 DFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 359

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
            P   +  V  ++      I     VVH+E RI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 360 APS-PDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPELVQDMFHSSRWVTQEGL 418

Query: 436 GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
           GL + +K++K+MNG +QY+RE+ER  F+I+L+ P
Sbjct: 419 GLSMCRKMLKLMNGEIQYIRESERCYFMIILDLP 452



>gb:LEAJ2281_1684212 Lycopersicon esculentum PHYB1 gene, complete CDS.
          Length = 1131

 Score =  124 bits (311), Expect = 3e-27
 Identities = 66/154 (42%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            +F LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 969  DFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 1028

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P   +  V  ++      I     VVH+E RI  P  G+P EL+Q+MF+  + +++EGL
Sbjct: 1029 APS-PDGWVEIQLRPSMMPISDGATVVHIELRIICPGEGLPPELVQDMFHSSRWVTQEGL 1087

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG +QY+RE+ER  F+I+L+ P
Sbjct: 1088 GLSMCRKMLKLMNGEIQYIRESERCYFMIILDLP 1121



>gb:AY741190_1626339 Arabidopsis thaliana Dijon-G phytochrome D (PHYD)
            gene, complete cds.
          Length = 1164

 Score =  124 bits (311), Expect = 3e-27
 Identities = 63/157 (40%), Positives = 98/157 (62%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +    EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWTXPEGL 1120

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            GL + +K++K+MNG VQY+RE ERS F+I++E P  L
Sbjct: 1121 GLSVCRKILKLMNGGVQYIREFERSYFLIVIELPVPL 1157



>gb:AY741175_1626324 Arabidopsis thaliana Ita-0 phytochrome B (PHYB)
            gene, complete cds.
          Length = 1168

 Score =  124 bits (310), Expect = 3e-27
 Identities = 63/154 (40%), Positives = 100/154 (64%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF LG  I A+V+QAM   R+  +Q++ D+P E  S+ +FGD +RIQQ+L++FL + + +
Sbjct: 995  EFFLGSVINAIVSQAMFLLRDRGLQLIRDIPEEIKSIEVFGDQIRIQQLLAEFLLSIIRY 1054

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   +    +++    G     +  EFR+  P  G+P EL+++MF+  +  S EGL
Sbjct: 1055 APSQEWVEIHLSQVSKLMADG--FAAIRTEFRMACPGEGLPPELVRDMFHSSRWTSPEGL 1112

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL + +K++K+MNG VQY+RE+ERS F+I+LE P
Sbjct: 1113 GLSVCRKILKLMNGEVQYIRESERSYFLIILELP 1146



>gb:AF122901_1769855 Lycopersicon esculentum phytochrome B2 (PHYB2)
            gene, complete cds.
          Length = 1121

 Score =  123 bits (309), Expect = 4e-27
 Identities = 66/159 (41%), Positives = 102/159 (64%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF L   I AVV+Q M+  RE  VQ++ D+P E  +L ++GD +RIQQV +DFL 
Sbjct: 960  ELEKGEFFLASVIDAVVSQVMLLLRERGVQLIRDIPDEIKTLRVYGDQVRIQQVFADFLQ 1019

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
                + P   E  V   +    +QI   + +VH+EFRI  P  G+P ELIQ+MF+    +
Sbjct: 1020 IMASYAPP-REGWVEVHLRPSIKQISDGVTIVHIEFRIVCPGEGLPPELIQDMFHNSLWV 1078

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            +++GLGL + ++++++MNG VQY+RE+ER  F+I+L+ P
Sbjct: 1079 TQQGLGLSMCRRILQLMNGQVQYIRESERCFFLIILQLP 1117



>gb:AY348567_1601422 Cuscuta pentagona phytochrome A (phyA) mRNA,
            complete cds.
          Length = 1119

 Score =  123 bits (308), Expect = 6e-27
 Identities = 66/183 (36%), Positives = 105/183 (57%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL+K             Y ++   EF L E + A ++Q M  S    ++++ D+     
Sbjct: 936  QQLSKVLDDTDLDCIIEGYLDLEMVEFKLDEVLLASISQVMTKSNGKSLRVINDVAENVL 995

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
               L+GD+LR+QQVL++FL+ AV FTP   + +V   +   ++ +G  + + HLEFR+TH
Sbjct: 996  CETLYGDSLRLQQVLAEFLSVAVNFTPSGGQLAVSSSLT--KDHLGQSVQLAHLEFRVTH 1053

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               G+PEEL+ +MF        EG+ L +S+ L+K+MNG VQY REA RS+FII +E   
Sbjct: 1054 SGGGVPEELLTQMFGSDVDALEEGISLLVSRNLVKLMNGDVQYHREAGRSAFIISVELAV 1113

Query: 541  SLR 549
            + +
Sbjct: 1114 ATK 1116



>gb:AY345120_1600978 Cyrtosia septentrionalis phytochrome A (phyA)
            mRNA, complete cds.
          Length = 1118

 Score =  122 bits (307), Expect = 8e-27
 Identities = 63/157 (40%), Positives = 98/157 (62%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            EMN  EF+L + +   V+Q M+PS    V ++ DLP    S Y++GD+LR+QQ+ +DFL 
Sbjct: 951  EMN--EFNLKDVVLTAVSQVMLPSEGKGVNVVYDLPDGLLSEYVYGDSLRLQQIXADFLL 1008

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
              V ++P  + + V      ++  +G  + ++H+E RITH   G+ EEL+ EMF  K+  
Sbjct: 1009 VCVKYSP--DGAQVEITANLKKNTLGKSLQLIHVEIRITHAGNGVAEELLSEMFGSKEET 1066

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
            S EG+ L + +KL+++MNG V YLREA +S FI+  E
Sbjct: 1067 SEEGMSLMVCRKLLRLMNGDVCYLREANKSVFILSAE 1103



>pir|S20497|S20497 phytochrome A - potato
          Length = 1123

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/183 (37%), Positives = 106/183 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y ++   EF L E + A ++Q M+ S    + I  D+  +  +
Sbjct: 942  QLDKILDDTDLDSIIEGYLDLEMLEFKLHEVLVASISQVMMKSNGKNIMISNDMVEDLLN 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+ R+QQVL++FL  +V  TP   + S+  ++   +++IG  + +  LEFRI H 
Sbjct: 1002 ETLYGDSPRLQQVLANFLLVSVNSTPSGGKLSISQKLT--KDRIGESVQLALLEFRIRHT 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ +MF  +   S EG+ L +S+KL+K+MNG VQYLREA RS+FII +E   +
Sbjct: 1060 GGGVPEELLSQMFGSEADASEEGISLLVSRKLVKLMNGEVQYLREAGRSTFIISVELAVA 1119

Query: 544  LRS 552
             +S
Sbjct: 1120 TKS 1122



>sp|P30733|PHYA_SOLTU Phytochrome A.>gb:S84872_1704643 Solanum
            tuberosum type A phytochrome (c-phyA) mRNA, complete cds.
          Length = 1123

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/183 (37%), Positives = 106/183 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y ++   EF L E + A ++Q M+ S    + I  D+  +  +
Sbjct: 942  QLDKILDDTDLDSIIEGYLDLEMLEFKLHEVLVASISQVMMKSNGKNIMISNDMVEDLLN 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+ R+QQVL++FL  +V  TP   + S+  ++   +++IG  + +  LEFRI H 
Sbjct: 1002 ETLYGDSPRLQQVLANFLLVSVNSTPSGGKLSISGKLT--KDRIGESVQLALLEFRIRHT 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ +MF  +   S EG+ L +S+KL+K+MNG VQYLREA RS+FII +E   +
Sbjct: 1060 GGGVPEELLSQMFGSEADASEEGISLLVSRKLVKLMNGEVQYLREAGRSTFIISVELAVA 1119

Query: 544  LRS 552
             +S
Sbjct: 1120 TKS 1122



>sp|P55141|PHYA_PETCR Phytochrome A.>pir|S52631|S52631 phytochrome A -
            parsley>gb:PCPHYA_1699326 P.crispum phyA mRNA for
            phytochrome A.
          Length = 1129

 Score =  121 bits (303), Expect = 2e-26
 Identities = 63/167 (37%), Positives = 99/167 (59%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y ++   EF L +   A  +Q  + S    +Q++ +   E  S  L+GD+LR+Q+VL+DF
Sbjct: 964  YLDLEMSEFRLHDVYVASRSQVSMRSNGKAIQVVDNFSEEMMSETLYGDSLRLQKVLADF 1023

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            ++  V  TP+     +   +    + +G  + +VHLEFRITH   G+PEE + +MF    
Sbjct: 1024 MSVCVNLTPVGGHLGI--SVTLTEDNLGQSVQLVHLEFRITHTGAGVPEEAVSQMFGSDS 1081

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
              S EG+ L IS+KL+K+MNG V YLREA +S+FII +E  A+ + +
Sbjct: 1082 ETSEEGISLLISRKLVKLMNGDVHYLREAGKSTFIITVELAAASKRE 1128



>gb:AF309806_1785029 Populus balsamifera subsp. trichocarpa
            phytochrome B1 (phyB1) gene, complete cds.
          Length = 1151

 Score =  120 bits (302), Expect = 3e-26
 Identities = 65/161 (40%), Positives = 102/161 (63%), Gaps = 2/161 (1%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF  G  I AVV+QAM+  RE  +Q++ D+P E  +L ++GD  RIQQVL+DFL 
Sbjct: 968  ELEKAEFLFGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLVVYGDQARIQQVLADFLL 1027

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFR--ITHPAPGIPEELIQEMFNYKQ 414
              V + P      V   +    +QI     +VH+EF+  + +    +P EL+Q+MF+  +
Sbjct: 1028 NMVRYAPS-SAGWVEIHVCPTLKQISDGHTLVHMEFKYALLNSFACLPPELVQDMFHSSR 1086

Query: 415  SMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
             +++EGLGL + +K++K+MNG VQY+RE+ER  F+++LE P
Sbjct: 1087 WVTQEGLGLSMCRKILKLMNGEVQYIRESERCYFLVILEVP 1127



>gb:LEAJ1913_1684208 Lycopersicon esculentum phyA gene (exons 1 to 4
            and joined CDS).>gb:LEAJ1914_1684209 Lycopersicon
            esculentum mRNA for phytochrome A, type
            1.>gb:LEAJ1915_1684210 Lycopersicon esculentum mRNA for
            phytochrome A, type 2.>gb:LEAJ1916_1684211 Lycopersicon
            esculentum mRNA for phytochrome A type 3.
          Length = 1123

 Score =  120 bits (300), Expect = 5e-26
 Identities = 68/183 (37%), Positives = 105/183 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y ++   EF L E + A ++Q M+ S    + I  D+  +  +
Sbjct: 942  QLNKILDDTDLDSIIDGYLDLEMLEFKLHEVLVASISQVMMKSNGKNIMISNDMVEDLLN 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+ R+QQVL++FL  +V  TP   + S+  R+   +++IG  + +  LEFRI H 
Sbjct: 1002 ETLYGDSPRLQQVLANFLLVSVNATPSGGQLSISGRLT--KDRIGESVQLALLEFRIRHT 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ +MF  +   S EG+ L +S+KL+K+MNG VQYLREA +S+FII +E   +
Sbjct: 1060 GGGVPEELLGQMFGSEADASEEGISLLVSRKLVKLMNGEVQYLREAGQSTFIISVELAVA 1119

Query: 544  LRS 552
              S
Sbjct: 1120 TNS 1122



>sp|P15001|PHYA_PEA Phytochrome A.>pir|S06856|S06856 phytochrome -
            garden pea>gb:AY688953_1622386 Pisum sativum phytochrome
            A apoprotein (PHYA) gene, complete
            cds.>gb:PEAPHTAP_1699726 Pisum sativum phytochrome (phy)
            gene, complete cds.>gb:PSPHY_1702344 Pea phy gene for
            phytochrome apoprotein.
          Length = 1124

 Score =  119 bits (298), Expect = 8e-26
 Identities = 66/180 (36%), Positives = 103/180 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL+K             Y ++   EF+L E +   ++Q M  S    ++I  D+    + 
Sbjct: 942  QLSKILDDSDLDGIIDGYLDLEMAEFTLHEVLVTSLSQVMNRSNTKGIRIANDVAEHIAR 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+LR+QQVL+DFL  ++  TP      V+      +EQ+G  +H+V+LE  ITH 
Sbjct: 1002 ETLYGDSLRLQQVLADFLLISINSTP--NGGQVVIAASLTKEQLGKSVHLVNLELSITHG 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PE  + +MF      S EG+ L+IS+KL+K+MNG V+YL+EA +SSFI+ +E  A+
Sbjct: 1060 GSGVPEAALNQMFGNNVLESEEGISLHISRKLLKLMNGDVRYLKEAGKSSFILSVELAAA 1119



>sp|P93673|PHYA_LATSA Phytochrome type A.>gb:LSU84970_1685402 Lathyrus
            sativus phytochrome type A (phyA) gene, complete cds.
          Length = 1124

 Score =  119 bits (298), Expect = 8e-26
 Identities = 66/180 (36%), Positives = 103/180 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL+K             Y ++   EF+L E +   ++Q M  S    ++I  D+    + 
Sbjct: 942  QLSKILDDSDLDGIIDGYLDLEMAEFTLHEVLVTSLSQVMNRSNTKGIRIANDVAEHIAK 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+LR+QQVL+DFL  ++  TP      V+      +EQ+G  +H+V+LE  ITH 
Sbjct: 1002 ESLYGDSLRLQQVLADFLLISINSTP--NGGQVVIASSLTKEQLGKSVHLVNLELSITHG 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PE  + +MF      S EG+ L+IS+KL+K+MNG V+YL+EA +SSFI+ +E  A+
Sbjct: 1060 GSGVPEAALNQMFGNNVLESEEGISLHISRKLLKLMNGDVRYLKEAGKSSFILSVELAAA 1119



>sp|P33530|PHY1_TOBAC Phytochrome A1.>gb:NTPHYA1_1691684 N.tabacum
            Nt-PHYA-1 gene for type-A Phytochrome.
          Length = 1124

 Score =  119 bits (298), Expect = 8e-26
 Identities = 68/183 (37%), Positives = 105/183 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y ++   EF L E + A ++Q M+ S    + I+ D+  +  +
Sbjct: 942  QLNKILDDTDLDSIIDGYLDLEMLEFKLHEVLVASISQIMMKSNGKNIMIVNDMVEDLLN 1001

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+ R+QQVL++FL   V  TP   + S+   +   +++IG  + +  LE RI+H 
Sbjct: 1002 ETLYGDSPRLQQVLANFLLVCVNSTPSGGQLSISGTLT--KDRIGESVQLALLEVRISHT 1059

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
              G+PEEL+ +MF  +   S EG+ L IS+KL+K+MNG VQYLREA RS+FII +E   +
Sbjct: 1060 GGGVPEELLSQMFGTEAEASEEGISLLISRKLVKLMNGEVQYLREAGRSTFIISVELAVA 1119

Query: 544  LRS 552
             +S
Sbjct: 1120 TKS 1122



>gb:AY190013_1588464 Stellaria longipes PHYA2 photoreceptor (PHYA2)
            mRNA, complete cds.
          Length = 935

 Score =  119 bits (297), Expect = 1e-25
 Identities = 67/176 (38%), Positives = 102/176 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E+   EF++ + + A ++Q M  S E  +Q+  +       
Sbjct: 754  QLNKILDDSDLDSIIDGYCELEMVEFAVQDILVASISQVMAKSSEKGIQMSNNCTEHGFK 813

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+LR+QQ+L+DFL+ +V FT       V  R+   +++IG  + + +LEFRITH 
Sbjct: 814  ETLYGDSLRLQQILADFLSISVNFTSPGGHIGVTVRLT--KDKIGESVQLANLEFRITHT 871

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
              GI EEL+ EMF  + + S +G+ L IS+KL+K+MNG +QYLR A  S+FII +E
Sbjct: 872  GGGISEELLSEMFESRGNASEDGISLLISRKLVKLMNGDIQYLRSAGTSTFIISVE 927



>sp|P42496|PHY_ADICA Phytochrome 1.>gb:AB016151_1512763 Adiantum
            capillus-veneris PHY1 gene for phytochrome 1, complete
            cds.>gb:AB016168_1512765 Adiantum capillus-veneris PHY1
            mRNA for phytochrome 1, complete cds.
          Length = 1118

 Score =  119 bits (297), Expect = 1e-25
 Identities = 62/170 (36%), Positives = 97/170 (57%), Gaps = 3/170 (1%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y ++   EF +G  I AV++Q M  SR   VQI+ ++P +   + LFGD  R+QQVL+D 
Sbjct: 944  YMDLEMSEFFMGSVIDAVISQGMAASRGKGVQILTEIPNDVKLMCLFGDQARLQQVLADL 1003

Query: 235  LTTAVLFTPLFEESS---VLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN 405
            L  A+       E     V  ++   + ++   +H++H EFRI+H   GI E L++EM N
Sbjct: 1004 LFCAINHATTTNEDEKDWVTIKVSRTKTRLDDGVHLMHFEFRISHSGQGISEALVEEMTN 1063

Query: 406  YKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSD 555
              Q  + EGL + IS  LI++MNG V+Y  +A    F++ ++FP + R D
Sbjct: 1064 KSQKWTPEGLAISISCTLIRLMNGDVKYTTDAGNKCFLVTIQFPLAHRDD 1113



>sp|P25764|PHYB_ORYSA Phytochrome B.>pir|S14065|S14065 phytochrome B -
            rice>gb:OSPHYB1GE_1698301 O.sativa DNA for phyB1 gene.
          Length = 1171

 Score =  118 bits (296), Expect = 1e-25
 Identities = 65/154 (42%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFSLG  + AVV+Q MI  RE  +Q++ D+P E      +GD  RIQQVL DFL + V F
Sbjct: 1008 EFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQVLCDFLLSMVRF 1067

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q       +   FR   P  G+P E++Q+MF+  +  ++EG+
Sbjct: 1068 APA-ENGWVEIQVRPNIKQNSDGTDTMLFPFRFACPGEGLPPEIVQDMFSNSRWTTQEGI 1126

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL I +K++K+M G VQY+RE+ERS F I+LE P
Sbjct: 1127 GLSICRKILKLMGGEVQYIRESERSFFHIVLELP 1160



>sp|P42500|PHYA_SOYBN Phytochrome A.>pir|T07137|T07137 phytochrome A -
            soybean>gb:SOYCPPHYAA_1715991 Soybean chloroplast
            phytochrome A (phyA) gene, complete
            cds.>gb:SOYPHYA_1716074 Soybean phytochrome A (phyA)
            mRNA, complete cds.
          Length = 1131

 Score =  118 bits (296), Expect = 1e-25
 Identities = 67/181 (37%), Positives = 101/181 (55%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            +QL+K             Y ++   EF+L E +   ++Q M  S    ++I+ D+     
Sbjct: 948  QQLSKILDDSDLDTIIDGYLDLEMAEFTLHEVLVTSLSQVMEKSNGKSIRIVNDVAGHIM 1007

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
               L+GD+LR+QQVL+DFL  ++ FTP      V+      +EQ+G  +H+V LE  ITH
Sbjct: 1008 METLYGDSLRLQQVLADFLLISINFTP--NGGQVVVAGSLTKEQLGKSVHLVKLELSITH 1065

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
               G+PE L+ +MF      S EG+ L I  KL+K+MNG V+YLREA +S+FI+  E  A
Sbjct: 1066 GGSGVPEVLLNQMFGNNGLESEEGISLLIRAKLLKLMNGDVRYLREAGKSAFILSAELAA 1125

Query: 541  S 543
            +
Sbjct: 1126 A 1126



>gb:AB109892_1526863 Oryza sativa (japonica cultivar-group) PHYB mRNA
            for phytochrome B, complete cds.>gb:AB183525_1529300
            Oryza sativa (japonica cultivar-group) PhyB gene for
            phytochrome B, complete cds.
          Length = 1171

 Score =  117 bits (294), Expect = 2e-25
 Identities = 65/154 (42%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFSLG  + AVV+Q MI  RE  +Q++ D+P E      +GD  RIQQVL DFL + V F
Sbjct: 1008 EFSLGSVMNAVVSQVMIQLRERDLQLIRDIPDEIKEASAYGDQYRIQQVLCDFLLSMVRF 1067

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q       +   FR   P  G+P E++Q+MF+  +  ++EG+
Sbjct: 1068 APA-ENGWVEIQVRPNIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMFSNSRWTTQEGI 1126

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL I +K++K+M G VQY+RE+ERS F I+LE P
Sbjct: 1127 GLSICRKILKLMGGEVQYIRESERSFFHIVLELP 1160



>pir|T14802|T14802 phytochrome B - sorghum (fragment)
          Length = 1039

 Score =  117 bits (294), Expect = 2e-25
 Identities = 66/179 (36%), Positives = 101/179 (56%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQ++K                +   EFS G+ + AVV+QAM+  RE  +Q++ D+P E  
Sbjct: 851  EQMSKIVKDATLQSIEDGSLVLEKSEFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIK 910

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
                +GD  RIQQVL+DFL + V   P  E   V  ++    +Q           FR T+
Sbjct: 911  DASAYGDQFRIQQVLADFLLSMVRSAPS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFTY 969

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            P  G+P +++Q+MF+  Q  ++EG+GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 970  PGEGLPADIVQDMFSNSQWSTQEGVGLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1028



>sp|P93527|PHYB_SORBI Phytochrome B.>gb:AF182394_1774964 Sorghum
            bicolor phytochrome B (PHYB) gene, complete cds.
          Length = 1178

 Score =  117 bits (294), Expect = 2e-25
 Identities = 66/179 (36%), Positives = 101/179 (56%)
 Frame = +1

Query: 1    EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
            EQ++K                +   EFS G+ + AVV+QAM+  RE  +Q++ D+P E  
Sbjct: 990  EQMSKIVKDATLQSIEDGSLVLEKSEFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIK 1049

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
                +GD  RIQQVL+DFL + V   P  E   V  ++    +Q           FR T+
Sbjct: 1050 DASAYGDQFRIQQVLADFLLSMVRSAPS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFTY 1108

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            P  G+P +++Q+MF+  Q  ++EG+GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1109 PGEGLPADIVQDMFSNSQWSTQEGVGLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1167



>gb:AF544027_1810402 Stellaria longipes ecotype prairie phytochrome A1
            (PHYA1) mRNA, complete cds.
          Length = 1122

 Score =  116 bits (291), Expect = 5e-25
 Identities = 66/176 (37%), Positives = 101/176 (57%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E+   EF++ + + A ++Q M  S E  +Q+  +       
Sbjct: 941  QLNKILDDSDLDSIIDGYCELEMVEFAVQDILVASISQVMAKSSEKGIQMSNNCTEHGFK 1000

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+LR+QQ+L+DFL+ +V FT       V  R+   +++IG  + + +LEFRI H 
Sbjct: 1001 ETLYGDSLRLQQILADFLSISVNFTSPGGHIGVTVRLT--KDKIGESVQLANLEFRIMHT 1058

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
              GI EEL+ EMF  + + S +G+ L IS+KL+K+MNG +QYLR A  S+FII +E
Sbjct: 1059 GGGISEELLSEMFESRGNASEDGISLLISRKLVKLMNGDIQYLRSAGTSTFIISVE 1114



>gb:AY190014_1588465 Stellaria longipes PHYA3 photoreceptor (PHYA3)
            mRNA, complete cds.
          Length = 1123

 Score =  115 bits (288), Expect = 1e-24
 Identities = 68/177 (38%), Positives = 100/177 (56%), Gaps = 1/177 (0%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS- 180
            QL K             Y E+   EF++ + + A   Q M  S E  +QI  D   E   
Sbjct: 941  QLNKILDDSDLDSIIDGYCELEMVEFTVQDILVASTCQVMAKSNEKGIQIANDSTTEHGL 1000

Query: 181  SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITH 360
               L+GD+LR+QQ+L+DFL  +V FTP      +  R+   +++IG  +   +LEFRI+H
Sbjct: 1001 KETLYGDSLRLQQILADFLWISVNFTPAGGNVGIKVRLT--KDKIGESIQHANLEFRISH 1058

Query: 361  PAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
               GI EEL+ +MF  +  +S EG+ L +S+K++K+MNG VQYLR A  S+FII +E
Sbjct: 1059 TGGGISEELLSQMFENQGEVSEEGISLLVSRKIVKLMNGDVQYLRSAGSSTFIISVE 1115



>gb:TAE313099_1724320 Triticum aestivum phya1 gene for phytochrome A,
            exons 1-4.
          Length = 1130

 Score =  115 bits (287), Expect = 2e-24
 Identities = 61/158 (38%), Positives = 97/158 (61%), Gaps = 1/158 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L + + A V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL+
Sbjct: 965  DLEMAEFVLQDVVVAAVSQVLIACQGKGIRVSCNLPERFMKQLVYGDGVRLQQILSDFLS 1024

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ-S 417
             +V F+P+   SSV     A +  IG  +H++ LE RI H   G+P EL+ +MF   +  
Sbjct: 1025 ISVKFSPV--GSSVEISAKATKNSIGENLHLIDLELRIKHQGLGVPAELMAQMFEEDEPQ 1082

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
             S EGLGL +S+ L+++MNG V++LREA  S FI+  E
Sbjct: 1083 QSEEGLGLLVSRNLLRLMNGDVRHLREAGVSIFILTAE 1120



>gb:AY190015_1588466 Stellaria longipes PHYA4 photoreceptor (PHYA4)
            mRNA, complete cds.
          Length = 1122

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/176 (36%), Positives = 100/176 (56%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL K             Y E+   EF++ + + A ++Q M  S E  +Q+  +       
Sbjct: 941  QLNKILDDSDLDSIIDGYCELEMVEFTVQDILVASISQVMAKSSEKGIQMSNNCTEHGFK 1000

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP 363
              L+GD+LR+QQ+L+DFL+ +V FT       V  R+   +++IG  + + +LEFRI H 
Sbjct: 1001 ETLYGDSLRLQQILADFLSISVNFTSPGGHIGVTVRLT--KDKIGESVQLANLEFRIMHT 1058

Query: 364  APGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
              GI EEL+ EMF  + + S +G+ L IS+KL+K+MNG +QYLR A   +FII +E
Sbjct: 1059 GGGISEELLSEMFESRGNASEDGISLLISRKLVKLMNGDIQYLRSAGTCTFIIYVE 1114



>pir|S28431|S28431 phytochrome B - potato
          Length = 1129

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/155 (41%), Positives = 101/155 (65%), Gaps = 1/155 (0%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            +F LG  I AVV+Q M+  RE  VQ++ D+P E  +L + GD +RIQQVL+DFL   V +
Sbjct: 968  DFFLGSVIDAVVSQVMLLLREKGVQLIRDIPEEIKTLTVHGDQVRIQQVLADFLLNMVRY 1027

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPG-IPEELIQEMFNYKQSMSREG 432
             P   +  V  ++      I   + VVH+E  +   APG +P EL+Q+MF+  + +++EG
Sbjct: 1028 APS-PDGWVEIQLRPSMMPISDGVTVVHIELGLY--APGRLPPELVQDMFHSSRWVTQEG 1084

Query: 433  LGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            LGL + +K++K+MNG +QY+RE+ER  F+I+L+ P
Sbjct: 1085 LGLSMCRKMLKLMNGEIQYIRESERCYFLIILDLP 1119



>gb:AY234827_1591777 Zea mays cultivar B73 phytochrome B1 apoprotein
            (phyB1) gene, complete cds; and Ty3/gypsy-like
            retrotransposon, complete sequence.
          Length = 1161

 Score =  114 bits (284), Expect = 3e-24
 Identities = 63/154 (40%), Positives = 95/154 (61%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFSLG+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 998  EFSLGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQCRIQQVLADFLLSMVRS 1057

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q     +     FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1058 APS-ENGWVEIQVRPNVKQNSDGTNTELFIFRFACPGEGLPADVVQDMFSNSQWSTQEGV 1116

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1117 GLSTCRKILKLMGGEVQYIRESERSFFLIVLEQP 1150



>gb:AY466100_1608004 Sorghum propinquum phytochrome B (PHYB) gene,
            complete cds.
          Length = 1177

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1014 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1073

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1074 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1132

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1133 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1166



>gb:AY466099_1608003 Sorghum x drummondii voucher PI302233 phytochrome
            B (PHYB) gene, complete cds.
          Length = 1177

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1014 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1073

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1074 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1132

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1133 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1166



>gb:AY466098_1608002 Sorghum arundinaceum voucher PI302233 phytochrome
            B (PHYB) gene, complete cds.
          Length = 1178

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1015 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1074

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1075 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1133

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1134 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1167



>gb:AY466089_1607993 Sorghum bicolor isolate PHYB-Rtx430 phytochrome B
            (PHYB) gene, complete cds.>gb:AY466090_1607994 Sorghum
            bicolor phytochrome B (PHYB) gene, complete cds.
          Length = 1178

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1015 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1074

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1075 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1133

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1134 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1167



>gb:AY466087_1607991 Sorghum bicolor voucher PI152593 phytochrome B
            (PHYB) gene, complete cds.
          Length = 1178

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1015 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1074

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1075 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1133

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1134 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1167



>gb:AY466084_1607988 Sorghum bicolor voucher PI267380 phytochrome B
            (PHYB) gene, complete cds.>gb:AY466085_1607989 Sorghum
            bicolor voucher PI153800 phytochrome B (PHYB) gene,
            complete cds.>gb:AY466086_1607990 Sorghum bicolor voucher
            PI229835 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466088_1607992 Sorghum bicolor voucher NSL83707
            phytochrome B (PHYB) gene, complete
            cds.>gb:AY466091_1607995 Sorghum arundinaceum voucher
            IS14569 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466092_1607996 Sorghum arundinaceum voucher
            PI213900 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466093_1607997 Sorghum arundinaceum voucher
            IS14503 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466094_1607998 Sorghum arundinaceum voucher
            IS14567 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466095_1607999 Sorghum arundinaceum voucher
            PI302105 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466096_1608000 Sorghum arundinaceum voucher
            IS14485 phytochrome B (PHYB) gene, complete
            cds.>gb:AY466097_1608001 Sorghum arundinaceum voucher
            PI225905 phytochrome B (PHYB) gene, complete cds.
          Length = 1178

 Score =  113 bits (283), Expect = 5e-24
 Identities = 62/154 (40%), Positives = 93/154 (60%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFS G+ + AVV+QAM+  RE  +Q++ D+P E      +GD  RIQQVL+DFL + V  
Sbjct: 1015 EFSFGDVMNAVVSQAMLLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMVRS 1074

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1075 APS-ENGWVEIQVRPNVKQNSDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1133

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1134 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1167



>pir|S00097|S00097 phytochrome 4 - oat>gb:ASAP4R_1542111 Avena sativa
            mRNA for phytochrome (AP4).
          Length = 1129

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/162 (37%), Positives = 98/162 (60%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF   + + A V+Q +I  +   ++I C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 964  DLEMAEFVFQDVVVAAVSQVLITCQGKGIRISCNLPERFMKQSVYGDGVRLQQILSDFLF 1023

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P EL+++MF    + 
Sbjct: 1024 ISVKFSPV--GGSVEISSKLTKNSIGENLHLIDLELRIKHQGLGVPAELMEQMFEEDNKE 1081

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGLGL +S+KL+++MNG V++LREA  S+FI+  E  ++
Sbjct: 1082 QSDEGLGLLVSRKLLRLMNGDVRHLREAGVSTFILTAELASA 1123



>sp|P06594|PHY4_AVESA Phytochrome A type 4 (AP4).
          Length = 1128

 Score =  112 bits (280), Expect = 1e-23
 Identities = 60/162 (37%), Positives = 98/162 (60%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF   + + A V+Q +I  +   ++I C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 963  DLEMAEFVFQDVVVAAVSQVLITCQGKGIRISCNLPERFMKQSVYGDGVRLQQILSDFLF 1022

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P EL+++MF    + 
Sbjct: 1023 ISVKFSPV--GGSVEISSKLTKNSIGENLHLIDLELRIKHQGLGVPAELMEQMFEEDNKE 1080

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGLGL +S+KL+++MNG V++LREA  S+FI+  E  ++
Sbjct: 1081 QSDEGLGLLVSRKLLRLMNGDVRHLREAGVSTFILTAELASA 1122



>sp|P55004|PHYE_PHANI Phytochrome E.>gb:INU39787_1683171 Ipomoea nil
            phytochrome E (PHYE) mRNA, complete cds.
          Length = 1115

 Score =  111 bits (278), Expect = 2e-23
 Identities = 61/159 (38%), Positives = 100/159 (62%), Gaps = 1/159 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF +G  I AVV+Q MIP +E  +Q++ D+P +  SL ++GD +++Q VLSDFL 
Sbjct: 941  ELKTEEFVIGNVIDAVVSQVMIPLKEKNLQLLHDIPDQIKSLPIYGDQIKLQLVLSDFLL 1000

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF-NYKQS 417
            + V   P   +  V  R+    + I      +H++FR+THP  G+P  LI++M     + 
Sbjct: 1001 SIVRHAP-SPDGWVEIRVSPGLKLIQDGNVFIHIQFRMTHPGQGLPSALIEDMVRGGTRW 1059

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEF 534
             ++EG+ L++SQKL+++MNG V Y+RE ++  F+I L+F
Sbjct: 1060 TTQEGVVLHLSQKLVRMMNGHVHYVREQQKCYFLIDLDF 1098



>gb:ASAP3R_1542110 Avena sativa mRNA for phytochrome (AP3).
          Length = 1129

 Score =  110 bits (274), Expect = 5e-23
 Identities = 60/162 (37%), Positives = 96/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L + + A V+Q +I  +   ++I C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 964  DLEMAEFLLQDVVVAAVSQVLITCQGKGIRISCNLPERFMKQSVYGDGVRLQQILSDFLF 1023

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P EL+ +MF    + 
Sbjct: 1024 ISVKFSPV--GGSVEISSKLTKNSIGENLHLIDLELRIKHQGLGVPAELMAQMFEEDNKE 1081

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG V++LREA  S+FII  E  ++
Sbjct: 1082 QSEEGLSLLVSRNLLRLMNGDVRHLREAGVSTFIITAELASA 1123



>pir|A29631|A29631 phytochrome 3 - oat>gb:ASTPHT3A_1542592 Avena
            sativa type 3 phytochrome gene (phy3), complete cds.
          Length = 1129

 Score =  110 bits (274), Expect = 5e-23
 Identities = 60/162 (37%), Positives = 96/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L + + A V+Q +I  +   ++I C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 964  DLEMAEFLLQDVVVAAVSQVLITCQGKGIRISCNLPERFMKQSVYGDGVRLQQILSDFLF 1023

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P EL+ +MF    + 
Sbjct: 1024 ISVKFSPV--GGSVEISSKLTKNSIGENLHLIDLELRIKHQGLGVPAELMAQMFEEDNKE 1081

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG V++LREA  S+FII  E  ++
Sbjct: 1082 QSEEGLSLLVSRNLLRLMNGDVRHLREAGVSTFIITAELASA 1123



>sp|P06593|PHY3_AVESA Phytochrome A type 3 (AP3).
          Length = 1128

 Score =  110 bits (274), Expect = 5e-23
 Identities = 60/162 (37%), Positives = 96/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L + + A V+Q +I  +   ++I C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 963  DLEMAEFLLQDVVVAAVSQVLITCQGKGIRISCNLPERFMKQSVYGDGVRLQQILSDFLF 1022

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P EL+ +MF    + 
Sbjct: 1023 ISVKFSPV--GGSVEISSKLTKNSIGENLHLIDLELRIKHQGLGVPAELMAQMFEEDNKE 1080

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG V++LREA  S+FII  E  ++
Sbjct: 1081 QSEEGLSLLVSRNLLRLMNGDVRHLREAGVSTFIITAELASA 1122



>gb:AY234828_1591778 Zea mays cultivar B73 phytochrome B2 apoprotein
            (phyB2) gene, complete cds.
          Length = 1166

 Score =  109 bits (272), Expect = 9e-23
 Identities = 61/154 (39%), Positives = 91/154 (59%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EFSLG+ + AVV+Q M   RE  +Q++ D+P E      +GD  RIQQVL+DFL +    
Sbjct: 1000 EFSLGDVMNAVVSQTMSLLRERDLQLIRDIPDEIKDASAYGDQFRIQQVLADFLLSMAQS 1059

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P  E   V  ++    +Q           FR   P  G+P +++Q+MF+  Q  ++EG+
Sbjct: 1060 APS-ENGWVEIQVRPNVKQNYDGTDTELFIFRFACPGEGLPADIVQDMFSNSQWSTQEGV 1118

Query: 436  GLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            GL   +K++K+M G VQY+RE+ERS F+I+LE P
Sbjct: 1119 GLSTCRKILKLMGGEVQYIRESERSFFLIVLELP 1152



>gb:AY466073_1607977 Sorghum bicolor phytochrome A (PHYA) gene,
            complete cds.>gb:AY466076_1607980 Sorghum arundinaceum
            voucher IS14503 phytochrome A (PHYA) gene, complete cds.
          Length = 1131

 Score =  108 bits (270), Expect = 1e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGNIRHLREAGMSTFILTAELAAA 1125



>gb:AY466072_1607976 Sorghum bicolor isolate PHYA-RTx430 phytochrome A
            (PHYA) gene, complete cds.>gb:AY466080_1607984 Sorghum
            arundinaceum voucher PI225905 phytochrome A (PHYA) gene,
            complete cds.>gb:AY466081_1607985 Sorghum arundinaceum
            voucher PI302233 phytochrome A (PHYA) gene, complete cds.
          Length = 1131

 Score =  108 bits (270), Expect = 1e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGNIRHLREAGMSTFILTAELAAA 1125



>gb:AY234826_1591776 Zea mays cultivar B73 phytochrome A1 apoprotein
            (phyA1) gene, complete cds.
          Length = 1131

 Score =  108 bits (270), Expect = 1e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP  +    ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLQDVVVSAVSQVLIGCQGKGIRVACNLPERSMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P      +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPAGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYGEDNRE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGDIRHLREAGMSTFILTAELAAA 1125



>gb:AY466083_1607987 Sorghum propinquum phytochrome A (PHYA) gene,
            complete cds.
          Length = 1131

 Score =  108 bits (269), Expect = 2e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGDIRHLREAGMSTFILTAELAAA 1125



>gb:AY466077_1607981 Sorghum arundinaceum voucher IS14567 phytochrome
            A (PHYA) gene, complete cds.>gb:AY466078_1607982 Sorghum
            arundinaceum voucher PI302105 phytochrome A (PHYA) gene,
            complete cds.>gb:AY466082_1607986 Sorghum x drummondii
            voucher PI302233 phytochrome A (PHYA) gene, complete cds.
          Length = 1131

 Score =  108 bits (269), Expect = 2e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGDIRHLREAGMSTFILTAELAAA 1125



>gb:AY466075_1607979 Sorghum arundinaceum voucher PI213900 phytochrome
            A (PHYA) gene, complete cds.
          Length = 1131

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/162 (31%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG ++++REA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGNIRHIREAGMSTFILTAELAAA 1125



>gb:AY466074_1607978 Sorghum arundinaceum voucher IS14569 phytochrome
            A (PHYA) gene, complete cds.
          Length = 1131

 Score =  107 bits (268), Expect = 3e-22
 Identities = 51/162 (31%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG ++++REA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGNIRHIREAGMSTFILTAELAAA 1125



>gb:AY466071_1607975 Sorghum bicolor voucher NSL83707 phytochrome A
            (PHYA) gene, complete cds.
          Length = 1131

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 PSEEGLSLLVSRNLLRLMNGNIRHLREAGMSTFILTAELAAA 1125



>gb:AY466069_1607973 Sorghum bicolor voucher PI229835 phytochrome A
            (PHYA) gene, complete cds.>gb:AY466070_1607974 Sorghum
            bicolor voucher PI152593 phytochrome A (PHYA) gene,
            complete cds.
          Length = 1131

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/162 (32%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 PSEEGLSLLVSRNLLRLMNGNIRHLREAGMSTFILTAELAAA 1125



>gb:AY466079_1607983 Sorghum arundinaceum voucher IS14485 phytochrome
            A (PHYA) gene, complete cds.
          Length = 1131

 Score =  107 bits (267), Expect = 3e-22
 Identities = 51/162 (31%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG ++++REA  S+FI+  E  A+
Sbjct: 1084 QSEEGLSLLVSRNLLRLMNGDIRHIREAGMSTFILTAELAAA 1125



>gb:AY466068_1607972 Sorghum bicolor voucher PI153800 phytochrome A
            (PHYA) gene, complete cds.
          Length = 1131

 Score =  107 bits (266), Expect = 4e-22
 Identities = 51/162 (31%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG ++++REA  S+FI+  E  A+
Sbjct: 1084 PSEEGLSLLVSRNLLRLMNGNIRHIREAGMSTFILTAELAAA 1125



>sp|P93526|PHYA_SORBI Phytochrome a.>gb:AY466067_1607971 Sorghum
            bicolor voucher PI267380 phytochrome A (PHYA) gene,
            complete cds.>gb:SBU56729_1704934 Sorghum bicolor
            phytochrome A (PHYA) mRNA, complete cds.
          Length = 1131

 Score =  107 bits (266), Expect = 4e-22
 Identities = 51/162 (31%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLDMAEFVLEDVVVSAVSQVLIGCQGKGIRVACNLPERFMKQKVYGDGIRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P+     +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPVGGSVDISSKL--TKNSIGENLHLIDFELRIKHQGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EGL L +S+ L+++MNG ++++REA  S+FI+  E  A+
Sbjct: 1084 PSEEGLSLLVSRNLLRLMNGNIRHIREAGMSTFILTAELAAA 1125



>gb:AB109891_1526862 Oryza sativa (japonica cultivar-group) PHYA mRNA
            for phytochrome A, complete cds.>gb:AC147426_1744671
            Oryza sativa chromosome 3 B1377B10 genomic sequence,
            complete sequence.>gb:AF377946_1793295 Oryza sativa
            (japonica cultivar-group) chromosome 3, BAC clone
            OSJNBa0031O09, complete sequence.
          Length = 1128

 Score =  106 bits (264), Expect = 7e-22
 Identities = 54/162 (33%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L +   A V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLEMVEFVLQDVFVAAVSQVLITCQGKGIRVSCNLPERYMKQTVYGDGVRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF-NYKQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P +L+ +M+ +  + 
Sbjct: 1026 VSVKFSPV--GGSVEISCSLTKNSIGENLHLIDLELRIKHQGKGVPADLLSQMYEDDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EG+ L +S+ L+++MNG V+++REA  S+FI+ +E  ++
Sbjct: 1084 QSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSVELASA 1125



>sp|P10931|PHYA_ORYSA Phytochrome A.>pir|S03728|S03728 phytochrome
            (clone phy18) - rice>gb:OSPHY18_1698300 Rice phy 18 gene
            for phytochrome.
          Length = 1128

 Score =  106 bits (264), Expect = 7e-22
 Identities = 54/162 (33%), Positives = 97/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++   EF L +   A V+Q +I  +   +++ C+LP       ++GD +R+QQ+LSDFL 
Sbjct: 966  DLEMVEFVLQDVFVAAVSQVLITCQGKGIRVSCNLPERYMKQTVYGDGVRLQQILSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF-NYKQS 417
             +V F+P+    SV       +  IG  +H++ LE RI H   G+P +L+ +M+ +  + 
Sbjct: 1026 VSVKFSPV--GGSVEISCSLTKNSIGENLHLIDLELRIKHQGKGVPADLLSQMYEDDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EG+ L +S+ L+++MNG V+++REA  S+FI+ +E  ++
Sbjct: 1084 QSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSVELASA 1125



>gb:AF178571_1774717 Lycopersicon esculentum phytochrome E (PHYE)
            gene, complete cds.
          Length = 1137

 Score =  105 bits (262), Expect = 1e-21
 Identities = 56/167 (33%), Positives = 100/167 (59%), Gaps = 1/167 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++N  EF LG  + A+V+Q MI  +E  +Q++ D+P +  +L L+GD +++Q+VLSDFL 
Sbjct: 960  QLNMEEFVLGNVVDAIVSQVMIFLKEKNLQLLHDIPDQIKTLPLYGDQIKLQRVLSDFLL 1019

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQS- 417
            + V   P   +  V  +++   + I     ++HL+ R+THP  G+P  LI +M   +   
Sbjct: 1020 SVVHHAP-SPDGWVEIKVLPGLKLIQDGNELIHLQLRMTHPGQGLPAALIDDMSGERNRW 1078

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSDH 558
             ++EG+ L ++QKL+ +MNG V+Y+R  ++  F+I +E      + H
Sbjct: 1079 TTQEGIALNVAQKLLNVMNGHVRYVRGEDKCYFLIDVELQTLKPTQH 1125



>sp|P19862|PHYA_MAIZE Phytochrome A.>pir|JQ0382|JQ0382 phytochrome A -
            maize>gb:AY260865_1593432 Zea mays phytochrome A2 (phyA2)
            gene, complete cds.
          Length = 1131

 Score =  105 bits (262), Expect = 1e-21
 Identities = 50/162 (30%), Positives = 96/162 (59%), Gaps = 1/162 (0%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +++  EF L + + + V+Q +I  +   +++ C+LP  +    ++GD +R+QQ++SDFL 
Sbjct: 966  DLDMAEFVLQDVVVSAVSQVLIGCQAKGIRVACNLPERSMKQKVYGDGIRLQQIVSDFLF 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY-KQS 417
             +V F+P      +  ++   +  IG  +H++  E RI H   G+P E++ +M+    + 
Sbjct: 1026 VSVKFSPAGGSVDISSKL--TKNSIGENLHLIDFELRIKHRGAGVPAEILSQMYEEDNKE 1083

Query: 418  MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
             S EG  L +S+ L+++MNG +++LREA  S+FI+  E  A+
Sbjct: 1084 QSEEGFSLAVSRNLLRLMNGDIRHLREAGMSTFILTAELAAA 1125



>gb:AY348568_1601423 Orobanche minor phytochrome A (phyA) mRNA,
            complete cds.
          Length = 1123

 Score =  103 bits (258), Expect = 4e-21
 Identities = 63/164 (38%), Positives = 100/164 (60%), Gaps = 1/164 (0%)
 Frame = +1

Query: 55   YTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
            Y ++   EF L E + A ++Q +  S    ++I+ +L    S+  L+GD+LR+QQVL+ F
Sbjct: 958  YLDLEMVEFKLHEVLIASISQVISKSNGKGIKIVDNLAPNLSNETLYGDSLRLQQVLAAF 1017

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            L  AV  TP   +  V   +   ++ IG  + +  LE RITH   G+P+E++ +MF  + 
Sbjct: 1018 LLIAVDSTPSGGQLGVAATLA--KDSIGEFVQLGRLECRITHGG-GVPQEILNQMFGDEP 1074

Query: 415  S-MSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
            +  S +G+ L+IS+KL+K+M G +QYLREA RS+FII +E   S
Sbjct: 1075 TDASEDGISLFISRKLVKLMKGDIQYLREAGRSTFIISVEIAIS 1118



>sp|P42498|PHYE_ARATH Phytochrome E.>pir|S46313|S46313 phytochrome E -
            Arabidopsis thaliana>gb:ATCHRIV48_1545614 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            48.>gb:ATF15J5_1548725 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F15J5 (ESSA
            project).>gb:ATPHYE_1553857 A.thaliana phyE gene.
          Length = 1112

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 55/158 (34%), Positives = 87/158 (55%), Gaps = 1/158 (0%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF L   +  +++Q MI  RE   Q+  ++  E  +L L GD +++Q +L+D L   V  
Sbjct: 942  EFRLENILDTIISQVMIILRERNSQLRVEVAEEIKTLPLNGDRVKLQLILADLLRNIVNH 1001

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQS-MSREG 432
             P F  S V   I   +E        +HL+FR+ HP  G+P E++ +MF  +   ++ +G
Sbjct: 1002 AP-FPNSWVGISISPGQELSRDNGRYIHLQFRMIHPGKGLPSEMLSDMFETRDGWVTPDG 1060

Query: 433  LGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
            LGL +S+KL++ MNG V Y+RE ER  F + L+    L
Sbjct: 1061 LGLKLSRKLLEQMNGRVSYVREDERCFFQVDLQVKTML 1098



>sp|O49934|PHYA_POPTM Phytochrome A.>pir|T09835|T09835 phytochrome A -
            Populus tremula x Populus
            tremuloides>gb:PTXPTPHYA_1702841 Populus tremula x
            Populus tremuloides mRNA for phytochrome A.
          Length = 1125

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 65/187 (34%), Positives = 97/187 (51%), Gaps = 4/187 (2%)
 Frame = +1

Query: 4    QLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASS 183
            QL+K             Y ++   EF+L E        +     E  + I+ D    A +
Sbjct: 942  QLSKILDDSDLDSIIEGYLDLEMVEFTLREYY-GCYQSSHDEKHEKGIPIINDALKMAET 1000

Query: 184  LYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIAR--REQIGAKMHV-VHL-EFR 351
            LY  GD++R+QQVL+DF    ++ TP    S  L  + A   +  +GA + + VH  + R
Sbjct: 1001 LY--GDSIRLQQVLADFCRCQLILTP----SGGLLTVSASFFQRPVGAILFILVHSGKLR 1054

Query: 352  ITHPAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLE 531
            I H   GIPE L+ +M+      S EG+ L IS+KL+K+MNG V+Y+REA +SSFII +E
Sbjct: 1055 IRHLGAGIPEALVDQMYGEDTGASVEGISLVISRKLVKLMNGDVRYMREAGKSSFIISVE 1114

Query: 532  FPASLRS 552
                 +S
Sbjct: 1115 LAGGHKS 1121



>gb:AY244514_1592483 Triticum monococcum cultivar G1777 phytochrome
           C (PHYC) gene, partial cds.
          Length = 140

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 48/114 (42%), Positives = 68/114 (59%)
 Frame = +1

Query: 1   EQLAKXXXXXXXXXXXXXYTEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS 180
           EQL K             Y EMN  EF+L EA+  V+ Q M  S+E Q+ +  D PVE S
Sbjct: 28  EQLKKILHDNDLEGIEQCYMEMNTVEFNLEEALNTVLMQGMSVSKEKQISLDRDWPVEVS 87

Query: 181 SLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHL 342
           S+YL+GDNLR+QQVL+D+L   + FT    E  ++ ++I ++E IG+ M + HL
Sbjct: 88  SMYLYGDNLRLQQVLADYLACTLQFTRP-AEGPIVLQVIPKKEHIGSGMQIAHL 140



>gb:AY741187_1626336 Arabidopsis thaliana Mh-0 phytochrome D (PHYD)
            gene, partial cds.
          Length = 1126

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 46/124 (37%), Positives = 73/124 (58%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G    AVV+Q M+  RE  +Q++ ++P E  S+ ++GD +R+QQVL++FL + V +
Sbjct: 1003 EFFIGNVTNAVVSQVMLVVRERNLQLIRNIPTEVKSMAVYGDQIRLQQVLAEFLLSIVRY 1062

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P+  E SV   +     Q+      V LEFR+     G+P E +Q+MF+  +  S EGL
Sbjct: 1063 APM--EGSVELHLCPTLNQMADGFSAVRLEFRMACAGEGVPPEKVQDMFHSSRWPSPEGL 1120

Query: 436  GLYI 447
            GL +
Sbjct: 1121 GLSV 1124



>gb:AY741197_1626345 Cleome hassleriana phytochrome B (PHYB) gene,
            partial cds.
          Length = 1045

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 42/124 (33%), Positives = 72/124 (58%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF +G  I AVV+Q M+  RE  +Q++ D+P E  ++ ++GD +RIQQVL++FL + + +
Sbjct: 923  EFIMGSVINAVVSQVMMLVRERGLQLIRDIPEEIKTMAVYGDQMRIQQVLAEFLLSIIKY 982

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSREGL 435
             P      +    I +    G+    +  EFR+     G+P EL+++MF+  +  + EGL
Sbjct: 983  APSQGWVEIHLNPILKHLPDGSSS--LRSEFRMACGGEGLPPELVRDMFHGSRWTTPEGL 1040

Query: 436  GLYI 447
            GL +
Sbjct: 1041 GLSV 1044



>gb:AF309807_1785030 Populus balsamifera subsp. trichocarpa
            phytochrome B2 (phyB2) gene, complete cds.
          Length = 1146

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 7/158 (4%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF LG  I AVV+QAM+  RE  +Q++ D+P E  +L ++GD  RIQQVL+DFL 
Sbjct: 966  ELEKAEFLLGSVINAVVSQAMLLLRERNLQLLRDIPEEIKTLAVYGDQARIQQVLADFLL 1025

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEF----RITHPAPGIPEELIQEMFNY 408
              V + P      V   +    +QI     +VH EF    R+        +  ++   N+
Sbjct: 1026 NMVRYAP-SSAGWVEIHVCPTLKQISDGHTLVHTEFKYLERVLQTRMLGLQHPLRSFLNF 1084

Query: 409  KQS---MSREGLGLYISQKLIKIMNGTVQYLREAERSS 513
            K +   + REG+   I  + + +  G + +L   E ++
Sbjct: 1085 KLTLVMLHREGMVPKIQFQGLSVCQGRLIWLSYPENTT 1122



>gb:BX571657_777625 Wolinella succinogenes, complete genome; segment
           1/7.
          Length = 538

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 48/168 (28%), Positives = 86/168 (51%), Gaps = 9/168 (5%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
           E+      L E ++AV +   + +RE  V+++C L  E   L + GD +R++QV ++ L 
Sbjct: 340 ELESLPMKLSEELRAVADFCEVKAREKGVKLLC-LFKEIEGLIIQGDVMRLKQVTANLLG 398

Query: 241 TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQS 417
            A+ FTP   E  +   ++  RE+       + L+F ++    GI  E ++++F  ++Q+
Sbjct: 399 NAIKFTPEGGEVRLGVEVLEEREE------AIALDFSVSDTGIGIAPEYLEKIFRPFEQA 452

Query: 418 MSR-------EGLGLYISQKLIKIMNGTVQ-YLREAERSSFIILLEFP 537
            S         GLGL ISQ+L+++M G ++    E + S F   L  P
Sbjct: 453 ESSTARNYGGTGLGLSISQELVRLMGGEMRCQSEEGKGSRFSFTLTLP 500



>gb:ECU62023_134295 Erwinia carotovora subsp. carotovora
           sensor/regulator protein RpfA (rpfA) gene, complete cds.
          Length = 929

 Score = 59.7 bits (143), Expect = 8e-08
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L + +  + + A     E+ + I  D+P +       GD LRIQQ++++ L  A+ FT 
Sbjct: 370 TLDDVVMLLAHTAHEKGLELTLSIQNDVPEQ-----FVGDPLRIQQIITNLLGNAIKFT- 423

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSMSRE 429
             E+ ++  R+  RR+++    H V LE +I     GI E    +L Q       S+SR 
Sbjct: 424 --EQGNIDIRVEKRRQEL----HQVLLEVQIRDTGIGIAELQQSQLFQAFRQADTSISRR 477

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+Q+L+K M G + +  E  + S
Sbjct: 478 HGGTGLGLVITQRLVKEMGGDISFQSELSKGS 509



>gb:BX950851_842306 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 933

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 45/152 (29%), Positives = 75/152 (49%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L + +  + + A     E+ + I  D+P +       GD LRIQQ++++ L  A+ FT 
Sbjct: 371 TLDDVVMLLAHTAHEKGLELTLSIQNDVPEQ-----FVGDPLRIQQIITNLLGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSMSRE 429
             E+ ++  R+  RR++     H V LE +I     GI E    +L Q       S+SR 
Sbjct: 425 --EQGNIDIRVEKRRQE----HHQVQLEVQIRDTGIGIAELQQSQLFQAFRQADTSISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+Q+L+K M G + +  +  + S
Sbjct: 479 HGGTGLGLVITQRLVKEMGGDISFQSQLNKGS 510



>gb:ECEXPS_125532 Erwinia carotovora expS gene.
          Length = 928

 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 45/152 (29%), Positives = 75/152 (49%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L + +  + + A     E+ + I  D+P +       GD LRIQQ++++ L  A+ FT 
Sbjct: 368 TLDDVVMLLAHTAHEKGLELTLSIQNDVPEQ-----YVGDPLRIQQIITNLLGNAIKFT- 421

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSMSRE 429
             E+ ++  R+  RR++     H V LE +I     GI E    +L Q       S+SR 
Sbjct: 422 --EQGNIDIRVEKRRQE----HHQVQLEVQICDTGIGIAELQQSQLFQAFRQADTSISRR 475

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+Q+L+K M G + +  +  + S
Sbjct: 476 HGGTGLGLVITQRLVKEMGGDISFQSQLNKGS 507



>gb:AY057389_587287 Serratia plymuthica putative global response
           regulation sensor kinase GrrS (grrS) gene, complete cds.
          Length = 908

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 52/168 (30%), Positives = 83/168 (49%), Gaps = 11/168 (6%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E I  +   A     E+ + +  D+P +     + GD+LR+QQ++++ L  A+ FT 
Sbjct: 370 TLDEVIVLLAPSAHEKGLELTLDVHNDVPEQ-----VIGDSLRLQQIITNLLGNAIKFT- 423

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQ---SMSRE 429
             E  ++  R+  R    G + H V LE +I     GI E    ++F  ++Q   S+SR 
Sbjct: 424 --ETGNIDIRVELR----GQQDHQVELEVQIHDTGIGISERQQSQLFQAFRQADASISRR 477

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS---FIILLEFPASLRS 552
               GLGL I+QKL+K M G + +  +  R S   F I LE    + S
Sbjct: 478 HGGTGLGLVITQKLVKEMGGDICFHSQLNRGSTFWFHITLELHEGMLS 525



>gb:BA000012_668843 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 1391

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 48/170 (28%), Positives = 85/170 (50%), Gaps = 9/170 (5%)
 Frame = +1

Query: 79   FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
            F+L EAI+ V       ++E  ++++  +     SL++ GD  RI+Q++++ L  AV FT
Sbjct: 913  FNLAEAIEDVATLVSTRAKEKDLELIVRVEPRLESLFV-GDVGRIRQIVTNLLGNAVKFT 971

Query: 259  PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE---LIQEMFNYKQSMSRE 429
               +E  VL  +   R   G ++ +      +T    GIPEE   L+ E F+   + S  
Sbjct: 972  ---DEGHVLVDVTGERVPTGTRLTI-----SVTDTGIGIPEEKLKLVFEKFSQVDTSSTR 1023

Query: 430  -----GLGLYISQKLIKIMNGTVQY-LREAERSSFIILLEFPASLRSDHQ 561
                 GLGL I+ +L+++M GT+     E + S+F   +  P + + + Q
Sbjct: 1024 RHEGTGLGLAITSRLVELMGGTIGVESAEGKGSTFWFTVTLPRAGQQNGQ 1073



>pir|PN0559|PN0559 phytochrome - wild rice (strain W2025)
           (fragments)
          Length = 176

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/63 (39%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +1

Query: 346 FRITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFII 522
           FRI H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+
Sbjct: 112 FRIKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFIL 171

Query: 523 LLE 531
            +E
Sbjct: 172 SVE 174



>gb:BX842653_825660 Bdellovibrio bacteriovorus complete genome, strain
            HD100; segment 8/11.
          Length = 878

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 41/163 (25%), Positives = 77/163 (47%), Gaps = 9/163 (5%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            E  L   +  +     + +RE  +++   L  +  S+++ GD  RI+QVLS+ ++ ++ F
Sbjct: 568  EVDLHSLVNDITEMFELKAREKNLELSVYLSEDTHSIFM-GDPTRIRQVLSNLISNSLKF 626

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN--------YK 411
            T    + S+   ++  + ++       +L F ++    GIP + I ++F           
Sbjct: 627  TT---DGSIRVEVMKNQTEMEG-----NLIFHVSDTGIGIPRDKIPQLFQPFTQADSTIT 678

Query: 412  QSMSREGLGLYISQKLIKIMNGTVQYLREAERSS-FIILLEFP 537
            +     GLGL IS++L+K+MNG +    E  R S F   L  P
Sbjct: 679  RKFGGTGLGLSISKRLVKMMNGDITVESELHRGSRFSFSLNLP 721



>gb:AE016824_341544 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome II, complete sequence.
          Length = 841

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 11/122 (9%)
 Frame = +1

Query: 196 GDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGI 375
           GD  RI QVLS+ ++ AV FT      S   +I A  E+I  K   +  + ++     GI
Sbjct: 582 GDKRRITQVLSNLISNAVKFT-----DSGKIQIRAFSEKIETK---IEYKIQVIDSGIGI 633

Query: 376 PEE----LIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERSS---FII 522
           P E    L Q+ F    S+SR+    GLGL IS+KL+++MNG +   +   + S   F +
Sbjct: 634 PREKIDLLFQKFFQLDSSISRKYGGTGLGLAISKKLVELMNGKIHVSQNKSKGSTFEFTV 693

Query: 523 LL 528
           LL
Sbjct: 694 LL 695



>gb:AE011611_274837 Leptospira interrogans serovar lai str. 56601
           chromosome II, section 23 of 34 of the complete
           sequence.>gb:AE010301_1003511 Leptospira interrogans
           serovar lai str. 56601 chromosome II, complete sequence.
          Length = 869

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 43/122 (35%), Positives = 63/122 (51%), Gaps = 11/122 (9%)
 Frame = +1

Query: 196 GDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGI 375
           GD  RI QVLS+ ++ AV FT      S   +I A  E+I  K   +  + ++     GI
Sbjct: 610 GDKRRITQVLSNLISNAVKFT-----DSGKIQIRAFSEKIETK---IEYKIQVIDSGIGI 661

Query: 376 PEE----LIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERSS---FII 522
           P E    L Q+ F    S+SR+    GLGL IS+KL+++MNG +   +   + S   F +
Sbjct: 662 PREKIDLLFQKFFQLDSSISRKYGGTGLGLAISKKLVELMNGKIHVSQNKSKGSTFEFTV 721

Query: 523 LL 528
           LL
Sbjct: 722 LL 723



>pir|AB2017|AB2017 two-component sensor histidine kinase all1688
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682677 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 676

 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 8/151 (5%)
 Frame = +1

Query: 58  TEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFL 237
           T +N  EFSL +  +  +   +  +   QV +  DL ++        D  RI+Q+L + L
Sbjct: 515 TVLNIAEFSLVKIAENTIESLLEKALSEQVNLKLDLQIDPRRDRFTADAARIEQILWNLL 574

Query: 238 TTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN---- 405
           T A+ FTP  E  +V  RI    +            F++     GIPEE +  +F     
Sbjct: 575 TNAIKFTP--EGGNVTLRIWVEEDT---------SIFQVEDTGIGIPEEQLPLLFEKFQQ 623

Query: 406 ----YKQSMSREGLGLYISQKLIKIMNGTVQ 486
               Y++     GLGL ++++L+++  G ++
Sbjct: 624 LDTPYRRRYEGTGLGLALTKQLVELHRGRIE 654



>gb:AE016914_356151 Chromobacterium violaceum ATCC 12472 section 5
           of 16 of the complete genome.>gb:AE016825_1041305
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1105

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 48/170 (28%), Positives = 77/170 (45%), Gaps = 11/170 (6%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIK--AVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
           E+    F L + +   + +  A + +R+I++ I    P      YL GD LR++QVL + 
Sbjct: 461 EIEQASFRLADVLDNLSTIMSASVGNRDIELIIA---PPPQDIDYLRGDALRLEQVLINL 517

Query: 235 LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF---- 402
            + A+ FT   E   V   I    + + A    V L F +     GIP+   +E+F    
Sbjct: 518 TSNAIKFT---EHGHVKVSI----QPLEASPSQVRLRFAVEDTGIGIPKPKQRELFRPFT 570

Query: 403 ----NYKQSMSREGLGLYISQKLIKIMNGTV-QYLREAERSSFIILLEFP 537
               +  +     GLGL ISQ+L+ +M G +  Y    + S+F   L FP
Sbjct: 571 QADASTTRRFGGTGLGLAISQRLVALMGGEIGLYSEPGQGSAFWFTLRFP 620



>pir|AI0860|AI0860 sensor protein [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain
           CT18)>gb:AE016843_346879 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 10 of 16 of the
           complete genome.>gb:AL627276_543201 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 12/20.>gb:AE014613_984211 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 918

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQV+++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKNDVPEN-----VIGDPLRLQQVITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              ES  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ESGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>pir|PN0557|PN0557 phytochrome - wild rice (strain CP20) (fragments)
          Length = 170

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 23/67 (34%), Positives = 44/67 (65%), Gaps = 1/67 (1%)
 Frame = +1

Query: 334 VHLEFRITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERS 510
           + +   I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S
Sbjct: 102 IRVSCNIKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMS 161

Query: 511 SFIILLE 531
           +FI+ +E
Sbjct: 162 TFILSVE 168



>pir|PN0556|PN0556 phytochrome - wild rice (strain W180) (fragments)
          Length = 162

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 23/67 (34%), Positives = 44/67 (65%), Gaps = 1/67 (1%)
 Frame = +1

Query: 334 VHLEFRITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERS 510
           + +   I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S
Sbjct: 94  IRVSCNIKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMS 153

Query: 511 SFIILLE 531
           +FI+ +E
Sbjct: 154 TFILSVE 160



>gb:AE008835_244610 Salmonella typhimurium LT2, section 139 of 220
           of the complete genome.>gb:AF171069_485348 Salmonella
           typhimurium BarA sensor kinase (barA) gene, complete
           cds.>gb:AE006468_1001692 Salmonella typhimurium LT2,
           complete genome.
          Length = 918

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQV+++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKNDVPDN-----VIGDPLRLQQVITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              ES  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ESGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>gb:CP000026_77557 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 918

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 44/152 (28%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQV+++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKNDVPDN-----VIGDPLRLQQVITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              ES  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ESGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>gb:BX571659_778216 Wolinella succinogenes, complete genome; segment
            3/7.
          Length = 1555

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 7/164 (4%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+ C +F L   I+ V     + + E  ++ +     +  ++ L GD LR+ Q+L++   
Sbjct: 920  EIECIDFDLHSVIEHVSTLVELKATEKNLEFVVSYD-QGMNMNLHGDPLRLGQILTNLAN 978

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP--APGIPEELIQEMFNYKQ 414
             A+ FT    E  V   I  +      ++H    E R T    +PG  E+L +       
Sbjct: 979  NAIKFT---HEGEVGIYITKQ------ELHRYRFEVRDTGIGLSPGQKEKLFRSFSQADT 1029

Query: 415  SMSRE----GLGLYISQKLIKIMNGTVQY-LREAERSSFIILLE 531
            S +R+    GLGL IS++L+++MNG +     E + SSFI  +E
Sbjct: 1030 STTRQYGGTGLGLAISKQLVEMMNGRIWVESEEGKGSSFIFEIE 1073



>pir|PN0555|PN0555 phytochrome - wild rice (strain W108) (fragments)
          Length = 166

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +1

Query: 352 ITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+ +
Sbjct: 104 IKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSV 163

Query: 529 E 531
           E
Sbjct: 164 E 164



>pir|PN0552|PN0552 phytochrome - wild rice (strain W106) (fragments)
          Length = 172

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +1

Query: 352 ITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+ +
Sbjct: 110 IKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSV 169

Query: 529 E 531
           E
Sbjct: 170 E 170



>pir|PN0553|PN0553 phytochrome - wild rice (strain W2008)
           (fragments)
          Length = 171

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +1

Query: 352 ITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+ +
Sbjct: 109 IKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSV 168

Query: 529 E 531
           E
Sbjct: 169 E 169



>pir|PN0558|PN0558 phytochrome - wild rice (strains NE88 and NE4)
           (fragments)
          Length = 171

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +1

Query: 352 ITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+ +
Sbjct: 109 IKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSV 168

Query: 529 E 531
           E
Sbjct: 169 E 169



>pir|PN0560|PN0560 phytochrome - long-staminate rice (strain W1444)
           (fragments)
          Length = 169

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 23/61 (37%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +1

Query: 352 ITHPAPGIPEELIQEMF-NYKQSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           I H   G+P +L+ +M+ +  +  S EG+ L +S+ L+++MNG V+++REA  S+FI+ +
Sbjct: 107 IKHQGKGVPADLLSQMYEDDNKEQSDEGMSLAVSRNLLRLMNGDVRHMREAGMSTFILSV 166

Query: 529 E 531
           E
Sbjct: 167 E 167



>gb:D90894_124012 E.coli genomic DNA, 62.8 min.
          Length = 813

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQ++++ +  A+ FT 
Sbjct: 266 TLDEVVTLLAHSSHDKGLELTLNIKSDVPDN-----VIGDPLRLQQIITNLVGNAIKFT- 319

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              E+  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 320 ---ENGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 373

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 374 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 405



>pir|T38457|T38457 putatve sensory transduction histidine kinase -
            fission yeast (Schizosaccharomyces
            pombe)>gb:SPAC27E2_1717507 S.pombe chromosome I cosmid
            c27E2.
          Length = 2310

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 40/121 (33%), Positives = 64/121 (52%), Gaps = 8/121 (6%)
 Frame = +1

Query: 145  VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAK 324
            VQI  D+     +L L GD+ +++QV+++ L  +V FT    E  +L R +A  E+I A+
Sbjct: 1850 VQISYDIYPNVPAL-LAGDSAKLRQVITNLLGNSVKFTT---EGHILLRCMAIDEEINAE 1905

Query: 325  MHVVHLEFRITHPAPGIPEELIQEMFN----YKQSMSR----EGLGLYISQKLIKIMNGT 480
             +   L F I     G+ EE ++ +FN       S +R     GLGL I  ++ KIM+G 
Sbjct: 1906 ENQCKLRFEIEDTGIGLKEEQLKLLFNPFTQVDGSTTRIYGGSGLGLSICLQICKIMDGD 1965

Query: 481  V 483
            +
Sbjct: 1966 I 1966



>pir|G85929|G85929 hypothetical protein barA [imported] -
           Escherichia coli  (strain O157:H7, substrain
           EDL933)>gb:AE005174_67898 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 918

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQ++++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKSDVPDN-----VIGDPLRLQQIITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              E+  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ENGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>sp|P59342|BARA_SHIFL Sensor protein barA (EC
           2.7.3.-).>gb:AE005674_72381 Shigella flexneri 2a str.
           301, complete genome.>gb:AE016987_372560 Shigella
           flexneri 2a str. 2457T section 10 of 16 of the complete
           genome.>gb:AE014073_997310 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 918

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQ++++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKSDVPDN-----VIGDPLRLQQIITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              E+  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ENGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>sp|P26607|BARA_ECOLI Sensor protein barA (EC
           2.7.3.-).>pir|S20550|S20550 sensor-regulator protein
           barA (EC 2.7.3.-) - Escherichia coli (strain
           K-12)>pir|F91084|F91084 sensor-regulator protein barA
           [imported] - Escherichia coli  (strain O157:H7,
           substrain RIMD 0509952)>gb:ECOBARA_128172 E.coli barA
           gene for sensor-regulator protein.>gb:U00096_201811
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016765_327339 Escherichia coli CFT073
           section 11 of 18 of the complete
           genome.>gb:BA000007_661658 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_957923 Escherichia coli
           CFT073 complete genome.
          Length = 918

 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 42/152 (27%), Positives = 71/152 (46%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E +  + + +     E+ + I  D+P       + GD LR+QQ++++ +  A+ FT 
Sbjct: 371 TLDEVVTLLAHSSHDKGLELTLNIKSDVPDN-----VIGDPLRLQQIITNLVGNAIKFT- 424

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSRE 429
              E+  +  ++ +R     K   V +E +I     GIPE     L Q       S+SR 
Sbjct: 425 ---ENGNIDILVEKRALSNTK---VQIEVQIRDTGIGIPERDQSRLFQAFRQADASISRR 478

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G + +  +  R S
Sbjct: 479 HGGTGLGLVITQKLVNEMGGDISFHSQPNRGS 510



>gb:AF525283_519032 Methylococcus capsulatus MmoC (mmoC) gene, partial
            cds; and MmoG (mmoG), MmoQ (mmoQ), MmoS (mmoS), and MmoR
            (mmoR) genes, complete cds.
          Length = 1177

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 6/147 (4%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF+L + ++ V       + +  +++ C LP +   +++ GD  RI+Q+L++ L 
Sbjct: 588  EIERTEFNLPDLVEEVCALLAGRAHDKGLELNCFLPADLPRMWI-GDPTRIRQILTNLLG 646

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP--APGIPEELIQEMFNYKQ 414
             +V FT   E   V  +++  + + GAK   +  E R T    AP +   L Q       
Sbjct: 647  NSVKFT---ERGEVSVKVM--QGEAGAKRTDLSFEIRDTGIGIAPDVQARLFQPFTQADG 701

Query: 415  SMSRE----GLGLYISQKLIKIMNGTV 483
            S SR     GLGL I + L+++M GT+
Sbjct: 702  STSRRFGGTGLGLSICRNLVELMGGTI 728



>gb:AE017282_427966 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 1177

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 6/147 (4%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            E+   EF+L + ++ V       + +  +++ C LP +   +++ GD  RI+Q+L++ L 
Sbjct: 588  EIERTEFNLPDLVEEVCALLAGRAHDKGLELNCFLPADLPRMWI-GDPTRIRQILTNLLG 646

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHP--APGIPEELIQEMFNYKQ 414
             +V FT   E   V  +++  + + GAK   +  E R T    AP +   L Q       
Sbjct: 647  NSVKFT---ERGEVSVKVM--QGEAGAKRTDLSFEIRDTGIGIAPDVQARLFQPFTQADG 701

Query: 415  SMSRE----GLGLYISQKLIKIMNGTV 483
            S SR     GLGL I + L+++M GT+
Sbjct: 702  STSRRFGGTGLGLSICRNLVELMGGTI 728



>pir|S71629|S71629 sensory transduction histidine kinase dhkA - slime
            mold  (Dictyostelium discoideum)
          Length = 2150

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 44/153 (28%), Positives = 75/153 (49%), Gaps = 11/153 (7%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +M    FS+ E  +AV++   + + +  V I+  +P     + +FGD +R++QVL + L+
Sbjct: 1454 KMETLPFSIIETCQAVIHMLSVAAND-DVDILLRVPPNVPRI-IFGDAMRMRQVLLNLLS 1511

Query: 241  TAVLFTPLFEESSVLFRIIARRE--QIGAKMHVVHLEFRITHPAPGIPEELIQEMF---- 402
             A+ FT       VL  I           +  ++HL   I     GIP+ L   +F    
Sbjct: 1512 NAIKFT---SRGHVLTDISVDDSIPPTNTEEEIIHLCITIEDTGIGIPQSLFDSIFEPFS 1568

Query: 403  NYKQSMSRE----GLGLYISQKLI-KIMNGTVQ 486
                S +R+    GLGL I+++LI ++M GT+Q
Sbjct: 1569 QADNSTTRKYGGTGLGLSITKRLIEEVMGGTIQ 1601



>gb:BX571862_785767 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 4/17.
          Length = 775

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 41/153 (26%), Positives = 75/153 (49%), Gaps = 8/153 (5%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
           F L + I  V+    + ++   +Q+   +  +  +L + GD  R+QQ+ ++ +  A+ FT
Sbjct: 365 FLLQDTIDEVMVLLTLSAKSKNIQLTHHVDPQIPNLVV-GDPTRLQQIFTNIIGNAIKFT 423

Query: 259 PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNYKQSMSR 426
              ++ SV  +I   ++    K H ++LE  ++    GI  E    L Q       S+SR
Sbjct: 424 ---DQGSVEIKINLLQQ----KHHKINLEITVSDTGIGISPEQQPHLFQAFHQANASISR 476

Query: 427 E----GLGLYISQKLIKIMNGTVQYLREAERSS 513
                GLGL I++KLI+ M G + +  E ++ S
Sbjct: 477 HYGGTGLGLVITRKLIQEMGGNISFTSEPKKGS 509



>gb:DDU42597_1377340 Dictyostelium discoideum histidine kinase A
            (dhkA) mRNA, complete cds.
          Length = 2150

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 44/153 (28%), Positives = 75/153 (49%), Gaps = 11/153 (7%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            +M    FS+ E  +AV++   + + +  V I+  +P     + +FGD +R++QVL + L+
Sbjct: 1454 KMETLPFSIIETCQAVIHMLSVAAND-DVDILLRVPPNVPRI-IFGDAMRMRQVLLNRLS 1511

Query: 241  TAVLFTPLFEESSVLFRIIARRE--QIGAKMHVVHLEFRITHPAPGIPEELIQEMF---- 402
             A+ FT       VL  I           +  ++HL   I     GIP+ L   +F    
Sbjct: 1512 NAIKFT---SRGHVLTDISVDDSIPPTNTEEEIIHLCITIEDTGIGIPQSLFDSIFEPFS 1568

Query: 403  NYKQSMSRE----GLGLYISQKLI-KIMNGTVQ 486
                S +R+    GLGL I+++LI ++M GT+Q
Sbjct: 1569 QADNSTTRKYGGTGLGLSITKRLIEEVMGGTIQ 1601



>gb:CR767821_116562 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925678_118424 Ehrlichia
           ruminantium str. Welgevonden, complete genome.
          Length = 477

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 43/162 (26%), Positives = 83/162 (51%), Gaps = 8/162 (4%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           +F LG+ + +  N  MIP  E Q ++  +  + +  + +  D  RI+QV+ + L+ ++ F
Sbjct: 318 KFDLGKIVSSCFNM-MIPRAE-QAKVHLEKVLPSDKVVMVADPKRIKQVIINLLSNSIKF 375

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY------KQS 417
           TP   E+  +  ++  R  +  K+ ++     IT    GI ++ + ++ +       K S
Sbjct: 376 TP---ENGTVKLVV--RYNLEDKLIIIE----ITDTGIGIAQQDLYKVMSVFGQVDSKHS 426

Query: 418 MSREG--LGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
              EG  LGL +S+KL+++MNG  + ++    S  +I L FP
Sbjct: 427 RKYEGTGLGLPLSKKLVELMNGIFK-IKSEPNSGTVITLTFP 467



>gb:AY263399_1314087 Dictyostelium discoideum strain Ax2 sombrero SmbA
            (smbA) gene, complete cds.
          Length = 1213

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)
 Frame = +1

Query: 79   FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
            F + E  + + +     + E  + + C++  +  S+ L GD+ RI Q+L +    A+ FT
Sbjct: 890  FRMRELTQQICHVLSGQANEKNIHLSCEVSDKIPSI-LLGDSGRILQILMNLTGNALKFT 948

Query: 259  PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF--------NYKQ 414
                   ++  I    E +  K    ++ FR+     G+P E  Q++F        +  +
Sbjct: 949  QSGYVKIIIDLIEEESELVSLKKGEYNISFRVKDTGIGVPVESHQKIFEAFVQADPSDSR 1008

Query: 415  SMSREGLGLYISQKLIKIMNGTV 483
                 GLGLY+  KL+++M G +
Sbjct: 1009 KYGGSGLGLYLCAKLVRLMKGEI 1031



>gb:AF362376_1265609 Dictyostelium discoideum histidine kinase DhkK
            (dhkK) gene, complete cds.
          Length = 1213

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 8/143 (5%)
 Frame = +1

Query: 79   FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
            F + E  + + +     + E  + + C++  +  S+ L GD+ RI Q+L +    A+ FT
Sbjct: 890  FRMRELTQQICHVLSGQANEKNIHLSCEVSDKIPSI-LLGDSGRILQILMNLTGNALKFT 948

Query: 259  PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF--------NYKQ 414
                   ++  I    E +  K    ++ FR+     G+P E  Q++F        +  +
Sbjct: 949  QSGYVKIIIDLIEEESELVSLKKGEYNISFRVKDTGIGVPVESHQKIFEAFVQADPSDSR 1008

Query: 415  SMSREGLGLYISQKLIKIMNGTV 483
                 GLGLY+  KL+++M G +
Sbjct: 1009 KYGGSGLGLYLCAKLVRLMKGEI 1031



>gb:BA000045_740451 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 577

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 46/162 (28%), Positives = 72/162 (44%), Gaps = 10/162 (6%)
 Frame = +1

Query: 85  LGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSL--YLFGDNLRIQQVLSDFLTTAVLFT 258
           L  AI+AV N A       Q +++ D   E S+L   +  D  R+QQV+ + LT A+ FT
Sbjct: 430 LHSAIEAVRNLAE------QKEVLLDCRCEPSALNRQVSADPTRLQQVIWNLLTNAIKFT 483

Query: 259 PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQSMSRE-- 429
           P              R ++       +L   +     GI  E +  MF  ++Q+ SR   
Sbjct: 484 PK-----------GGRVEVDLAGDSANLYVAVRDNGMGIAPEFLPYMFERFRQADSRSTR 532

Query: 430 -----GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPA 540
                GLGL+I + ++++  G VQ   E E    +  +E PA
Sbjct: 533 KEGGLGLGLFIVRHIVELHGGMVQAESEGEGKGAVFTVELPA 574



>gb:BA000045_740108 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 692

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 48/180 (26%), Positives = 83/180 (46%), Gaps = 20/180 (11%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIKAVVNQ--AMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
           E++   F L   I +VV      + S+++++Q++ D  V A    L GD +R+ QVL++ 
Sbjct: 382 ELDVVPFELPRLIDSVVAMFAEQLRSKDLRLQVLIDPEVPAQ---LEGDPVRLAQVLTNL 438

Query: 235 LTTAVLFTPLFEESSVLFRIIARREQIGAKMHV-------VHLEFRITHPAPGIPEE--- 384
           +  ++ FTP              R QI  ++H        + L F +     G+  E   
Sbjct: 439 VGNSLKFTP--------------RGQIAIRVHPAAQGGDDLRLRFEVVDTGIGMAPETTG 484

Query: 385 -LIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERSS---FIILLEFPA 540
            L Q  F    S +R+    GLGL IS++L+++M G +      E+ S   F++ L+  A
Sbjct: 485 RLFQSFFQADTSTTRKYGGTGLGLAISRQLVELMGGQIGVESRLEQGSTFWFVLPLKVSA 544



>gb:AE017130_386752 Yersinia pestis biovar Medievalis str. 91001
           section 4 of 16 of the complete
           genome.>gb:BX936398_835902 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE017042_1143318
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 957

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 8/158 (5%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EFS  E I  +    +    + ++ + C +  +   L + GD +R+QQV+S+ L  A+ F
Sbjct: 552 EFSTVEVITHITANYLPLVVKKRLGLYCFIEPDVPRL-IEGDPVRLQQVISNLLNNAIKF 610

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN--------YK 411
           T   +   ++ ++  R           +LEFR+     GI    I ++F+         +
Sbjct: 611 T---DTGCIILQVRVRD---------CYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQ 658

Query: 412 QSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIIL 525
           +     GLGL I +KL+ +M+G V+ + E    S   +
Sbjct: 659 RHFQGTGLGLAICEKLVNLMDGDVEVISELGMGSIFAI 696



>gb:CR925677_117469 Ehrlichia ruminantium str. Gardel, complete
           genome.
          Length = 477

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 43/162 (26%), Positives = 83/162 (51%), Gaps = 8/162 (4%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           +F LG+ + +  N  MIP  E Q ++  +  + +  + +  D  RI+QV+ + L+ ++ F
Sbjct: 318 KFDLGKIVSSCFNM-MIPRAE-QAKVHLEKVLPSDKVVMVADPKRIKQVIINLLSNSMKF 375

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY------KQS 417
           TP   E+  +  ++  R  +  K+ ++     IT    GI ++ + ++ +       K S
Sbjct: 376 TP---ENGTVKLVV--RYNLEDKLIIIE----ITDTGIGIAQQDLYKVMSVFGQVDSKHS 426

Query: 418 MSREG--LGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
              EG  LGL +S+KL+++MNG  + ++    S  +I L FP
Sbjct: 427 RKYEGTGLGLPLSKKLVELMNGIFK-IKSEPNSGTVITLTFP 467



>pir|AD0149|AD0149 two component sensor kinase/response regulator
           protein RcsC  (EC 2.7.3.-) [imported] - Yersinia pestis
           (strain CO92)>gb:AE013898_301264 Yersinia pestis KIM
           section 298 of 415 of the complete
           genome.>gb:AJ414147_523048 Yersinia pestis strain CO92
           complete genome; segment 7/20.>gb:AE009952_931447
           Yersinia pestis KIM complete genome.
          Length = 957

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 8/158 (5%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EFS  E I  +    +    + ++ + C +  +   L + GD +R+QQV+S+ L  A+ F
Sbjct: 552 EFSTVEVITHITANYLPLVVKKRLGLYCFIEPDVPRL-IEGDPVRLQQVISNLLNNAIKF 610

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN--------YK 411
           T   +   ++ ++  R           +LEFR+     GI    I ++F+         +
Sbjct: 611 T---DTGCIILQVRVRD---------CYLEFRVRDTGVGIDSREINQLFDPFFQVGTGVQ 658

Query: 412 QSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIIL 525
           +     GLGL I +KL+ +M+G V+ + E    S   +
Sbjct: 659 RHFQGTGLGLAICEKLVNLMDGDVEVISELGMGSIFAI 696



>gb:BA000032_709670 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 873

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 37/142 (26%), Positives = 69/142 (48%), Gaps = 8/142 (5%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EF L   +++        + +  ++++ D+P+ A +  + GD  RI Q+L + +  AV F
Sbjct: 447 EFDLRSLVESCTALCAYQADKKNLKLLVDMPL-AMNTVVVGDKGRINQILLNLIGNAVKF 505

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSRE-- 429
           T   +E  VL ++  R  ++G        +F +T    GIPE+ +  + +  + +     
Sbjct: 506 T---DEGHVLLKV--RESELG-------FDFSVTDTGIGIPEDRLTHIMDKFEQVDTSAT 553

Query: 430 ------GLGLYISQKLIKIMNG 477
                 GLGL IS++LI + NG
Sbjct: 554 RRHEGTGLGLAISKRLISMYNG 575



>pir|E83443|E83443 probable sensor/response regulator hybrid PA1611
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004589_55847 Pseudomonas aeruginosa PAO1,
           section 150 of 529 of the complete
           genome.>gb:AE004091_969947 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 651

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 52/192 (27%), Positives = 90/192 (46%), Gaps = 11/192 (5%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIK--AVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
           E+ C  F+L E ++  A+V Q     R + +++     +E  ++ + GD  RI+Q+L + 
Sbjct: 333 ELECIPFNLLELVQGSALVFQHSAQQRGLALELQIQAGLE--NIEVCGDPTRIRQILVNL 390

Query: 235 LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
           L  A+ FT   EE ++   +    E       V+ L   +     GI  E ++ MF+  Q
Sbjct: 391 LGNALKFT---EEGAIHLSL----EWQALDHDVLWLTCAVHDSGIGISPERLEHMFDAFQ 443

Query: 415 ----SMSRE----GLGLYISQKLIKIMNGTVQ-YLREAERSSFIILLEFPASLRSDHQ*L 567
               S+SR     GLGL I++ L + M GT+Q   +E   S+F + +  P      H+  
Sbjct: 444 QADSSISRRYGGTGLGLAIARTLAERMGGTLQAESKEGSGSTFTLEIPLPFQQSPAHRQQ 503

Query: 568 QSSVCSPPAWGE 603
            +   +P A G+
Sbjct: 504 AAGDAAPVAAGQ 515



>gb:BX950851_839949 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 951

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 41/145 (28%), Positives = 68/145 (46%), Gaps = 8/145 (5%)
 Frame = +1

Query: 73  CEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVL 252
           CEF+  E I  + +  +    + ++ + C +      + LFGD +R+QQVLS+ L+ A+ 
Sbjct: 540 CEFAPHEVISHITSNYLPLVVKKRLTLYCFIAPNVP-VSLFGDPVRLQQVLSNLLSNAIK 598

Query: 253 FTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGI-PEE---LIQEMFNYKQSM 420
           FT   +   ++F +  R           +LEF +     GI P E   L    F     +
Sbjct: 599 FT---DTGCIIFEVGCRDG---------YLEFVVRDTGVGIQPREAVKLFDPFFQAGSGV 646

Query: 421 SRE----GLGLYISQKLIKIMNGTV 483
            R     GLGL I +KL+ +M+G +
Sbjct: 647 QRHFQGTGLGLAICEKLVNLMDGDI 671



>gb:BX571869_787906 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 11/17.
          Length = 938

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 38/154 (24%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EFS  E I  V++  +    +  + + C +       Y+  D +R+QQV+S+ L  A+ F
Sbjct: 542 EFSCQEVISHVISNYLPLVVKKPLTLYCYIEPGVPD-YICNDPVRLQQVISNLLNNAIKF 600

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF--------NYK 411
           T   +   V+  +   ++         +L  RI     GI ++ + ++F        N +
Sbjct: 601 T---DTGCVIIHVTVDKD---------YLYVRIKDTGVGISDKALIQLFDPFFQIMPNTE 648

Query: 412 QSMSREGLGLYISQKLIKIMNGTVQYLREAERSS 513
            S    GLGL I +KLI +M+G ++ + + +  S
Sbjct: 649 SSSQGTGLGLAICEKLINLMDGDIEVISQPQIGS 682



>gb:BA000031_708027 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 932

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 43/155 (27%), Positives = 69/155 (44%), Gaps = 10/155 (6%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSRE--IQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVL 252
           F   E+++ V+N     + E  +++ +  D  +      L GD LRIQQ+L++ +  ++ 
Sbjct: 364 FDFRESLEEVINLQATSAHEKGLEITLKVDPKIPPG---LVGDPLRIQQILTNLVGNSIK 420

Query: 253 FTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSM 420
           FT    E   +   +  R Q G     V L+F +     GI E    +L Q       S+
Sbjct: 421 FT----ERGNIDVSVEMRSQAGDS---VELQFMVRDTGIGISERQQAQLFQAFSQADASI 473

Query: 421 SRE----GLGLYISQKLIKIMNGTVQYLREAERSS 513
           SR     GLGL I+QKL+  M G +       + S
Sbjct: 474 SRRYGGTGLGLVITQKLVSQMGGEISLTSRLHQGS 508



>gb:AY280634_605693 Uncultured bacterium cosmid pbiov sequence.
          Length = 1248

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 10/109 (9%)
 Frame = +1

Query: 190  LFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIG--AKMHVVHLEFRITHP 363
            + GD LR++Q+L++ +  A+ FT   E    + R I    ++     +  + LEF +   
Sbjct: 788  IHGDPLRLRQILTNLVANAIKFTEHGEIVVDIRRAIGGAVELPKPGSLETMELEFMVRDT 847

Query: 364  APGIPEELIQEMFN----YKQSMSRE----GLGLYISQKLIKIMNGTVQ 486
              GIP E++  +F+        M+R     GLGL IS++L+++M G ++
Sbjct: 848  GIGIPAEVVPRLFSAFVQANGGMARRYGGTGLGLAISKQLVELMGGQIE 896



>gb:AE011887_277414 Xanthomonas axonopodis pv. citri str. 306, section
            265 of 469 of the complete genome.>gb:AE008923_919189
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 1364

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 45/178 (25%), Positives = 79/178 (44%), Gaps = 11/178 (6%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++ C  F L +    + +          V+++ + P+   S +L GD LRI QVL + + 
Sbjct: 711  DLECAPFDLNQLFDNIADLMRSSLSAKPVEMIVE-PLPRDSRWLLGDALRINQVLVNLVG 769

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNY 408
             A+ FT   E+  V   +++ R       +   L F +     GI +E    +       
Sbjct: 770  NAIKFT---EQGEV---VLSVRRFPSGDPNKFKLLFSVRDTGIGISKEKQSVIFSPFLQA 823

Query: 409  KQSMSR----EGLGLYISQKLIKIMNGTVQYLREAERSS---FIILLEFPASLRSDHQ 561
              S SR     GLGL IS++L+++M G ++      R S   F++ LE  A L++  +
Sbjct: 824  DTSTSRRYGGSGLGLTISRRLVELMGGELEVESVPGRGSEFYFVVTLEKSAPLQAQRE 881



>pir|AB2457|AB2457 two-component hybrid sensor and regulator all5210
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_686199 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1558

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 43/177 (24%), Positives = 75/177 (42%), Gaps = 11/177 (6%)
 Frame = +1

Query: 64   MNCCEFSLGEAIKAVVNQAMIPSREIQVQI---MCDLPVEASSLYLFGDNLRIQQVLSDF 234
            +N C   L   ++A +    + +    ++I   + D PV+     + GD  R+QQV+ + 
Sbjct: 1255 LNVCLVDLRNTVQAGLETVRLAAEAKSIEIHTILSDEPVQ-----VMGDGDRLQQVIWNL 1309

Query: 235  LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQ 414
            ++ AV FTP   E     R+  R EQ+G    +     ++     GI  E +  +F Y +
Sbjct: 1310 VSNAVKFTP--SEG----RVDVRLEQVGRDAQI-----QVIDTGKGITPEFLPYVFEYFR 1358

Query: 415  SMSRE--------GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSDHQ 561
                +        GLGL I   L+++  GTV      E       ++ P    +D+Q
Sbjct: 1359 QADAKTTRVFGGLGLGLAIVHHLVELHGGTVVAESAGEDQGATFTVKLPLHKSADYQ 1415



>gb:AF257496_1781358 Aspergillus fumigatus putative two-component
           histidine kinase Fos-1 mRNA, complete cds.
          Length = 708

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 13/158 (8%)
 Frame = +1

Query: 55  YTEMNCCEFSLGEAIKAVVNQAMIPSREIQ-----VQIMCDLPVEASSLYLFGDNLRIQQ 219
           Y++++   FSL   + +V N      R  +     V+I C +P     L L GD LR +Q
Sbjct: 386 YSKLSSGTFSLNTDVLSVENIVGAVVRNCKALNPAVEISCSMPPGFPKL-LRGDPLRYRQ 444

Query: 220 VLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEM 399
           V+ + +  A+ FT   E+  V        E+  A  +++  E  +T    G+PE+ I  +
Sbjct: 445 VIQNLVGNAMKFT---EKGHVKVTHRFAVEEHDANRYIITTE--VTDTGIGVPEDAINTL 499

Query: 400 FN----YKQSMSRE----GLGLYISQKLIKIMNGTVQY 489
           F     +  S ++     GLGL I + L ++M+G+V Y
Sbjct: 500 FTPFTRFADSATKRYQGTGLGLSICKSLAELMDGSVGY 537



>gb:BA000040_729017 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 862

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query: 196  GDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGI 375
            GD  R+ QVL + L  AV F+P  ++S+V   I ARR +     H V   F +T   PGI
Sbjct: 744  GDEKRVVQVLYNLLANAVGFSP--QDSTV--GISARRTE-----HSV--VFTVTDSGPGI 792

Query: 376  PEELIQEMFNYKQSMSR------EGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            P ++  ++FN+ +S S+       GLGL + +  +++  G V+      R + +++ +FP
Sbjct: 793  PADMKDKVFNWFESRSQGSRHRGAGLGLSLVRSFVELHGGKVRVDSIVGRGT-VVICDFP 851



>gb:AF042096_472357 Bradyrhizobium japonicum UbiE (ubiE) gene, partial
            cds; AarF (aarF), panthotenate metabolism flavoprotein
            (dfp), deoxyuridine-triphosphatase (dut), putative sensor
            protein (bdfA), GalF-like (galF), hypothetical protein
            genes, complete cds; putative helicase 2 gene, partial
            cds; and unknown genes.
          Length = 873

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 38/120 (31%), Positives = 64/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query: 196  GDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGI 375
            GD  R+ QVL + L  AV F+P  ++S+V   I ARR +     H V   F +T   PGI
Sbjct: 755  GDEKRVVQVLYNLLANAVGFSP--QDSTV--GISARRTE-----HSV--VFTVTDSGPGI 803

Query: 376  PEELIQEMFNYKQSMSR------EGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
            P ++  ++FN+ +S S+       GLGL + +  +++  G V+      R + +++ +FP
Sbjct: 804  PADMKDKVFNWFESRSQGSRHRGAGLGLSLVRSFVELHGGKVRVDSIVGRGT-VVICDFP 862



>gb:CR628337_115311 Legionella pneumophila str. Lens complete
           genome.
          Length = 676

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 8/112 (7%)
 Frame = +1

Query: 187 YLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPA 366
           Y+  D  +I +VL + L  A+ FTP   +  +  ++     ++  K   +HL+F+++   
Sbjct: 390 YIQSDRKKIHRVLLNLLGNAIKFTP---KGQITIQVACL--EVSGKN--IHLQFKVSDTG 442

Query: 367 PGIPEELIQEMF--------NYKQSMSREGLGLYISQKLIKIMNGTVQYLRE 498
            GIP  L +++F        +YK      GLGL+I+Q  + ++ G +  + E
Sbjct: 443 IGIPTSLQEKVFERFFRISPSYKGIYKGHGLGLHIAQSYVNLLGGHIALISE 494



>pir|S75636|S75636 sensory transduction histidine kinase slr1969 -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_688976
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 750

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 34/151 (22%), Positives = 66/151 (43%), Gaps = 8/151 (5%)
 Frame = +1

Query: 58  TEMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFL 237
           T +NC  FSL    + V++  +  + + Q+ +  D  +         D  R+ Q+L+  L
Sbjct: 451 TALNCQSFSLHTLAQTVIHSLLGVAIKQQINLELDYQINVGQDQFCADQERLDQILTQLL 510

Query: 238 TTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF----- 402
             A+ FTP   E +V+ RI     Q           F++     GI E+ +  +F     
Sbjct: 511 NNALKFTP--AEGTVILRIWKESNQ---------AIFQVEDTGIGINEQQLPVLFEAFKV 559

Query: 403 ---NYKQSMSREGLGLYISQKLIKIMNGTVQ 486
              +Y       G+GL ++++L+++  G ++
Sbjct: 560 AGDSYTSFYETGGVGLALTKQLVELHGGYIE 590



>gb:AF398464_507272 Marinomonas mediterranea protein kinase PpoS
           (ppoS) gene, complete cds.
          Length = 939

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 42/132 (31%), Positives = 64/132 (48%), Gaps = 9/132 (6%)
 Frame = +1

Query: 130 SREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRI-IARR 306
           S+E+ +    DL V     ++ GD +RI+QVL++ +  A+ FT    E SV   + I  +
Sbjct: 387 SKELDLIPEFDLDVPT---WVIGDPVRIRQVLTNLIGNAIKFT---HEGSVRTTVKILEK 440

Query: 307 EQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN----YKQSMSRE----GLGLYISQKLI 462
                K     L F+I     GIPE  +  +F        S +R+    GLGL I++KL+
Sbjct: 441 SNSSLK-----LSFQIIDTGVGIPENKLDNLFKPFSQVDTSTTRKFGGTGLGLVITKKLV 495

Query: 463 KIMNGTVQYLRE 498
           K M G V+   E
Sbjct: 496 KQMGGNVEVSSE 507



>gb:AE017314_439814 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 6 of 12 of the complete
            genome.>gb:AE017285_1072975 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 1039

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 9/150 (6%)
 Frame = +1

Query: 79   FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEAS-SLYLFGDNLRIQQVLSDFLTTAVLF 255
            F L  +I+ V  +  IPS  +Q  +   + ++A+    + GD  R+QQVL++ L  A  F
Sbjct: 732  FDLSRSIRQV-RELFIPSA-MQAGVSLHVHIDAAIPSRVVGDASRLQQVLTNLLGNAFKF 789

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF--------NYK 411
            T   E+ SV  R       +     V+   F +     GIP+E   ++F         +K
Sbjct: 790  T---EKGSVTLRAEHLSPVLANSCRVL---FSVEDTGCGIPDEKHGKLFTPFTQACEGFK 843

Query: 412  QSMSREGLGLYISQKLIKIMNGTVQYLREA 501
            +S    GLGL I +++I++M G + +  EA
Sbjct: 844  RSHQGAGLGLSICRRIIRVMGGHLAFESEA 873



>gb:CP000031_84202 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 739

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 44/153 (28%), Positives = 69/153 (45%), Gaps = 8/153 (5%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
           F L   I  V        R+  + ++ D  +   +L++ GD  R++QVL++ L  AV FT
Sbjct: 289 FDLERCIHEVAMLMQPIVRDKGLTLLVDYDLFLPTLFV-GDPGRVRQVLTNLLGNAVKFT 347

Query: 259 PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSRE--- 429
               +  +L R+    +    +   +H+    T    GIP E +  +F     +  E   
Sbjct: 348 T---KGHILIRVTGVPDPATGRC-AIHVAIEDT--GIGIPREKLAHIFGEFNQVENERNR 401

Query: 430 -----GLGLYISQKLIKIMNGTVQYLREAERSS 513
                GLGL ISQ+LI++M GTV    E  R S
Sbjct: 402 QFDGTGLGLAISQRLIQMMGGTVWVESEEGRGS 434



>pir|AF1829|AF1829 two-component hybrid sensor and regulator all0182
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681174 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 715

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 44/171 (25%), Positives = 77/171 (45%), Gaps = 16/171 (9%)
 Frame = +1

Query: 64  MNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTT 243
           +N  + +L   I A +    + +    +Q++ + P     +   GD+ R+QQV+ + L+ 
Sbjct: 405 INITKVNLVTVILAALETMRLAAESKLIQVLTNFPPNIGQV--MGDSARLQQVVWNLLSN 462

Query: 244 AVLFTPLFEESSVLFRIIARREQIGAKMHVV------HLEFRITHPAPGIPEELIQEMFN 405
           AV FTP                  G K+ V       + +  ++    GI  E +  +F+
Sbjct: 463 AVKFTP-----------------NGGKIEVTLDKMEGYAQIVVSDTGKGIQPEFLPYVFD 505

Query: 406 Y-KQSMSRE-------GLGLYISQKLIKIMNGTV--QYLREAERSSFIILL 528
           Y +Q+ S         GLGL I +K+++I  GTV  Q L E + +SF + L
Sbjct: 506 YFRQADSSSTRRFGGLGLGLAIVRKIVEIHGGTVTAQSLGEEQGASFTVRL 556



>gb:BA000045_741929 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1241

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 8/161 (4%)
 Frame = +1

Query: 85   LGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPL 264
            +G A++AV   A+  ++ I+++ +C     A +  +  D+ R+QQV+ + LT AV FTP 
Sbjct: 1086 VGAAVEAV--DAIGRAKSIRIETVC-----APAPPVMADSTRMQQVVWNLLTNAVKFTP- 1137

Query: 265  FEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY--------KQSM 420
              E     R+  R E   A + +      ++    GI  E + +MF+          ++ 
Sbjct: 1138 --EGG---RVGVRLEGTAAGVRLT-----VSDTGMGIAPEFLPKMFDRFAQGDGSRTRTQ 1187

Query: 421  SREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPAS 543
               GLGLY+ + LI++  GTV      E    +  +  PA+
Sbjct: 1188 GGLGLGLYLVRSLIELHGGTVDAHSAGEGRGSVFTVALPAA 1228



>gb:BA000045_740174 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 785

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 46/160 (28%), Positives = 69/160 (43%), Gaps = 6/160 (3%)
 Frame = +1

Query: 151 IMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMH 330
           I  D  +E     L GD  R+QQV+ + L  AV FTP    +    R+   R    A++ 
Sbjct: 504 IEVDTEIEPGVPLLMGDATRLQQVVWNLLANAVKFTP----NGGRVRVRLSRRGTAAEVA 559

Query: 331 VVHLEFRIT-HPAPGIPEELIQEMFNYKQSMSREGLGLYISQKLIKIMNGTVQYLR--EA 501
           V      I  H  P + E   Q   +  +S    GLGL I ++L+++ +GTV      E 
Sbjct: 560 VSDSGLGIAPHLLPHVFERFRQADSSSTRSHGGLGLGLAIVRQLVELHSGTVSAASPGEG 619

Query: 502 ERSSFIILLEFPAS---LRSDHQ*LQSSVCSPPAWGETAP 612
           + ++F + L F  +   L  DH        SP  W   +P
Sbjct: 620 QGATFTVRLPFDGARTLLAGDH--------SPGDWTRESP 651



>gb:AF497904_516623 Acinetobacter baumannii GacS-like sensor kinase
           protein (gacS) gene, complete cds.
          Length = 935

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 9/159 (5%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIKAVVNQAMIPSREIQVQI-MCDLPVEASSLYLFGDNLRIQQVLSDFL 237
           E+    F L EA+  V++  M+     Q  I M     +     + GD LR +Q+L++ +
Sbjct: 358 ELETAPFDLEEAVFDVMD--MLSPLAAQKHIAMAFYYADNIPQQVIGDALRFKQILTNLI 415

Query: 238 TTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIP----EELIQEMFN 405
           + A+ FTP   +  ++ R+    + IG  +    L F +     G+     ++L +    
Sbjct: 416 SNAIKFTP---DGEIIVRVRMEHDDIGQCL----LHFSVQDSGIGLSGTDRKKLFESFSQ 468

Query: 406 YKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERS 510
              S++R+    GLGL IS++L+ +M+G + +    ER+
Sbjct: 469 GDASVTRQFGGTGLGLAISKQLVHLMHGQIGFEDNQERA 507



>gb:AE017180_399563 Geobacter sulfurreducens PCA, complete genome.
          Length = 445

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 44/158 (27%), Positives = 69/158 (43%), Gaps = 9/158 (5%)
 Frame = +1

Query: 115 QAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRI 294
           QA     E+  Q+  D+P       L GD  R+QQV+ +    A+ FT    E +V  R+
Sbjct: 159 QAQRKGLELSWQVSPDVPSR-----LLGDQARVQQVIVNLAGNAIKFT---REGAVTIRV 210

Query: 295 IARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSRE--------GLGLYIS 450
               + + A   +  + F I     GIP + +  +F      S E        GLGL I+
Sbjct: 211 ERVPDPLTAS-SLAMIRFVIEDTGIGIPVDRLGGIFERYDRGSPETSKLFGGTGLGLAIA 269

Query: 451 QKLIKIMNGTVQY-LREAERSSFIILLEFPASLRSDHQ 561
           + LI+ M+G +     E   S FI+ + F  ++  D Q
Sbjct: 270 KGLIEAMDGDITVESYEGRGSRFIVTIPFCLTITGDRQ 307



>gb:AE016922_358464 Chromobacterium violaceum ATCC 12472 section 13 of
            16 of the complete genome.>gb:AE016825_1043618
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1229

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 42/155 (27%), Positives = 77/155 (49%), Gaps = 10/155 (6%)
 Frame = +1

Query: 79   FSLGEAIK--AVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVL 252
            FS+ + ++   V+  A +  ++++V  + D+  E    ++  D+LR+QQ+L +    A+ 
Sbjct: 578  FSIDKLLRDVGVIMSANVGDKDVEV--LFDIDPELPD-WISADSLRLQQILINLSGNAIK 634

Query: 253  FTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN----YKQSM 420
            FT   E   V+   +ARR++ G +     + F +     GI  E +Q +F      + S 
Sbjct: 635  FTERGEV--VIAARLARRDEAGLR-----IAFSVRDTGIGIAPEHLQRIFEGFSQAEAST 687

Query: 421  SRE----GLGLYISQKLIKIMNGTVQYLREAERSS 513
            +R     GLGL ISQ+L+ +M G +    E  + S
Sbjct: 688  ARRYGGSGLGLAISQRLVALMGGQLTVESEEGKGS 722



>gb:CR378673_96377 Photobacterium profundum SS9; segment 11/12.
          Length = 903

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           SL E ++ +   A     E+ +++   +P       L GD LRIQQV+++ +  AV FT 
Sbjct: 344 SLDEVMRLLAPSAHEKGLELTLKVDDRIPAG-----LIGDPLRIQQVVTNLIGNAVKFT- 397

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSMSRE 429
             E  ++   +    E   +K   + L+F +     GI E    +L Q       S+SR 
Sbjct: 398 --ERGNIDVSV----ELKASKDESIELQFTVRDTGIGISERQQAQLFQAFSQADASISRR 451

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G +       + S
Sbjct: 452 YGGTGLGLVITQKLVTQMGGEISLTSRLHQGS 483



>pir|D82696|D82696 hypothetical protein XF1330 [imported] - Xylella
            fastidiosa  (strain 9a5c)>gb:AE003965_48968 Xylella
            fastidiosa 9a5c, section 111 of 229 of the complete
            genome.>gb:AE003849_1116178 Xylella fastidiosa 9a5c,
            complete genome.
          Length = 1197

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 40/149 (26%), Positives = 64/149 (42%), Gaps = 14/149 (9%)
 Frame = +1

Query: 187  YLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPA 366
            Y+ GD  R+QQ+L + L  A  FT   E   V+ ++   +EQ       + +   +    
Sbjct: 915  YVHGDTDRLQQILLNLLINATKFT---EHGEVVLQVAPGQEQA-----CLGVRIDVADTG 966

Query: 367  PGIPEELIQEMFNYKQSMS---------REGLGLYISQKLIKIMNGTVQYLREAERSS-F 516
            PG+ EE  Q +F   + ++           GLGL I ++L  +M G +    E  + + F
Sbjct: 967  PGLSEEQCQRLFRRFEQVNGASTAARYGGSGLGLAICRELATVMEGEIHVDSELGKGTCF 1026

Query: 517  IILLEFPASLRSDH----Q*LQSSVCSPP 591
             +LL  P  L   H       + S CS P
Sbjct: 1027 RVLLPLPWVLAVQHAVAVMDAEPSPCSNP 1055



>pir|A83324|A83324 probable sensor/response regulator hybrid PA2583
            [imported] - Pseudomonas aeruginosa (strain
            PAO1)>gb:AE004686_56819 Pseudomonas aeruginosa PAO1,
            section 247 of 529 of the complete
            genome.>gb:AE004091_970919 Pseudomonas aeruginosa PAO1,
            complete genome.
          Length = 992

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 44/159 (27%), Positives = 69/159 (43%), Gaps = 9/159 (5%)
 Frame = +1

Query: 88   GEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLF 267
            GE I+ ++      +R+  + +  +L  +     L  D L  +QVL + L  A+ FT   
Sbjct: 685  GELIRGILPLVGGLTRQKNLSLALELDGDLEQWVLV-DPLHFKQVLFNLLGNAIKFT--- 740

Query: 268  EESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQ-------SMS 423
            E   V  R + RRE        +HL   ++    GI EE    +F  + Q         S
Sbjct: 741  ERGGVTVRAVGRREA-----ERLHLLLEVSDTGLGISEEDQARLFRPFSQVGSPALGQAS 795

Query: 424  REGLGLYISQKLIKIMNGTVQYLRE-AERSSFIILLEFP 537
              GLGLYIS++L+ +M G +    E    S F +  + P
Sbjct: 796  GSGLGLYISRRLVHLMGGQISLRSELGNGSCFSVEFDLP 834



>pir|B82075|B82075 sensor histidine kinase/response regulator VC2453
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004315_52825 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 223 of 251 of the
           complete chromosome.>gb:AE003852_1053599 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 927

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 10/155 (6%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSRE--IQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVL 252
           F   E ++ VVN     + E  +++ +  D  +      + GD LRIQQVL++ +  ++ 
Sbjct: 364 FEFQEVLEEVVNLQATSAHEKGLEITLKIDPKIPRG---VVGDPLRIQQVLTNLVGNSIK 420

Query: 253 FTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSM 420
           FT   E  ++   +    E    +  V+ L+F +     GI E    +L Q       S+
Sbjct: 421 FT---ERGNIDVSV----EMRALRDDVIDLQFMVRDTGIGISERQQAQLFQAFSQADASI 473

Query: 421 SRE----GLGLYISQKLIKIMNGTVQYLREAERSS 513
           SR     GLGL I+QKL+  M G +       + S
Sbjct: 474 SRRYGGTGLGLVITQKLVSHMGGEISLTSRLHQGS 508



>gb:BX936398_834956 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 939

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 45/157 (28%), Positives = 69/157 (43%), Gaps = 5/157 (3%)
 Frame = +1

Query: 85  LGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPL 264
           L +A+  + +QA+  S  +   I  D+P+E        D LR++Q+L + L  AV FTP 
Sbjct: 477 LDQAMLTIHSQALSKSLALSTFISADIPLELEL-----DTLRLRQILVNLLGNAVKFTP- 530

Query: 265 FEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQSMSRE---G 432
                        R Q+  +     L F +     GI  +  Q +F  + Q+   E   G
Sbjct: 531 -----------QGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQGTG 579

Query: 433 LGLYISQKLIKIMNGTVQYLRE-AERSSFIILLEFPA 540
           LGL I+  L K+M G +    E  + S F + L F A
Sbjct: 580 LGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNA 616



>gb:AY208923_597595 Xanthomonas campestris pv. campestris SucC
           (sucC), PilS (pilS), PilR (pilR), PilB (pilB), PilA2
           (pilA2), PilA1 (pilA1), PilC (pilC), PilD (pilD), and
           dephospho-CoA kinase genes, complete cds.
          Length = 611

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 3/129 (2%)
 Frame = +1

Query: 169 VEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEF 348
           +E +S++   D   + QVL+  +  A+ +  + +E + +   + RRE++ A         
Sbjct: 488 IEGASVHALIDPKHLHQVLTALVHNALKYGRILDEPARVKLRVERRERMVA--------I 539

Query: 349 RITHPAPGIPEELIQEMFN--YKQSMSREGLGLYISQKLIKIMNGTVQYLR-EAERSSFI 519
            +    PGIPE +  ++F   Y  S    GLGLYI+Q+L +     + Y+      + F 
Sbjct: 540 DVIDRGPGIPETVAAQLFRPFYTTSEHGTGLGLYIAQELCRANQAQLDYVSVPGGGACFR 599

Query: 520 ILLEFPASL 546
           ILL+ P  L
Sbjct: 600 ILLQGPNGL 608



>gb:AE017340_457487 Idiomarina loihiensis L2TR, complete genome.
          Length = 866

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 41/169 (24%), Positives = 76/169 (44%), Gaps = 9/169 (5%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
           F L + + ++ +     + +  ++ + +LP    +  L GD LR+ QVL + ++ A+ FT
Sbjct: 281 FDLQDVLTSLADMFAYRAYDKDLEFIINLPANIPTR-LIGDPLRLNQVLVNLISNAIKFT 339

Query: 259 PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF--------NYKQ 414
              E +  +  + + R+        V L   +T    G+ EE    +F        +  +
Sbjct: 340 EDGEINVAVNLLDSSRDN-------VLLRISVTDTGIGMDEEQRANLFKAFTQADTSTTR 392

Query: 415 SMSREGLGLYISQKLIKIMNGTVQYLREA-ERSSFIILLEFPASLRSDH 558
                GLGL IS++LI +M G +     A + S+F I +E P     D+
Sbjct: 393 KYGGTGLGLAISRRLILLMGGDIGVTSAAGQGSTFYIEVELPLQTEQDN 441



>gb:AE017180_398757 Geobacter sulfurreducens PCA, complete genome.
          Length = 469

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 10/166 (6%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIKAVVNQAMI--PSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDF 234
           ++   +  L + +  +V Q+ +  P + +++  +   PV      + GD LR++QV  + 
Sbjct: 313 KLELADLDLSDLLAELVQQSRLIAPDKSLRIAFVGQEPVT-----ILGDWLRLRQVFMNL 367

Query: 235 LTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN--Y 408
           L  AV +TP   E SV+        ++            I    PGIP E +  +F   Y
Sbjct: 368 LDNAVKYTPADGEISVVVDTTGDSARVA-----------IIDSGPGIPPEDLPHIFERFY 416

Query: 409 KQSMSRE------GLGLYISQKLIKIMNGTVQYLREAERSSFIILL 528
           +   +R       GLGL + +  ++   G ++ + EA + S   +L
Sbjct: 417 RVDKARNRADGGCGLGLSLVKTFVEAHGGRIEVVSEAGKGSIFTVL 462



>gb:AE015830_318315 Shewanella oneidensis MR-1 section 379 of 457 of
            the complete genome.>gb:AE014299_953912 Shewanella
            oneidensis MR-1 complete genome.
          Length = 1689

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 46/163 (28%), Positives = 76/163 (46%), Gaps = 9/163 (5%)
 Frame = +1

Query: 76   EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
            EF L E +  + N       E  ++++ D+  +    Y  GD  R+ Q+L ++   AV F
Sbjct: 1028 EFDLDEVLTQLNNVIGFKVEENSMRLIYDIATDCPR-YFIGDPQRLGQILLNYCNNAVKF 1086

Query: 256  TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF-NYKQ---SMS 423
            +P  + S +L    A  ++ GA      L F +     GIP +    +F +++Q   S S
Sbjct: 1087 SP--KGSDILLSCQAELDKQGAT-----LTFCVADDGIGIPLDKQARLFHSFEQGDTSTS 1139

Query: 424  RE----GLGLYISQKLIKIMNGTVQYLRE-AERSSFIILLEFP 537
            R+    GLGL I ++L ++M G V    E  + S F + L  P
Sbjct: 1140 RKYGGTGLGLAICKRLSELMQGEVWCESELGQGSRFYLRLHLP 1182



>gb:AE013598_296498 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 1402

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 47/168 (27%), Positives = 73/168 (43%), Gaps = 11/168 (6%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++ C  F L +    +  + M  S   +   M   P+   S +L GD LRI QVL + + 
Sbjct: 749  DLECAPFDLNQLFDNIA-ELMRSSLSAKPVEMIVEPLPRDSRWLLGDALRINQVLVNLVG 807

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEE----LIQEMFNY 408
             A+ FT   E+  V   +++ R       +   L F +     GI +E    +       
Sbjct: 808  NAIKFT---EQGEV---VLSVRRFPSGDPNKFKLLFSVRDTGIGISKEKQSLIFSPFLQA 861

Query: 409  KQSMSR----EGLGLYISQKLIKIMNGTVQYLREAERSS---FIILLE 531
              S SR     GLGL IS++LI++M G ++      R S   F+I LE
Sbjct: 862  DTSTSRRYGGSGLGLTISRRLIELMGGELEVESVPGRGSEFYFVITLE 909



>gb:AE012425_282322 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 333 of 460 of the complete
           genome.>gb:AE008922_915604 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 536

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 3/129 (2%)
 Frame = +1

Query: 169 VEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEF 348
           +E +S++   D   + QVL+  +  A+ +  + +E + +   + RRE++ A         
Sbjct: 413 IEGASVHALIDPKHLHQVLTALVHNALKYGRILDEPARVKLRVERRERMVA--------I 464

Query: 349 RITHPAPGIPEELIQEMFN--YKQSMSREGLGLYISQKLIKIMNGTVQYLR-EAERSSFI 519
            +    PGIPE +  ++F   Y  S    GLGLYI+Q+L +     + Y+      + F 
Sbjct: 465 DVIDRGPGIPETVAAQLFRPFYTTSEHGTGLGLYIAQELCRANQAQLDYVSVPGGGACFR 524

Query: 520 ILLEFPASL 546
           ILL+ P  L
Sbjct: 525 ILLQGPNGL 533



>gb:BX572597_801171 Rhodopseudomonas palustris CGA009 complete
           genome; segment 5/16.
          Length = 903

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 10/148 (6%)
 Frame = +1

Query: 172 EASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFR 351
           +A+   L GD  R++QVL + +  AV FT       ++         IG   H+V L   
Sbjct: 503 QATPPVLIGDAGRLRQVLLNLMNNAVKFTTAGSVELIV-------SCIGRVDHLVRLRIS 555

Query: 352 ITHPAPGIPEELIQEMFNY----KQSMSRE----GLGLYISQKLIKIMNGTVQY-LREAE 504
           +     GI  E  + +F       +++SR+    GLGL ISQ++++ M+G ++   +   
Sbjct: 556 VADTGIGISPEAQKGLFKRFSQADETISRKFGGTGLGLAISQRIVQAMHGELKIDSQPGV 615

Query: 505 RSSFIILLEFPASLRSDHQ*LQSSV-CS 585
            S+F   +E P + R D + L + V CS
Sbjct: 616 GSTFYFEVELPVAERLDIERLDAQVHCS 643



>gb:BA000040_735036 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 907

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 35/166 (21%), Positives = 76/166 (45%), Gaps = 9/166 (5%)
 Frame = +1

Query: 67   NCCEFSLGEAIKAVVNQA--MIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            N     L E + + + +A  ++ + ++++ +  DLP+      LF      +QVL + L 
Sbjct: 747  NTALHDLSEIVGSALRRAAKILTAHKVELVLAADLPMLQLDAVLF------EQVLFNLLD 800

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
             A  ++P   E+++  +    R+Q+           +I     GIP + ++ +F+    +
Sbjct: 801  NAAKYSPA--ETTISIKSQRERDQV---------VLQIADEGSGIPPDEVESVFDKFYRV 849

Query: 421  SR-------EGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
             +        GLGL IS+  ++ M+GT+     ++RS  ++ +  P
Sbjct: 850  QKGDHVRPGTGLGLAISRGFVEAMHGTISAANRSDRSGAVLTIRLP 895



>gb:AY456049_1607134 Gibberella moniliformis putative histidine kinase
            HHK2p (HHK2) gene, complete cds.
          Length = 2072

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 54/191 (28%), Positives = 84/191 (43%), Gaps = 14/191 (7%)
 Frame = +1

Query: 82   SLGEAIKAVVNQAMIPSR-EIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
            S+ E +  +V+   I  R E+   +  D+P      ++ GD +RI+QVL +    A+ FT
Sbjct: 1486 SIIEDVNELVSTMAIAKRLELNYLVEADVPA-----WVKGDKVRIRQVLLNVTGNAIKFT 1540

Query: 259  PLFEESSVLFRIIARREQIGAKMHV----VHLEFRITHPAPGIPEELIQEMFN-YKQ--- 414
                E  V  R    R  +    HV    + LEF +T    G  +E  + +F  + Q   
Sbjct: 1541 ---SEGEVFSRC---RVYVAEGSHVDENEIMLEFSVTDTGRGFSKEEAELIFKPFSQIDG 1594

Query: 415  SMSRE----GLGLYISQKLIKIMNGTVQ-YLREAERSSFIILLEFPASLRSDHQ*LQSSV 579
            S +R+    GLGL IS++L ++  G++       + S+F     F      DH  L    
Sbjct: 1595 SSTRQHGGSGLGLVISRQLAELHGGSMTGRATLGKGSTFTFTARFGLPTADDHPNLPD-- 1652

Query: 580  CSPPAWGETAP 612
             SPPA G   P
Sbjct: 1653 -SPPATGAFTP 1662



>gb:AE013496_292848 Methanosarcina mazei strain Goe1, section 278 of
           379 of the complete genome.>gb:AE008384_966957
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 702

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 35/149 (23%), Positives = 71/149 (47%), Gaps = 8/149 (5%)
 Frame = +1

Query: 61  EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
           E+   EFS+ E+I   ++ A+   + ++  I  +   ++  L +F D  + +Q++   L 
Sbjct: 529 ELTLQEFSVNESINKSISTAL--PQILKKNIKLNYNSDSDPLCIFADENKFRQIMESLLN 586

Query: 241 TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF----NY 408
            AV FTP  E+  +          I +K     +  ++     GIPE+ + ++F      
Sbjct: 587 NAVKFTP--EDGLI---------DISSKQEGGIVTIKVKDTGIGIPEDSLDKIFKPFIQL 635

Query: 409 KQSMSR----EGLGLYISQKLIKIMNGTV 483
           + S+SR     GLGL +++K +++  G +
Sbjct: 636 ESSLSRTFEGTGLGLTLAKKYVEMHGGNI 664



>pir|AD2580|AD2580 two component sensor kinase Atu0027 [imported] -
            Agrobacterium tumefaciens (strain C58,
            Dupont)>pir|C97362|C97362 protein sensor protein
            (AF042096) [imported] - Agrobacterium tumefaciens (strain
            C58, Cereon)>gb:AE007945_231792 Agrobacterium tumefaciens
            str. C58 circular chromosome, section 3 of 254 of the
            complete sequence.>gb:AE008977_247085 Agrobacterium
            tumefaciens str. C58 circular chromosome, section 3 of
            256 of the complete sequence.>gb:AE007869_1081461
            Agrobacterium tumefaciens str. C58 circular chromosome,
            complete sequence.>gb:AE008688_1084928 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.
          Length = 881

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 6/147 (4%)
 Frame = +1

Query: 61   EMNCCEFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLT 240
            ++N  +  L E +  V  Q     +E  + +    P    SL    D+ R++Q+L   LT
Sbjct: 720  QLNYSDNDLNELLDDVSVQIADRLQESGISLEIVAPAHLGSLV--ADHQRLKQILIKLLT 777

Query: 241  TAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSM 420
             A+ F P  E SSV         Q+  +       F +    PGIPE++++ +F+   + 
Sbjct: 778  NAINFAP--EGSSV---------QLSCQRSEGDFVFSVADKGPGIPEDMLKSVFDRFATR 826

Query: 421  SR------EGLGLYISQKLIKIMNGTV 483
                     GLGL I +  + + +GTV
Sbjct: 827  GNGGRRTGAGLGLSIVESFVSLHHGTV 853



>gb:BX842647_823508 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 2/11.
          Length = 766

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 37/142 (26%), Positives = 72/142 (50%), Gaps = 8/142 (5%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           EF L + ++ V  QA+I +  ++  +           ++ GD+LR++QVL + L  AV F
Sbjct: 449 EFLLSDLVREV--QALISTSVLRKNLQFTFHPPEHDRWIVGDSLRLKQVLMNLLGNAVKF 506

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN----YKQSMS 423
           T   +  ++   +   +   G++     + F +     GI +E ++++F+       S++
Sbjct: 507 T---DRGAIELTV---QPYPGSEPGKETIFFEVKDTGIGIAKENLKKVFDEFGQEDSSVT 560

Query: 424 RE----GLGLYISQKLIKIMNG 477
           R     GLGL ISQK++++M G
Sbjct: 561 RRFGGTGLGLSISQKIVQLMGG 582



>gb:AE016827_343359 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 614

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 42/150 (28%), Positives = 68/150 (45%), Gaps = 11/150 (7%)
 Frame = +1

Query: 109 VNQAMIPSREIQ--VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSV 282
           V Q M   + ++  +Q+  DLP      +L  D  R+ QVL + ++ AV FT   ++ +V
Sbjct: 200 VAQLMAEQKHLKFILQVDKDLPN-----WLLLDYTRLSQVLWNLISNAVKFT---DKGTV 251

Query: 283 LFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNY---------KQSMSREGL 435
             +I    E   A        F I+   PGIPE  + ++F           K   +  G+
Sbjct: 252 TLKISRLSENRYA--------FAISDTGPGIPENELNKIFTMYYQVKANFNKHKAAGSGI 303

Query: 436 GLYISQKLIKIMNGTVQYLREAERSSFIIL 525
           GL IS+ + ++MNG +    E  + S  IL
Sbjct: 304 GLAISKSIARLMNGDLVVESEIGKGSTFIL 333



>gb:CR543861_104867 Acinetobacter sp. ADP1 complete genome.
          Length = 932

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 29/115 (25%), Positives = 61/115 (53%), Gaps = 8/115 (6%)
 Frame = +1

Query: 190 LFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAP 369
           + GD LR++Q+L++ ++ A+ FTP   +  ++ R+    + I   +    L F +     
Sbjct: 398 VIGDALRVKQILTNLISNAIKFTP---DGEIIVRVRMEHDDIDQCL----LHFSVQDSGI 450

Query: 370 GIP----EELIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERS 510
           G+     ++L +       S++R+    GLGL IS++L+++M+G + +    ER+
Sbjct: 451 GLSGTDRKKLFESFSQGDASVTRQFGGTGLGLAISKQLVQLMHGHIGFEDNQERA 505



>pir|AE2469|AE2469 two-component hybrid sensor and regulator all5309
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_686298 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 935

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 10/131 (7%)
 Frame = +1

Query: 199 DNLRIQQVLSDFLTTAVLFTPLFEESSVLFRI--IARREQIGAKMHVVHLEFRITHPAPG 372
           D  R++QVL + L  AV FT   +   V F++  +  ++Q   +  V  + F+I     G
Sbjct: 578 DEKRLRQVLINLLGNAVKFT---DSGGVTFKVELLDTQDQDNQQSSVAKIRFQIEDTGVG 634

Query: 373 IPEELIQEMF-------NYKQSMSREGLGLYISQKLIKIMNGTVQ-YLREAERSSFIILL 528
           +  E ++++F       + ++     GLGL ISQ++ ++M   +Q   R  E S F + +
Sbjct: 635 MSPEQLEKIFLAFEQVGDCRRQSEGTGLGLAISQRIAELMGSQIQVQSRLGEGSIFWLDV 694

Query: 529 EFPASLRSDHQ 561
             P  +  D Q
Sbjct: 695 TLPVPISHDWQ 705



>gb:AE017319_441301 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 11 of 12 of the complete
            genome.>gb:AE017285_1074462 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 1223

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 12/143 (8%)
 Frame = +1

Query: 91   EAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFE 270
            +A+  +  QA      +++ +   LP     L L GD LR++Q+L + +  AV FTP   
Sbjct: 929  DALAPLAMQAERKGLALELHMQNGLP-----LTLRGDPLRLRQILVNLVGNAVKFTP--- 980

Query: 271  ESSVLFRIIARREQIGAKMHVVH----LEFRITHPAPGIPEELIQEMF--------NYKQ 414
            + +V          +     V H    L F I    PGIP E +  +F        +Y +
Sbjct: 981  QGTV-------HVDVSTGDGVTHDRECLVFTIEDTGPGIPHEKLAHIFESFAQADGSYSR 1033

Query: 415  SMSREGLGLYISQKLIKIMNGTV 483
              +  GLGL IS+ L+++  G +
Sbjct: 1034 QHTGSGLGLAISRHLVELQGGDI 1056



>gb:AE016933_361168 Bacteroides thetaiotaomicron VPI-5482, section 8
           of 21 of the complete genome.>gb:AE015928_987656
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 616

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 4/139 (2%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
           F+  +AI    N     ++  Q Q         +SL L+ D+ R+QQ+L + L  A  FT
Sbjct: 460 FTYCDAIAICNNVIDTVNKVKQTQAELRFNTSLASLKLYTDDSRLQQLLINLLINATKFT 519

Query: 259 PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSR---- 426
           P   + S+   +    E+           F +T    GIP E    +FN  + ++     
Sbjct: 520 P---QGSITLEVRQESEEFAL--------FSVTDTGCGIPLEKQSSIFNRFEKLNEGAQG 568

Query: 427 EGLGLYISQKLIKIMNGTV 483
            GLGL I Q +I+ + G++
Sbjct: 569 TGLGLSICQLIIERIGGSI 587



>gb:AE012287_281101 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 195 of 460 of the complete
           genome.>gb:AE008922_914383 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 726

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 12/169 (7%)
 Frame = +1

Query: 76  EFSLGEAIKAV--VNQAMIPSREIQ--VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTT 243
           +FSL E I +V  + Q     R ++   Q+  D+P       L GD   ++QVL + +  
Sbjct: 261 DFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPD-----LLKGDTAHLRQVLLNLVGN 315

Query: 244 AVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQS- 417
           AV FT   E   VL R+       G+    V L F +     G+P ++   +F  ++Q+ 
Sbjct: 316 AVKFT---EHGHVLLRV---TRVSGSAEDAVRLRFDVEDTGIGVPMDMRPRLFEAFEQAD 369

Query: 418 --MSRE----GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
             +SR     GLG  I++ L++ M G++ + +E + S  +   E P ++
Sbjct: 370 VGLSRRYEGTGLGTTIAKGLVEAMGGSIGF-KENQPSGSVFWFELPMAI 417



>gb:XCA251547_210727 Xanthomonas campestris regulatory operon
           (rpfGHC genes).
          Length = 726

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 12/169 (7%)
 Frame = +1

Query: 76  EFSLGEAIKAV--VNQAMIPSREIQ--VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTT 243
           +FSL E I +V  + Q     R ++   Q+  D+P       L GD   ++QVL + +  
Sbjct: 261 DFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPD-----LLKGDTAHLRQVLLNLVGN 315

Query: 244 AVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQS- 417
           AV FT   E   VL R+       G+    V L F +     G+P ++   +F  ++Q+ 
Sbjct: 316 AVKFT---EHGHVLLRV---TRVSGSAEDAVRLRFDVEDTGIGVPMDMRPRLFEAFEQAD 369

Query: 418 --MSRE----GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
             +SR     GLG  I++ L++ M G++ + +E + S  +   E P ++
Sbjct: 370 VGLSRRYEGTGLGTTIAKGLVEAMGGSIGF-KENQPSGSVFWFELPMAI 417



>gb:CP000030_83344 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 468

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 36/162 (22%), Positives = 79/162 (48%), Gaps = 8/162 (4%)
 Frame = +1

Query: 76  EFSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLF 255
           +F LG+ + +     +  +++ +V++  ++P E   + +  D  R++QV+ + L+ +V F
Sbjct: 309 KFDLGKIVDSSFTMVLPRAKDAKVELKKEMPEEP--IVMLADPKRMKQVIINVLSNSVKF 366

Query: 256 TPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN--------YK 411
           TP   E  ++        ++ A++    L   I+    GI ++ + ++ +        + 
Sbjct: 367 TP---EGGLV--------KLCAEIRGEQLIVEISDTGIGIAQQDLYKVMSVFGQADSTHS 415

Query: 412 QSMSREGLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFP 537
           +     GLGL +S+KL+++M GT     E    + I+ L FP
Sbjct: 416 RKYEGTGLGLPLSKKLVELMQGTFSIKSEPNLGT-IVTLTFP 456



>pir|S16003|S16003 rpfC protein - Xanthomonas campestris
          Length = 677

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 12/169 (7%)
 Frame = +1

Query: 76  EFSLGEAIKAV--VNQAMIPSREIQ--VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTT 243
           +FSL E I +V  + Q     R ++   Q+  D+P       L GD   ++QVL + +  
Sbjct: 212 DFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPD-----LLKGDTAHLRQVLLNLVGN 266

Query: 244 AVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQS- 417
           AV FT   E   VL R+       G+    V L F +     G+P ++   +F  ++Q+ 
Sbjct: 267 AVKFT---EHGHVLLRV---TRVSGSAEDAVRLRFDVEDTGIGVPMDMRPRLFEAFEQAD 320

Query: 418 --MSRE----GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
             +SR     GLG  I++ L++ M G++ + +E + S  +   E P ++
Sbjct: 321 VGLSRRYEGTGLGTTIAKGLVEAMGGSIGF-KENQPSGSVFWFELPMAI 368



>pir|AH2036|AH2036 two-component hybrid sensor and regulator all1846
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_682835 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 680

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 10/106 (9%)
 Frame = +1

Query: 196 GDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKM--HVVHLEFRITHPAP 369
           GD  R+QQ++ + LT A+ FTP  +E  V  R+    E I  ++   + H + ++     
Sbjct: 405 GDFARLQQIVWNLLTNAIKFTP--KEGQVEIRL----EGINGELSDDLTHAQIQVIDTGV 458

Query: 370 GIPEELIQEMF-NYKQSMSRE-------GLGLYISQKLIKIMNGTV 483
           GI  E + ++F  ++Q+ S         GLGL I + L+++ NGT+
Sbjct: 459 GIASEFLPKVFERFRQADSTTTRSHNGLGLGLAIVRHLVELHNGTI 504



>pir|E87698|E87698 sensor histidine kinase/response regulator
           [imported] - Caulobacter crescentus>gb:AE006021_214748
           Caulobacter crescentus CB15 section 347 of 359 of the
           complete genome.>gb:AE005673_924647 Caulobacter
           crescentus CB15 complete genome.
          Length = 595

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = +1

Query: 187 YLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPA 366
           +  GD +R++QVL++ L+ A  FT      S    +  R E +G +   V L   +    
Sbjct: 325 WTLGDAMRLKQVLNNLLSNAAKFT-----RSGGVSVTLRAEIVGDQ---VRLVVDVVDTG 376

Query: 367 PGIPEELIQEMF----NYKQSMSR----EGLGLYISQKLIKIMNG 477
           PGIPE  +  +F       +S++R     GLGL IS++L ++M G
Sbjct: 377 PGIPEAALPRLFTPFDQLNESVARLHGGSGLGLAISRELARLMGG 421



>sp|P49246|RPFC_XANCP Sensory/regulatory protein rpfC (EC 2.7.3.-).
          Length = 677

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 12/169 (7%)
 Frame = +1

Query: 76  EFSLGEAIKAV--VNQAMIPSREIQ--VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTT 243
           +FSL E I +V  + Q     R ++   Q+  D+P       L GD   ++QVL + +  
Sbjct: 212 DFSLREMIGSVNLILQPQARGRRLEYGTQVADDVPD-----LLKGDTAHLRQVLLNLVGN 266

Query: 244 AVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQS- 417
           AV FT   E   VL R+       G+    V L F +     G+P ++   +F  ++Q+ 
Sbjct: 267 AVKFT---EHGHVLLRV---TRVSGSAEDAVRLRFDVEDTGIGVPMDMRPRLFEAFEQAD 320

Query: 418 --MSRE----GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASL 546
             +SR     GLG  I++ L++ M G++ + +E + S  +   E P ++
Sbjct: 321 VGLSRRYEGTGLGTTIAKGLVEAMGGSIGF-KENQPSGSVFWFELPMAI 368



>gb:BA000045_742824 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1296

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 45/165 (27%), Positives = 69/165 (41%), Gaps = 8/165 (4%)
 Frame = +1

Query: 91   EAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFE 270
            EA++ +  Q        QVQ+   L   A    L  D  R+QQV+ + LT AV FTP   
Sbjct: 1150 EAVRGLAEQK-------QVQLFEQLRTTAP---LSADPTRLQQVVWNLLTNAVKFTPAGG 1199

Query: 271  ESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMF-NYKQSMSRE------ 429
            +  V       R + G  M        I+    GIP E +  +F  ++Q+ ++       
Sbjct: 1200 QVQV-------RLESGGGM----ARLTISDTGVGIPAEFLPHLFERFRQADTKSTREQKG 1248

Query: 430  -GLGLYISQKLIKIMNGTVQYLREAERSSFIILLEFPASLRSDHQ 561
             GLGL+I + +++   GTVQ   E E       +  P    +  Q
Sbjct: 1249 LGLGLFIVRHIVEAHGGTVQAESEGEGKGAAFTVVLPLGGEAQRQ 1293



>gb:BA000032_709760 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 858

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 38/123 (30%), Positives = 66/123 (53%), Gaps = 10/123 (8%)
 Frame = +1

Query: 190 LFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQI-GAKMHVVHLEFRITHPA 366
           +F D +R+ Q+L + ++ AV FTP     S   R+ A  EQ  GA   V+ +E  I+   
Sbjct: 591 IFTDQVRLNQILFNLVSNAVKFTP-----SGCVRLHAELEQFYGADNSVLVVE--ISDTG 643

Query: 367 PGIPEELIQEMF----NYKQSMSRE----GLGLYISQKLIKIMNGTVQY-LREAERSSFI 519
            GI  + + EMF      + + +RE    GLGL I + L+ +++G VQ   ++ + ++F+
Sbjct: 644 IGIESDKLDEMFEPFVQEEATTTREYGGSGLGLTIVKNLVDMLDGDVQVRSQKGQGTTFV 703

Query: 520 ILL 528
           + L
Sbjct: 704 VTL 706



>gb:BA000030_700083 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 478

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 8/116 (6%)
 Frame = +1

Query: 199 DNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIP 378
           D LRI+QVL + LT A + TP   E SV   + +    +G           +    PG+P
Sbjct: 366 DPLRIRQVLDNLLTNAAVHTPAGTEVSVEVSVSSGTAWVG-----------VADSGPGVP 414

Query: 379 ----EELIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTVQYLREAERSSFII 522
               E +    +   ++ SR+    GLGL +++ L++   GTV    E   + F +
Sbjct: 415 AADRERVFDRFYRVDKARSRDRGGSGLGLAVARSLVRAHGGTVALTGEPGATVFTL 470



>gb:AE016936_361908 Bacteroides thetaiotaomicron VPI-5482, section
           11 of 21 of the complete genome.>gb:AE015928_988396
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 391

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 4/117 (3%)
 Frame = +1

Query: 145 VQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPLFEESSVLFRIIARREQIGAK 324
           +QI+ +  + + S+    D  R+ QVLS+F T A+ FT   +E ++          IG +
Sbjct: 264 IQIIAEPSLPSCSIET--DRNRVAQVLSNFTTNAIKFT---QEGTI---------SIGYE 309

Query: 325 MHVVHLEFRITHPAPGIPEELIQEMFNYKQSMSRE----GLGLYISQKLIKIMNGTV 483
                L F +T    GIP + + E+F     ++++    GLGL IS+ ++  + G +
Sbjct: 310 ARDTELYFYVTDTGAGIPADKLPEVFGRFVKLNKDKKGTGLGLSISKTIVNKLEGQI 366



>gb:AE016802_336250 Vibrio vulnificus CMCP6 chromosome I section 6
           of 11 of the complete sequence.>gb:AE016795_1045974
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 928

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 45/152 (29%), Positives = 65/152 (42%), Gaps = 8/152 (5%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           SL E I      A     EI ++I   +P       + GD LRIQQVL++ +  ++ FT 
Sbjct: 369 SLEEVISLQATSAHEKGLEITLKIDPRIPEG-----VVGDPLRIQQVLTNLVGNSIKFT- 422

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPE----ELIQEMFNYKQSMSRE 429
              E   +   +  R Q G     + L+F +     GI E    +L Q       S+SR 
Sbjct: 423 ---ERGNIDVSVEMRAQSGDS---IDLQFMVKDTGIGISERQQAQLFQAFSQADASISRR 476

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS 513
               GLGL I+QKL+  M G +       + S
Sbjct: 477 YGGTGLGLVITQKLVSQMGGEISLTSRLHQGS 508



>gb:AE013653_298844 Yersinia pestis KIM section 53 of 415 of the
           complete genome.>gb:AE017128_386257 Yersinia pestis
           biovar Medievalis str. 91001 section 2 of 16 of the
           complete genome.>gb:AE009952_929027 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142823 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 929

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 44/157 (28%), Positives = 69/157 (43%), Gaps = 5/157 (3%)
 Frame = +1

Query: 85  LGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPL 264
           L +A+  + +QA+  S  +   I  ++P+E        D LR++Q+L + L  AV FTP 
Sbjct: 467 LDQAMLTIHSQALSKSLALSTFISANIPLELEL-----DTLRLRQILVNLLGNAVKFTP- 520

Query: 265 FEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQSMSRE---G 432
                        R Q+  +     L F +     GI  +  Q +F  + Q+   E   G
Sbjct: 521 -----------QGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQGTG 569

Query: 433 LGLYISQKLIKIMNGTVQYLRE-AERSSFIILLEFPA 540
           LGL I+  L K+M G +    E  + S F + L F A
Sbjct: 570 LGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNA 606



>pir|A87580|A87580 sensory box histidine kinase/response regulator
           [imported] - Caulobacter crescentus>gb:AE005934_213800
           Caulobacter crescentus CB15 section 260 of 359 of the
           complete genome.>gb:AE005673_923699 Caulobacter
           crescentus CB15 complete genome.
          Length = 690

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 39/142 (27%), Positives = 69/142 (48%), Gaps = 7/142 (4%)
 Frame = +1

Query: 79  FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
           F LG  +  +++   + ++E  V +  +    A+  +L GD++RI QVLS+  + AV FT
Sbjct: 394 FDLGALVDGLLDVTRLRAKEKGVAVRLERSPTAAGGFL-GDSVRIGQVLSNLFSNAVKFT 452

Query: 259 PLFEESSVLFRIIARREQIG--AKMHVVHLEFRITHPAPGIPEELIQEMFNYKQS----- 417
              ++  V+ R+       G  A++ V   +  +   A     E+I + FN   S     
Sbjct: 453 ---DQGEVIVRVDVEEAGNGQAARLFVEVEDTGVGFDAE--KAEMIFQRFNQADSTITRR 507

Query: 418 MSREGLGLYISQKLIKIMNGTV 483
               GLGL IS+ L+++M G +
Sbjct: 508 FGGSGLGLSISKTLVEMMGGEI 529



>pir|AB0032|AB0032 two-component sensor/regulator YPO0256 [imported]
           - Yersinia pestis (strain CO92)>gb:AJ414141_522110
           Yersinia pestis strain CO92 complete genome; segment
           1/20.
          Length = 939

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 44/157 (28%), Positives = 69/157 (43%), Gaps = 5/157 (3%)
 Frame = +1

Query: 85  LGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTPL 264
           L +A+  + +QA+  S  +   I  ++P+E        D LR++Q+L + L  AV FTP 
Sbjct: 477 LDQAMLTIHSQALSKSLALSTFISANIPLELEL-----DTLRLRQILVNLLGNAVKFTP- 530

Query: 265 FEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQSMSRE---G 432
                        R Q+  +     L F +     GI  +  Q +F  + Q+   E   G
Sbjct: 531 -----------QGRIQLRVRRQNQTLCFTVEDTGCGIDVQHQQTIFQPFMQTSDHEQGTG 579

Query: 433 LGLYISQKLIKIMNGTVQYLRE-AERSSFIILLEFPA 540
           LGL I+  L K+M G +    E  + S F + L F A
Sbjct: 580 LGLAIADNLAKMMGGHLTVFSEPGQGSCFSLCLPFNA 616



>gb:AE017343_1755577 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 1390

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 37/141 (26%), Positives = 73/141 (51%), Gaps = 8/141 (5%)
 Frame = +1

Query: 79   FSLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFT 258
            FSL  A+ +V+    + + + ++ ++ D+        L GD LR++QV+++ +  AV FT
Sbjct: 910  FSLRVAVFSVLKTLCVKAAQNKLDLIFDVDPTMPD-QLIGDPLRLRQVITNLIGNAVKFT 968

Query: 259  PLFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQ---SMSR 426
               + +     +  R ++       V LEF +     GI ++ +  +F+ + Q   S +R
Sbjct: 969  TKGQVA-----LSCRVKRYVTVADAVELEFCVADTGIGIKQDKLDVIFDTFAQADGSTTR 1023

Query: 427  E----GLGLYISQKLIKIMNG 477
            +    GLGL IS++L+ +M+G
Sbjct: 1024 KYGGTGLGLTISKRLVNLMSG 1044



>gb:BX936398_835395 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 942

 Score = 42.7 bits (99), Expect = 0.010
 Identities = 44/166 (26%), Positives = 81/166 (48%), Gaps = 11/166 (6%)
 Frame = +1

Query: 82  SLGEAIKAVVNQAMIPSREIQVQIMCDLPVEASSLYLFGDNLRIQQVLSDFLTTAVLFTP 261
           +L E I  + + A     E+ + I  D+P +     + GD +R+QQ++++ L  A+ FT 
Sbjct: 370 TLDEVIILLAHTAHEKGLELTLHINNDVPDQ-----VLGDAMRLQQIVTNLLGNAIKFT- 423

Query: 262 LFEESSVLFRIIARREQIGAKMHVVHLEFRITHPAPGIPEELIQEMFN-YKQ---SMSRE 429
             EE ++   ++ +   I ++   + +E   T    GI E    ++F  ++Q   S SR 
Sbjct: 424 --EEGNIDILVVVKA--IASQQVTLMVEIHDT--GIGISESQQAQLFQAFRQADASTSRR 477

Query: 430 ----GLGLYISQKLIKIMNGTVQYLREAERSS---FIILLEFPASL 546
               GLGL I+++L+K M G + +  +    S   F + LE   S+
Sbjct: 478 HGGTGLGLVITERLVKEMGGNISFQSQMSCGSIFRFHLTLELNESI 523


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 964,785,954
Number of Sequences: 1806583
Number of extensions: 20435376
Number of successful extensions: 50551
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 48565
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50187
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 65496007989
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)