BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2945
         (758 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB009054_1510726 Arabidopsis thaliana genomic DNA, chromosome...   300   1e-80   
gb:ATU36432_1556929 Arabidopsis thaliana pattern-formation (GNOM...   284   1e-75   
sp|Q42510|EM30_ARATH|EM30_ARATH Pattern formation protein EMB30.>pir|S65571...   284   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb:AC135792_1742772 Oryza sativa chromosome 3 BAC OSJNBa0056E06 ...   268   1e-70   
gb:AP004789_1845106 Oryza sativa (japonica cultivar-group) genom...   267   2e-70   
gb:OSJN00069_1694271 Oryza sativa genomic DNA, chromosome 4, BAC...   175   7e-43   
gb:AE013599_1131423 Drosophila melanogaster chromosome 2R, compl...   106   5e-22   
gb:AE013599_1131422 Drosophila melanogaster chromosome 2R, compl...   106   5e-22   
gb:BC082336_2108382 Mus musculus golgi-specific brefeldin A-resi...   100   2e-20   
gb:BC076569_2106771 Mus musculus golgi-specific brefeldin A-resi...   100   2e-20   
gb:AK172919_2069853 Mus musculus mRNA for mKIAA0248 protein.          100   2e-20   
gb:AK039570_1165434 Mus musculus adult male spinal cord cDNA, RI...   100   2e-20   
gb:CR861302_1185308 Pongo pygmaeus mRNA; cDNA DKFZp459D2411 (fro...   100   3e-20   
pir|T19430|T19430 hypothetical protein C24H11.7 - Caenorhabditis...   100   3e-20   Caenorhabditis elegans [roundworm]
sp|Q9R1D7|GBF1_CRIGR|GBF1_CRIGR Golgi-specific brefeldin A-resistance guani...   100   4e-20   Cricetulus griseus [Chinese hamsters]
gb:D87435_1995324 Human mRNA for KIAA0248 gene, partial cds.           99   8e-20   
sp|Q92538|GBF1_HUMAN|GBF1_HUMAN Golgi-specific brefeldin A-resistance guani...    99   8e-20   Homo sapiens [man]
gb:AE016818_1748088 Ashbya gossypii (= Eremothecium gossypii) AT...    79   9e-14   
sp|O46382|BIG1_BOVIN|BIG1_BOVIN Brefeldin A-inhibited guanine nucleotide-ex...    78   2e-13   Bos taurus [bovine]
gb:AY255526_2080859 Rattus norvegicus Brefeldin A-inhibited guan...    76   6e-13   
gb:HS1164I10_1996896 Human DNA sequence from clone RP5-1164I10 o...    75   2e-12   
gb:BC050449_1984351 Homo sapiens ADP-ribosylation factor guanine...    75   2e-12   
gb:AF111162_1884312 Homo sapiens guanine nucleotide exchange fac...    75   2e-12   
sp|Q9Y6D5|BIG2_HUMAN|BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-ex...    75   2e-12   Homo sapiens [man]
sp|Q9Y6D6|BIG1_HUMAN|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-ex...    75   2e-12   Homo sapiens [man]
gb:CR382125_1658242 Kluyveromyces lactis strain NRRL Y-1140 chro...    72   8e-12   
gb:BC077123_2559842 Danio rerio cDNA clone IMAGE:7138204, partia...    72   1e-11   
gb:AY144827_1583618 Saccharomyces bayanus clone Contig4024 GEA1 ...    71   2e-11   
gb:AY144825_1583616 Saccharomyces bayanus clone Contig2596 GEA2 ...    70   3e-11   
sp|P39993|GEA2_YEAST|GEA2_YEAST ARF guanine-nucleotide exchange factor 2.>p...    70   3e-11   Saccharomyces cerevisiae [brewer's yeast]
sp|P47102|GEA1_YEAST|GEA1_YEAST ARF guanine-nucleotide exchange factor 1.>p...    70   3e-11   Saccharomyces cerevisiae [brewer's yeast]
gb:AF262215_1781621 Oryza sativa guanine nucleotide-exchange pro...    70   5e-11   
pir|E86151|E86151 hypothetical protein F22M8.9 - Arabidopsis tha...    70   5e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AE014134_1129088 Drosophila melanogaster chromosome 2L, compl...    69   1e-10   
gb:AE014134_1129087 Drosophila melanogaster chromosome 2L, compl...    69   1e-10   
pir|T47897|T47897 guanine nucleotide exchange factor-like protei...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:CR382133_1666814 Debaryomyces hansenii chromosome A of strain...    67   4e-10   
gb:AP000366_1819738 Oryza sativa (japonica cultivar-group) genom...    67   5e-10   
gb:AY144930_1583721 Saccharomyces castellii clone Contig636+1278...    67   5e-10   
gb:CR380955_1651648 Candida glabrata strain CBS138 chromosome I ...    66   6e-10   
gb:AP003539_1830616 Oryza sativa (japonica cultivar-group) genom...    64   2e-09   
gb:AC116984_1207340 Dictyostelium discoideum chromosome 2 map 25...    62   1e-08   
gb:AE017343_1755740 Cryptococcus neoformans var. neoformans JEC2...    59   1e-07   
pir|T06119|T06119 hypothetical protein F23E12.60 - Arabidopsis t...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP003705_1832159 Oryza sativa (japonica cultivar-group) genom...    56   8e-07   
gb:AF129515_1243451 Paramecium tetraurelia SEC7-related protein ...    54   4e-06   
gb:CEY6B3A_1370966 Caenorhabditis elegans YAC Y6B3A, complete se...    53   5e-06   
gb:CEY6B3A_1370965 Caenorhabditis elegans YAC Y6B3A, complete se...    53   5e-06   
pir|T27321|T27321 hypothetical protein Y6B3A.1 - Caenorhabditis ...    53   5e-06   Caenorhabditis elegans [roundworm]
pir|T50338|T50338 probable guanine-nucleotide exchange factor wi...    53   5e-06   Schizosaccharomyces pombe
pir|B87990|B87990 protein Y6B3A.1 [imported] - Caenorhabditis el...    53   5e-06   Caenorhabditis elegans [roundworm]
gb:AE016820_1749808 Ashbya gossypii (= Eremothecium gossypii) AT...    51   2e-05   
gb:AY144931_1583722 Saccharomyces castellii clone Contig420 trun...    51   2e-05   
pir|T05647|T05647 hypothetical protein F20D10.320 - Arabidopsis ...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T49244|T49244 guanine nucleotide-exchange-like protein - Ara...    50   6e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AE017344_1756205 Cryptococcus neoformans var. neoformans JEC2...    49   1e-04   
gb:CR382131_1664263 Yarrowia lipolytica chromosome E of strain C...    48   2e-04   
gb:BX897674_1644324 Neurospora crassa DNA linkage group IV BAC c...    47   3e-04   
gb:CR382134_1667381 Debaryomyces hansenii chromosome B of strain...    46   6e-04   
gb:AY762831_1350312 Tetrahymena thermophila guanine nucleotide e...    46   6e-04   
gb:CR380951_1649969 Candida glabrata strain CBS138 chromosome E ...    45   0.001   
gb:CR380959_1653998 Candida glabrata strain CBS138 chromosome M ...    44   0.003   
gb:CR382124_1657091 Kluyveromyces lactis strain NRRL Y-1140 chro...    43   0.005   
sp|Q9P7V5|SC72_SCHPO|SC72_SCHPO Protein transport protein sec72.>pir|T50207...    43   0.007   Schizosaccharomyces pombe
gb:BC044050_2548455 Xenopus laevis similar to ubiquitin specific...    40   0.060   
gb:CR382130_1663283 Yarrowia lipolytica chromosome D of strain C...    39   0.078   
gb:AY136340_1581841 Arabidopsis thaliana putative protein (At5g2...    38   0.17    
gb:AB006708_1510055 Arabidopsis thaliana genomic DNA, chromosome...    38   0.17    
gb:BC081032_2561941 Xenopus laevis MGC81700 protein, mRNA (cDNA ...    37   0.51    
gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 compl...    36   0.66    
gb:AF265459_1781905 Pleurothallis costaricensis trnK gene, intro...    34   2.5     
gb:AE017341_1754590 Cryptococcus neoformans var. neoformans JEC2...    34   2.5     
gb:YSCSEC7_1730564 Yeast (S.cerevisaie) Sec7 gene encoding a pro...    34   2.5     
gb:SC9489_1705942 S.cerevisiae chromosome IV cosmid 9489.              34   2.5     
sp|P11075|SEC7_YEAST|SEC7_YEAST Protein transport protein SEC7.>pir|S49764|...    34   2.5     Saccharomyces cerevisiae [brewer's yeast]
gb:AF265464_1781909 Stelis argentata trnK gene, intron sequence;...    33   4.3     
gb:SPAC4D7_1717928 S.pombe chromosome I cosmid c4D7.                   33   5.6     
pir|T38792|T38792 probable protein transport protein sec7 homolo...    33   5.6     Schizosaccharomyces pombe
sp|Q9UT02|SC71_SCHPO|SC71_SCHPO Protein transport protein sec71.>pir|T39252...    33   5.6     Schizosaccharomyces pombe
gb:CNS07EGF_1373955 chromosome VIII of strain GB-M1 of Encephali...    32   9.6     
gb:CR543861_105144 Acinetobacter sp. ADP1 complete genome.             32   9.6     


>gb:AB009054_1510726 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUL8.
          Length = 1443

 Score =  300 bits (769), Expect = 1e-80
 Identities = 150/210 (71%), Positives = 178/210 (84%), Gaps = 3/210 (1%)
 Frame = +2

Query: 137 DEKVGQRKENANS---GERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDE 307
           DEK  +  ++ N+   GE +MM PYGIPCMVEI HFLC+LLNV ++ E++ RSNPIA+DE
Sbjct: 289 DEKKTEVSDDLNAAANGENAMMAPYGIPCMVEIFHFLCTLLNVGENGEVNSRSNPIAFDE 348

Query: 308 DVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLN 487
           DVPLFALGLINSAIE+GG SF  HPKLL LIQ++LF NLM+FG+SMSPLILSTV SIVLN
Sbjct: 349 DVPLFALGLINSAIELGGPSFREHPKLLTLIQDDLFCNLMQFGMSMSPLILSTVCSIVLN 408

Query: 488 LYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANF 667
           LY +LRT+LK+QLE FFS VLLRIA SKH +SYQ QEVAME LVD CRQH F+ E++ANF
Sbjct: 409 LYLNLRTELKVQLEAFFSYVLLRIAQSKHGSSYQQQEVAMEALVDLCRQHTFIAEVFANF 468

Query: 668 DCDISCSNIFEDFANLLSKSSFPVNDPLSA 757
           DCDI+CSN+FED +NLLSK++FPVN PLSA
Sbjct: 469 DCDITCSNVFEDVSNLLSKNAFPVNGPLSA 498



>gb:ATU36432_1556929 Arabidopsis thaliana pattern-formation (GNOM)
           mRNA, complete cds.
          Length = 1451

 Score =  284 bits (726), Expect = 1e-75
 Identities = 142/203 (69%), Positives = 165/203 (81%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G RK  +      M EPYG+P MVEI HFLCSLLNV++H+ +  RSN IA+DEDVPLFAL
Sbjct: 295 GSRKPASPYDLHIMTEPYGVPSMVEIFHFLCSLLNVVEHVGMGSRSNTIAFDEDVPLFAL 354

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRT 508
            LINSAIE+GG S   HP+LL+LIQ+ELF+NLM+FGLSMSPLILS V SIVLNLY HLRT
Sbjct: 355 NLINSAIELGGSSIRHHPRLLSLIQDELFRNLMQFGLSMSPLILSMVCSIVLNLYQHLRT 414

Query: 509 KLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCS 688
           +LKLQLE FFS V+LR+A  K+  SYQ QEVAME LV+FCRQ  FM EMYAN DCDI+CS
Sbjct: 415 ELKLQLEAFFSCVILRLAQGKYGPSYQQQEVAMEALVNFCRQKSFMVEMYANLDCDITCS 474

Query: 689 NIFEDFANLLSKSSFPVNDPLSA 757
           N+FE+ +NLLSKS+FPVN PLSA
Sbjct: 475 NVFEELSNLLSKSTFPVNCPLSA 497



>sp|Q42510|EM30_ARATH Pattern formation protein
           EMB30.>pir|S65571|S65571 pattern formation protein GNOM
           - Arabidopsis thaliana>gb:AE005172_890389 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC007576_1535936 Arabidopsis thaliana
           chromosome I BAC F7A19 genomic sequence, complete
           sequence.>gb:AC068197_1540358 Genomic sequence for
           Arabidopsis thaliana BAC F16A14 from chromosome I,
           complete sequence.>gb:ATU36433_1556930 Arabidopsis
           thaliana pattern-formation (GNOM) gene, complete
           cds.>gb:ATU56140_1557093 Arabidopsis thaliana EMB30
           mRNA, complete cds.>gb:ATU56141_1557094 Arabidopsis
           thaliana EMB30 gene, complete cds.
          Length = 1451

 Score =  284 bits (726), Expect = 1e-75
 Identities = 142/203 (69%), Positives = 165/203 (81%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G RK  +      M EPYG+P MVEI HFLCSLLNV++H+ +  RSN IA+DEDVPLFAL
Sbjct: 295 GSRKPASPYDLHIMTEPYGVPSMVEIFHFLCSLLNVVEHVGMGSRSNTIAFDEDVPLFAL 354

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRT 508
            LINSAIE+GG S   HP+LL+LIQ+ELF+NLM+FGLSMSPLILS V SIVLNLY HLRT
Sbjct: 355 NLINSAIELGGSSIRHHPRLLSLIQDELFRNLMQFGLSMSPLILSMVCSIVLNLYQHLRT 414

Query: 509 KLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCS 688
           +LKLQLE FFS V+LR+A  K+  SYQ QEVAME LV+FCRQ  FM EMYAN DCDI+CS
Sbjct: 415 ELKLQLEAFFSCVILRLAQGKYGPSYQQQEVAMEALVNFCRQKSFMVEMYANLDCDITCS 474

Query: 689 NIFEDFANLLSKSSFPVNDPLSA 757
           N+FE+ +NLLSKS+FPVN PLSA
Sbjct: 475 NVFEELSNLLSKSTFPVNCPLSA 497



>gb:AC135792_1742772 Oryza sativa chromosome 3 BAC OSJNBa0056E06
           genomic sequence, complete sequence.>gb:AF262214_1781620
           Oryza sativa guanine nucleotide-exchange protein GEP1
           (GEP1) mRNA, complete cds.
          Length = 1175

 Score =  268 bits (684), Expect = 1e-70
 Identities = 134/199 (67%), Positives = 157/199 (78%)
 Frame = +2

Query: 161 ENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLIN 340
           EN+  G   ++EPYGIPCMVEI HFLCSLLNV++          I  DED+PLFAL LIN
Sbjct: 36  ENSADGSGIVVEPYGIPCMVEIFHFLCSLLNVVEQ---------IGVDEDLPLFALKLIN 86

Query: 341 SAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKL 520
           SAIE+GG S   HPKLL+L+Q+ELF+NLM+FGLSMSPLILS V SIVLNLYHHLRT+LKL
Sbjct: 87  SAIELGGSSIRKHPKLLSLVQDELFRNLMQFGLSMSPLILSMVCSIVLNLYHHLRTELKL 146

Query: 521 QLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFE 700
           QLE FFS ++LR+A  +   +Y  QEVAME LVDFCRQ  FM EMYAN DCDI+C NIFE
Sbjct: 147 QLEAFFSCIILRLAQPRFGATYHQQEVAMEALVDFCRQKNFMVEMYANLDCDITCRNIFE 206

Query: 701 DFANLLSKSSFPVNDPLSA 757
           + ANLLSKS+FP+N PLS+
Sbjct: 207 ELANLLSKSAFPINCPLSS 225



>gb:AP004789_1845106 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0476C12.>gb:AP005778_1857708 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0042G06.
          Length = 1424

 Score =  267 bits (682), Expect = 2e-70
 Identities = 128/192 (66%), Positives = 157/192 (81%)
 Frame = +2

Query: 179 ERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIG 358
           +++M E +G+PCMVEIL FLCSLLN+ + +E++PR NPI +DEDVPLFALGLI+SAIE+ 
Sbjct: 282 DQAMSELFGVPCMVEILQFLCSLLNIAEDIEVNPRINPIDFDEDVPLFALGLISSAIELS 341

Query: 359 GDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFF 538
             S   HP+LLA +Q+ELF+NLM+FGLSMSPLILSTV SIV  L++HLR +LKLQLE FF
Sbjct: 342 ASSINKHPELLAFVQDELFRNLMQFGLSMSPLILSTVCSIVFTLFYHLRQELKLQLEAFF 401

Query: 539 SGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLL 718
           S V++R+  S++  SYQ QEVA+E LVDFCRQ  FM EMYAN DCD+  SNIFED ANLL
Sbjct: 402 SCVIIRLGQSRYGASYQQQEVALEALVDFCRQKEFMAEMYANMDCDLQSSNIFEDLANLL 461

Query: 719 SKSSFPVNDPLS 754
           SKS+FPV  PLS
Sbjct: 462 SKSAFPVKSPLS 473



>gb:OSJN00069_1694271 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0050O03, complete sequence.
          Length = 1407

 Score =  175 bits (444), Expect = 7e-43
 Identities = 91/186 (48%), Positives = 121/186 (65%), Gaps = 1/186 (0%)
 Frame = +2

Query: 200 YGIPCMVEILHFLCSLL-NVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGS 376
           +G  CM +I +FLC+LL N  D +           +EDV LF+L LINSAIE+GG++ G 
Sbjct: 259 FGARCMADIFNFLCTLLLNAPDMVATGDGHGAFITEEDVQLFSLVLINSAIELGGEAIGK 318

Query: 377 HPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLR 556
           HPKLL LIQ++LF +L+ +    SPL+LS + S  LNLYH LR  LKLQLE FF  VLLR
Sbjct: 319 HPKLLRLIQDDLFYHLIHYATESSPLVLSMICSTALNLYHFLRRFLKLQLEAFFMYVLLR 378

Query: 557 IAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           +         QLQEVA+E L+ FCRQ  F+ EMY N+DCD    N++E+   LL K++FP
Sbjct: 379 LCGG--GGGAQLQEVAIEGLISFCRQPTFVIEMYVNYDCDPMLRNVYEEVGKLLCKAAFP 436

Query: 737 VNDPLS 754
            + P++
Sbjct: 437 ASSPMT 442



>gb:AE013599_1131423 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226230 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.
          Length = 1740

 Score =  106 bits (264), Expect = 5e-22
 Identities = 65/228 (28%), Positives = 110/228 (48%), Gaps = 1/228 (0%)
 Frame = +2

Query: 44  VNAESNHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQR-KENANSGERSMMEPYGIPCMV 220
           +  ES    P  +G    A S ++    +     VG R  + +   + + + PYG+P + 
Sbjct: 310 IQVESTESEPLLDGETGEATSTLAEANSSEYINSVGVRFTQQSTDHDVTSLSPYGLPFIQ 369

Query: 221 EILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALI 400
           E+  FL  L N +D              + +    L L+  A E+  D+ G +  LL L+
Sbjct: 370 ELFRFLIILCNPLDKQN----------SDSMMHTGLSLLTVAFEVAADNIGKYEGLLELV 419

Query: 401 QEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDT 580
           +++L +NL+    S    I +    +   L+  LR  LK QLE +   +   IA     T
Sbjct: 420 KDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKT 479

Query: 581 SYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
            Y+++E+A++ L+   R   F+TE+Y N+DCD+ C+++FE   NLLSK
Sbjct: 480 PYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSK 527



>gb:AE013599_1131422 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003822_1226229 Drosophila melanogaster
           chromosome 2R, section 28 of 74 of the complete
           sequence.
          Length = 1983

 Score =  106 bits (264), Expect = 5e-22
 Identities = 65/228 (28%), Positives = 110/228 (48%), Gaps = 1/228 (0%)
 Frame = +2

Query: 44  VNAESNHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQR-KENANSGERSMMEPYGIPCMV 220
           +  ES    P  +G    A S ++    +     VG R  + +   + + + PYG+P + 
Sbjct: 310 IQVESTESEPLLDGETGEATSTLAEANSSEYINSVGVRFTQQSTDHDVTSLSPYGLPFIQ 369

Query: 221 EILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALI 400
           E+  FL  L N +D              + +    L L+  A E+  D+ G +  LL L+
Sbjct: 370 ELFRFLIILCNPLDKQN----------SDSMMHTGLSLLTVAFEVAADNIGKYEGLLELV 419

Query: 401 QEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDT 580
           +++L +NL+    S    I +    +   L+  LR  LK QLE +   +   IA     T
Sbjct: 420 KDDLCRNLISLLSSERLSIFAADLQLCFLLFESLRGHLKFQLEAYLRKLSEIIASDNPKT 479

Query: 581 SYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
            Y+++E+A++ L+   R   F+TE+Y N+DCD+ C+++FE   NLLSK
Sbjct: 480 PYEMRELALDNLLQLWRIPGFVTELYINYDCDLYCTDMFESLTNLLSK 527



>gb:BC082336_2108382 Mus musculus golgi-specific brefeldin
           A-resistance factor 1, mRNA (cDNA clone MGC:90745
           IMAGE:30536866), complete cds.
          Length = 1128

 Score =  100 bits (250), Expect = 2e-20
 Identities = 64/202 (31%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 382 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 429

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 430 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSVERLNLYAASLRVCFLLFESMR 488

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK QLE +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 489 EHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAVVQLWRIPSFVTELYINYDCDYYC 548

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FED   LLSK++FPV+  L
Sbjct: 549 SNLFEDLTKLLSKNAFPVSGQL 570



>gb:BC076569_2106771 Mus musculus golgi-specific brefeldin
           A-resistance factor 1, mRNA (cDNA clone MGC:100238
           IMAGE:6409170), complete cds.
          Length = 1861

 Score =  100 bits (250), Expect = 2e-20
 Identities = 64/202 (31%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 382 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 429

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 430 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSVERLNLYAASLRVCFLLFESMR 488

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK QLE +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 489 EHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAVVQLWRIPSFVTELYINYDCDYYC 548

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FED   LLSK++FPV+  L
Sbjct: 549 SNLFEDLTKLLSKNAFPVSGQL 570



>gb:AK172919_2069853 Mus musculus mRNA for mKIAA0248 protein.
          Length = 1803

 Score =  100 bits (250), Expect = 2e-20
 Identities = 64/202 (31%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 328 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 375

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 376 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSVERLNLYAASLRVCFLLFESMR 434

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK QLE +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 435 EHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAVVQLWRIPSFVTELYINYDCDYYC 494

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FED   LLSK++FPV+  L
Sbjct: 495 SNLFEDLTKLLSKNAFPVSGQL 516



>gb:AK039570_1165434 Mus musculus adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330065C10
           product:GOLGI-SPECIFIC BREFELDIN A-RESISTANCE GUANINE
           NUCLEOTIDE EXCHANGE FACTOR 1 (BFA-RESISTANT GEF 1)
           homolog [Cricetulus griseus], full insert sequence.
          Length = 747

 Score =  100 bits (250), Expect = 2e-20
 Identities = 64/202 (31%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 383 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 430

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 431 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSVERLNLYAASLRVCFLLFESMR 489

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK QLE +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 490 EHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAVVQLWRIPSFVTELYINYDCDYYC 549

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FED   LLSK++FPV+  L
Sbjct: 550 SNLFEDLTKLLSKNAFPVSGQL 571



>gb:CR861302_1185308 Pongo pygmaeus mRNA; cDNA DKFZp459D2411 (from
           clone DKFZp459D2411).
          Length = 700

 Score =  100 bits (249), Expect = 3e-20
 Identities = 63/202 (31%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 382 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 429

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 430 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSIERLNLYAASLRVCFLLFESMR 488

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK Q+E +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 489 EHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYC 548

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FED   LLSK++FPV+  L
Sbjct: 549 SNLFEDLTKLLSKNAFPVSGQL 570



>pir|T19430|T19430 hypothetical protein C24H11.7 - Caenorhabditis
           elegans>gb:CEC24H11_1360612 Caenorhabditis elegans
           cosmid C24H11, complete sequence.>gb:CEY41C4A_1369930
           Caenorhabditis elegans YAC Y41C4A, complete sequence.
          Length = 1820

 Score =  100 bits (249), Expect = 3e-20
 Identities = 70/233 (30%), Positives = 114/233 (48%), Gaps = 5/233 (2%)
 Frame = +2

Query: 53  ESNHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILH 232
           E +H+ P       +    VS +     ++ VG        GE  M  PYG+PC  E+L 
Sbjct: 345 EEHHERPPVRAHAGLQREIVSDEEEIDTEQTVG--------GEEKM--PYGLPCCRELLR 394

Query: 233 FLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEEL 412
           FL ++ N +D      R N     E + +  L L+  A+E   D   ++  L+ LI+ EL
Sbjct: 395 FLITMTNPVD------RHNT----ESMVILGLNLLIVALEAIADFLPNYDILMPLIKNEL 444

Query: 413 FQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGV--LLRIAHSKHDTS- 583
            +NL++   +    +L+        L+  +R  +K QLE++   +  ++     +H+   
Sbjct: 445 CRNLLQLLDTNRLPVLAATNRCCFLLFESMRMHMKFQLESYLKKLQSIVLTEEKQHENGG 504

Query: 584 --YQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
              + +E+A+E+LV   R    +TEMY NFDCD+ C NIFED   LL ++SFP
Sbjct: 505 GGTEQKEMALESLVQLWRIPGLVTEMYLNFDCDLYCGNIFEDLTKLLVENSFP 557



>sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance guanine
           nucleotide exchange factor 1 (BFA-resistant GEF
           1).>gb:AF127523_2055532 Cricetulus griseus
           golgi-specific brefeldin A-resistance guanine nucleotide
           exchange factor 1 (GBF1) mRNA, complete cds.
          Length = 1856

 Score =  100 bits (248), Expect = 4e-20
 Identities = 67/202 (33%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D      R N     E +    L
Sbjct: 380 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHD------RHN----SEGMIHMGL 429

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
            L+  A+E           LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 430 HLLTVALESA--PVAQCQTLLGLIKDEMCRHLFQL-LSVERLNLYAASLRVCFLLFESMR 486

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK QLE +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 487 EHLKFQLEMYMKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYC 546

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           +N+FED   LLSK++FPV+  L
Sbjct: 547 ANLFEDLTKLLSKNAFPVSGQL 568



>gb:D87435_1995324 Human mRNA for KIAA0248 gene, partial cds.
          Length = 1880

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 62/202 (30%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 403 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 450

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 451 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSIERLNLYAASLRVCFLLFESMR 509

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK Q+E +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 510 EHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYC 569

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FE+   LLSK++FPV+  L
Sbjct: 570 SNLFEELTKLLSKNAFPVSGQL 591



>sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine
           nucleotide exchange factor 1 (BFA-resistant GEF
           1).>gb:AF068755_1880639 Homo sapiens sec7 domain family
           member (GBF1) mRNA, complete cds.>gb:AL160011_1921693
           Human DNA sequence from clone RP11-242B12 on chromosome
           10 Contains the ELOVL3 gene for elongation of very long
           chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3,
           the PITX3 gene for paired-like homeodomain transcription
           factor 3, the 5' end of the GBF1 gene for golgi-specific
           brefeldin A resistance factor 1 and three CpG islands,
           complete sequence.>gb:AL356420_1924517 Human DNA
           sequence from clone RP11-346A7 on chromosome 10 Contains
           part ot the GBF1 gene for golgi-specific brefeldin A
           resistance factor 1, complete
           sequence.>gb:HSBA18I14_2010877 Human DNA sequence from
           clone RP11-18I14 on chromosome 10 Contains the GBF1 gene
           for golgi-specific brefeldin A resistance factor 1 (SEC7
           domain family member, Myeloblast KIAA0248), the NFKB2
           gene for the nuclear factor of kappa light polypeptide
           gene enhancer in B-cells 2 (p49/p100), the PSD gene for
           a pleckstrin and Sec7 domain protein, four novel genes,
           a novel gene (FLJ22529) the ACTR1A gene for ARP1
           actin-related protein 1 homolog A, centractin alpha
           (yeast), the 5' end of the SUFU gene for suppressor of
           fused homolog (Drosophila) and eight CpG islands,
           complete sequence.
          Length = 1859

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 62/202 (30%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = +2

Query: 149 GQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFAL 328
           G R   ++  E + + PYG+PC+ E+  FL SL N  D            ++ +V +  +
Sbjct: 382 GVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR-----------HNSEV-MIHM 429

Query: 329 GLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT-SIVLNLYHHLR 505
           GL    + +          LL LI++E+ ++L +  LS+  L L   +  +   L+  +R
Sbjct: 430 GLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQL-LSIERLNLYAASLRVCFLLFESMR 488

Query: 506 TKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISC 685
             LK Q+E +   ++  I        Y+++E+A+E +V   R   F+TE+Y N+DCD  C
Sbjct: 489 EHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYINYDCDYYC 548

Query: 686 SNIFEDFANLLSKSSFPVNDPL 751
           SN+FE+   LLSK++FPV+  L
Sbjct: 549 SNLFEELTKLLSKNAFPVSGQL 570



>gb:AE016818_1748088 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 1393

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 62/253 (24%), Positives = 119/253 (47%), Gaps = 15/253 (5%)
 Frame = +2

Query: 44  VNAESNHKAPSDEGSVNVAPS-----NVSSDPLASKDEKVGQRKENANSGERSMMEPYGI 208
           +N ES   A   E  +   P      +V +  L + + K   + E+A   + ++ E YG+
Sbjct: 239 INDESFATALLKEDIIGTMPRATTDVSVENGTLVATEAK---KHEDAPVDDTTLEENYGL 295

Query: 209 PCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKL 388
           P + + L  L SL+ +          N    +    +F L L+N  +E+ GD F  HP+L
Sbjct: 296 PVVKDYLGILISLIVI---------ENSHKQNNSTKVFGLHLLNMTVELAGDLFPKHPRL 346

Query: 389 LALIQEELFQNLMRF-----GLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLL 553
            +L+ + +F+N++        LS+    L   T++ + L   L+++++L L+T FS   +
Sbjct: 347 FSLVSDPIFKNILYLIQNTDKLSLLQAALQLFTTLTIILGDCLQSQIELTLKTIFS---I 403

Query: 554 RIAHSKHDTSYQLQEVAMETLVD-----FCRQHMFMTEMYANFDCDISCSNIFEDFANLL 718
            +   K + +        E LV+     + R   F T ++ N+DCD+  S++  +F   L
Sbjct: 404 LLDEKKGNDNKIRPSAVKELLVEQISILWTRSPSFFTSIFINYDCDLERSDLAINFLKKL 463

Query: 719 SKSSFPVNDPLSA 757
           +K + P +  ++A
Sbjct: 464 TKLALPESALITA 476



>sp|O46382|BIG1_BOVIN Brefeldin A-inhibited guanine
           nucleotide-exchange protein 1 (Brefeldin A-inhibited GEP
           1) (p200 ARF-GEP1) (p200 ARF guanine nucleotide exchange
           factor).>pir|T14096|T14096 guanine nucleotide-exchange
           protein - bovine>gb:AF023451_1411904 Bos taurus guanine
           nucleotide-exchange protein (ARF-GEP1) mRNA, complete
           cds.
          Length = 1849

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 43/146 (29%), Positives = 79/146 (54%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  FG++   +  I++ L   L + G+S  P +   
Sbjct: 444 DPKSHELRSKILSLQLLLSILQNAGPIFGTNEMFINAIKQYLCVALSKNGVSSVPEVFEL 503

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI L L  + +T LK+Q+E FF  + L I  +   +S+  + + ++TL   C     +
Sbjct: 504 SLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETS-TSSFDHKWMVIQTLTRICADAQSV 562

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 563 VDIYVNYDCDLNAANIFERLVNDLSK 588



>gb:AY255526_2080859 Rattus norvegicus Brefeldin A-inhibited guanine
           nucleotide-exchange factor 2 (Big2) mRNA, complete cds.
          Length = 1791

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 42/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F SH   +  I++ L   L + G+S  P +   
Sbjct: 402 DPKSHELRSKVVSLQLLLSVLQNAGPVFRSHEMFVTAIKQYLCVALSKNGVSSVPDVFEL 461

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             +I L L  + +  LK+Q+E FF  + L I  +   +S++ + + ++TL   C     +
Sbjct: 462 SLAIFLTLLSNFKMHLKMQIEVFFKEIFLNILETS-TSSFEHRWMVIQTLTRICADAQCV 520

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 521 VDIYVNYDCDLNAANIFERLVNDLSK 546



>gb:HS1164I10_1996896 Human DNA sequence from clone RP5-1164I10 on
           chromosome 20q13.13-13.2 Contains part of the BIG2 gene
           for brefeldin A-inhibited guanine nucleotide-exchange
           protein 2, ESTs, STSs, GSSs and two CpG islands,
           complete sequence.>gb:HSDJ155G6_2011948 Human DNA
           sequence from clone RP1-155G6 on chromosome 20 Contains
           the 3' end of the ARFGEF2 gene for ADP-ribosylation
           factor guanine nucleotide-exchange factor 2 (brefeldin
           A-inhibited), the 5' end of the CSE1L gene for
           chromosome segregation 1-like (yeast), the SNAP23P gene
           for synaptosomal-associated protein (23 kDa) pseudogene,
           a novel gene and a CpG island, complete sequence.
          Length = 1785

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 41/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F +H   +  I++ L   L + G+S  P +   
Sbjct: 395 DPKSHELRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFEL 454

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             +I L L  + +  LK+Q+E FF  + L I  +   +S++ + + ++TL   C     +
Sbjct: 455 SLAIFLTLLSNFKMHLKMQIEVFFKEIFLNILETS-TSSFEHRWMVIQTLTRICADAQCV 513

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 514 VDIYVNYDCDLNAANIFERLVNDLSK 539



>gb:BC050449_1984351 Homo sapiens ADP-ribosylation factor guanine
           nucleotide-exchange factor 2 (brefeldin A-inhibited),
           mRNA (cDNA clone IMAGE:6187759), partial cds.
          Length = 832

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 41/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F +H   +  I++ L   L + G+S  P +   
Sbjct: 395 DPKSHELRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFEL 454

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             +I L L  + +  LK+Q+E FF  + L I  +   +S++ + + ++TL   C     +
Sbjct: 455 SLAIFLTLLSNFKMHLKMQIEVFFKEIFLNILETS-TSSFEHRWMVIQTLTRICADAQCV 513

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 514 VDIYVNYDCDLNAANIFERLVNDLSK 539



>gb:AF111162_1884312 Homo sapiens guanine nucleotide exchange factor
           mRNA, complete cds.
          Length = 1849

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F ++   +  I++ L   L + G+S  P +   
Sbjct: 444 DPKSHELRSKILSLQLLLSILQNAGPIFRTNEMFINAIKQYLCVALSKNGVSSVPEVFEL 503

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI L L  + +T LK+Q+E FF  + L I  +   +S+  + + ++TL   C     +
Sbjct: 504 SLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETS-TSSFDHKWMVIQTLTRICADAQSV 562

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 563 VDIYVNYDCDLNAANIFERLVNDLSK 588



>sp|Q9Y6D5|BIG2_HUMAN Brefeldin A-inhibited guanine
           nucleotide-exchange protein 2 (Brefeldin A-inhibited GEP
           2).>gb:AF084521_1881694 Homo sapiens brefeldin
           A-inhibited guanine nucleotide-exchange protein 2 mRNA,
           complete cds.
          Length = 1785

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 41/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F +H   +  I++ L   L + G+S  P +   
Sbjct: 395 DPKSHELRSKVVSLQLLLSVLQNAGPVFRTHEMFINAIKQYLCVALSKNGVSSVPDVFEL 454

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             +I L L  + +  LK+Q+E FF  + L I  +   +S++ + + ++TL   C     +
Sbjct: 455 SLAIFLTLLSNFKMHLKMQIEVFFKEIFLNILETS-TSSFEHRWMVIQTLTRICADAQCV 513

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 514 VDIYVNYDCDLNAANIFERLVNDLSK 539



>sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine
           nucleotide-exchange protein 1 (Brefeldin A-inhibited GEP
           1) (p200 ARF-GEP1) (p200 ARF guanine nucleotide exchange
           factor).>gb:AF084520_1881693 Homo sapiens brefeldin
           A-inhibited guanine nucleotide-exchange protein 1 mRNA,
           complete cds.
          Length = 1849

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/146 (28%), Positives = 78/146 (53%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F ++   +  I++ L   L + G+S  P +   
Sbjct: 444 DPKSHELRSKILSLQLLLSILQNAGPIFRTNEMFINAIKQYLCVALSKNGVSSVPEVFEL 503

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI L L  + +T LK+Q+E FF  + L I  +   +S+  + + ++TL   C     +
Sbjct: 504 SLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETS-TSSFDHKWMVIQTLTRICADAQSV 562

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE   N LSK
Sbjct: 563 VDIYVNYDCDLNAANIFERLVNDLSK 588



>gb:CR382125_1658242 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 1387

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 50/197 (25%), Positives = 96/197 (48%), Gaps = 7/197 (3%)
 Frame = +2

Query: 167 ANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSA 346
           A+S  +++   YG+  + + +  L SLL            N    +    +F L L+N+A
Sbjct: 278 ASSESQNLESDYGLAVIKDYMDILVSLLLP---------ENQHKQNNSTKVFGLHLLNTA 328

Query: 347 IEIGGDSFGSHPKLLALIQEELFQNLMRF-----GLSMSPLILSTVTSIVLNLYHHLRTK 511
           IE+ GD F  HP+L +L+ + + +N++        LS+    L   T++ + L  HL  +
Sbjct: 329 IELAGDKFPQHPQLFSLVADPICKNILYIIQNSDKLSLLQAALQLFTNLTIILGDHLSLQ 388

Query: 512 LKLQLETFFSGVL-LRIAHSKHDTSYQLQEVAMETL-VDFCRQHMFMTEMYANFDCDISC 685
           ++  + T FS +L   ++         ++E+ +E + + + R   F T ++ NFDC +  
Sbjct: 389 IEFTINTIFSILLDSNVSDETKPRPAVVKELLIEQISILWTRSPSFFTAVFINFDCSLER 448

Query: 686 SNIFEDFANLLSKSSFP 736
           S++  +F   L+K S P
Sbjct: 449 SDLAIEFLMALTKLSLP 465



>gb:BC077123_2559842 Danio rerio cDNA clone IMAGE:7138204, partial
           cds.
          Length = 595

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 41/146 (28%), Positives = 76/146 (52%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+ S ++  G  F ++   +  I++ L   L + G+S  P +   
Sbjct: 448 DPKSHELRSKVLSLQLLLSILQNAGPIFKTNEMFINAIKQYLCVALSKNGVSSVPEVFEL 507

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI L L  + +T LK+Q+E FF  + L I  +   +SY  + + ++TL   C     +
Sbjct: 508 SLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETS-TSSYDHKWMVIQTLTRICADAQSV 566

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD++ +NIFE  A    K
Sbjct: 567 VDIYVNYDCDLNAANIFERLAKKKKK 592



>gb:AY144827_1583618 Saccharomyces bayanus clone Contig4024 GEA1
           gene, partial cds.
          Length = 678

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 19/240 (7%)
 Frame = +2

Query: 74  SDEGSVNVAPSNVSS--------DPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEIL 229
           SDE  ++    N S         DPL    EK G++ +  +  E +    YGI  + + L
Sbjct: 265 SDEELISTDDDNASDNHINKKLIDPLTIHQEKDGEKGKKDDEIEPN----YGIAVIKDYL 320

Query: 230 HFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEE 409
             L SL+   + M+         +       +L LIN+AIEI G+ F  +P+L  LI + 
Sbjct: 321 GLLLSLIIPENRMK---------HTNSAMKLSLQLINTAIEISGNKFPLYPRLFNLISDP 371

Query: 410 LFQNLMRFGL------SMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSK 571
           +F++++ F L      S+    L   TS+V+ L  +L  +++L L   F   +L      
Sbjct: 372 IFKSVV-FLLQNSAQHSLLQATLQLFTSLVVILGDYLPMQIELTLRRIFE--ILEDKKGA 428

Query: 572 HDTSYQLQEVAMETLVD-----FCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
            D + Q      E +++     +     F  +M+ NFDCD+  S++  DF   L++ S P
Sbjct: 429 DDATKQKSPAIKELIIEQLSILWIHSPTFFLQMFVNFDCDLDRSDLSIDFIRALTRFSLP 488



>gb:AY144825_1583616 Saccharomyces bayanus clone Contig2596 GEA2
           gene, partial cds.
          Length = 699

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 61/240 (25%), Positives = 113/240 (47%), Gaps = 19/240 (7%)
 Frame = +2

Query: 74  SDEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMM-------EPYGIPCMVEILH 232
           +DE +++    N  S     K+E   ++ E  +   RS         + YG+P   + L+
Sbjct: 278 NDEEAISEDDGNEGSHGRLEKNEDEIEQLEIVHKTTRSNSRIQAYADDNYGLPVARQYLN 337

Query: 233 FLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEEL 412
            L SL        I+P  N + +     +F L LI +A+EI GD    +P+L  LI + +
Sbjct: 338 LLLSL--------IAPE-NELKHSYSTRIFGLELIQTALEISGDRLQLYPRLFTLISDPI 388

Query: 413 FQNLM-----RFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLL--RIAHSK 571
           F++++        LS+    L   T++V+ L ++L+ +++L L   FS +LL    A S 
Sbjct: 389 FKSILFIIQNTTKLSLLQATLQLFTTLVVILGNNLQLQIELTLTRIFS-ILLDDGTASSS 447

Query: 572 HDTSYQLQEVAMETLVD-----FCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           +  +     +  E L++     + R   F T  + NFDC++  +++  +F   L+K + P
Sbjct: 448 NSENKNKPSIIKELLIEQISILWTRSPSFFTSTFINFDCNLDRADVSINFLKALTKLALP 507



>sp|P39993|GEA2_YEAST ARF guanine-nucleotide exchange factor
           2.>pir|S50437|S50437 hypothetical protein YEL022w -
           yeast (Saccharomyces cerevisiae)>gb:SCE9871_1708239
           Saccharomyces cerevisiae chromosome V cosmids 9871,
           8199, 9867, 9495 and lambda clones 6693 and 5898.
          Length = 1459

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 57/240 (23%), Positives = 119/240 (49%), Gaps = 13/240 (5%)
 Frame = +2

Query: 56  SNHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEP-YGIPCMVEILH 232
           +N +A S++  +     +       ++   + Q+   +NS  ++  +  YG+P + + L+
Sbjct: 278 NNEEAISEDDGIEEEHIHSEKSTNGAEQLDIVQKTTRSNSRIQAYADDNYGLPVVRQYLN 337

Query: 233 FLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEEL 412
            L SL        I+P  N + +     +F L LI +A+EI GD    +P+L  LI + +
Sbjct: 338 LLLSL--------IAPE-NELKHSYSTRIFGLELIQTALEISGDRLQLYPRLFTLISDPI 388

Query: 413 FQNLM-----RFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHD 577
           F++++        LS+    L   T++V+ L ++L+ +++L L   FS +LL    + + 
Sbjct: 389 FKSILFIIQNTTKLSLLQATLQLFTTLVVILGNNLQLQIELTLTRIFS-ILLDDGTANNS 447

Query: 578 TSYQ------LQEVAMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           +S        ++E+ +E + + + R   F T  + NFDC++  +++  +F   L+K + P
Sbjct: 448 SSENKNKPSIIKELLIEQISILWTRSPSFFTSTFINFDCNLDRADVSINFLKALTKLALP 507



>sp|P47102|GEA1_YEAST ARF guanine-nucleotide exchange factor
           1.>pir|S57049|S57049 hypothetical protein YEL022w
           homolog YJR031c - yeast  (Saccharomyces
           cerevisiae)>gb:SCORFTAN_1709015 S.cerevisiae J1545,
           J1575, J1580, J1585, J1590 ORFs and tandem duplication
           of Ty1 transposon.>gb:SCYJR031C_1712826 S.cerevisiae
           chromosome X reading frame ORF YJR031c.
          Length = 1408

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 65/237 (27%), Positives = 114/237 (48%), Gaps = 11/237 (4%)
 Frame = +2

Query: 59  NHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEP-YGIPCMVEILHF 235
           N  + +D+ S  VA  N +  P+     +    +E A   E   +EP YGI  + + L  
Sbjct: 267 NDLSSTDDDSA-VADDNKNEKPVQQVIREQENDEETAEKAEN--VEPNYGITVIKDYLGL 323

Query: 236 LCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELF 415
           L SL+   + M+ +  +  ++         L LIN+AIEI GD F  +P+L +LI + +F
Sbjct: 324 LLSLVMPENRMKHTTSAMKLS---------LQLINAAIEISGDKFPLYPRLFSLISDPIF 374

Query: 416 QNLM-----RFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDT 580
           ++++         S+    L   TS+V+ L  +L  +++L L   F   +L       D 
Sbjct: 375 KSVLFIIQSSTQYSLLQATLQLFTSLVVILGDYLPMQIELTLRRIFE--ILEDTTISGDV 432

Query: 581 SYQ----LQEVAMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           S Q    ++E+ +E L + +     F  +++ NFDC++  S++  DF   L+K S P
Sbjct: 433 SKQKPPAIRELIIEQLSILWIHSPAFFLQLFVNFDCNLDRSDLSIDFIKELTKFSLP 489



>gb:AF262215_1781621 Oryza sativa guanine nucleotide-exchange
           protein GEP2 (GEP2) mRNA, partial cds.
          Length = 1789

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 37/138 (26%), Positives = 69/138 (50%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + AL L+   +E  G  F +  + L  I++ L  +L++   S   ++     SI ++L  
Sbjct: 400 ILALELLKILLENAGAVFRTSERFLGAIKQYLCLSLLKNCASAHMIVFQLSCSIFISLVS 459

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             R  LK ++  FF  ++LR+  +    +YQ + + +  L   C     + +++ N+DCD
Sbjct: 460 RFRPGLKAEIGVFFPMIILRVLENIAQPNYQAKLIVLRFLEKLCADSQILVDIFLNYDCD 519

Query: 677 ISCSNIFEDFANLLSKSS 730
           +  SNIFE   N L K++
Sbjct: 520 VHSSNIFERMVNGLLKTA 537



>pir|E86151|E86151 hypothetical protein F22M8.9 - Arabidopsis
           thaliana>gb:AE005172_889246 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F22M8_1677900 Sequence of BAC F22M8 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 1750

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 38/138 (27%), Positives = 70/138 (50%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + AL L+   +E  G  F +  + L  I++ L  +L++   S   +I     SI+L+L  
Sbjct: 367 IVALELLKILLENAGAVFRTSDRFLGAIKQYLCLSLLKNSASNLMIIFQLSCSILLSLVS 426

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             R  LK ++  FF  ++LR+  +     +Q + + +  L   C     + +++ N+DCD
Sbjct: 427 RFRAGLKAEIGVFFPMIVLRVLENVAQPDFQQKMIVLRFLDKLCVDSQILVDIFINYDCD 486

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++ SNIFE   N L K++
Sbjct: 487 VNSSNIFERMVNGLLKTA 504



>gb:AE014134_1129088 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003641_1219195 Drosophila melanogaster
           chromosome 2L, section 50 of 83 of the complete
           sequence.
          Length = 1614

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 39/146 (26%), Positives = 75/146 (51%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+   ++  G  F S+   +  I++ L   L   G+S+ P +   
Sbjct: 337 DPKSHELRSKVLSLHLLLLILQNAGPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFEL 396

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI + L  + +  LK Q+E FF  + L I  + + +S++ + + ++ L   C     +
Sbjct: 397 SLSIFVALLSNFKVHLKRQIEVFFKEIFLNILEA-NSSSFEHKWMVIQALTRICADAQSV 455

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD S +N+FE   N LSK
Sbjct: 456 VDIYVNYDCDFSAANLFERLVNDLSK 481



>gb:AE014134_1129087 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003641_1219194 Drosophila melanogaster
           chromosome 2L, section 50 of 83 of the complete
           sequence.>gb:AY122171_1301533 Drosophila melanogaster
           LD29171 full insert cDNA.>gb:DROSADH01_1382696
           Drosophila melanogaster, chromosome 2L, region 34C4-36A7
           (Adh region), section 1 of 10 of the complete sequence.
          Length = 1653

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 39/146 (26%), Positives = 75/146 (51%)
 Frame = +2

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILST 466
           +P +++    + +L L+   ++  G  F S+   +  I++ L   L   G+S+ P +   
Sbjct: 337 DPKSHELRSKVLSLHLLLLILQNAGPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFEL 396

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             SI + L  + +  LK Q+E FF  + L I  + + +S++ + + ++ L   C     +
Sbjct: 397 SLSIFVALLSNFKVHLKRQIEVFFKEIFLNILEA-NSSSFEHKWMVIQALTRICADAQSV 455

Query: 647 TEMYANFDCDISCSNIFEDFANLLSK 724
            ++Y N+DCD S +N+FE   N LSK
Sbjct: 456 VDIYVNYDCDFSAANLFERLVNDLSK 481



>pir|T47897|T47897 guanine nucleotide exchange factor-like protein -
           Arabidopsis thaliana>gb:ATT4C21_1555978 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T4C21.
          Length = 1793

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 38/138 (27%), Positives = 70/138 (50%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + AL L+   +E  G  F +  K  A I++ L  +L++   S   +I     SI ++L  
Sbjct: 379 ILALELLKILLENAGAVFRTSEKFSADIKQFLCLSLLKNSASTLMIIFQLSCSIFISLVA 438

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             R  LK ++  FF  ++LR+  +    ++Q + + +  L   C     + +++ N+DCD
Sbjct: 439 RFRAGLKAEIGVFFPMIVLRVVENVAQPNFQQKMIVLRFLDKLCLDSQILVDIFLNYDCD 498

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++ SNIFE   N L K++
Sbjct: 499 VNSSNIFERMVNGLLKTA 516



>gb:CR382133_1666814 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 1558

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 57/229 (24%), Positives = 110/229 (48%), Gaps = 20/229 (8%)
 Frame = +2

Query: 110 VSSDPLASKDEKVGQRKENANSGERSMM----EPYGIPCMVEILHFLCSLLNVMDHMEIS 277
           +  + +   D+ V   +E +NS          EP+GI C+ E L  L S+        IS
Sbjct: 321 LDENTVEENDQPVENPREISNSENPKEALDTEEPFGIICINEFLGILISM--------IS 372

Query: 278 PRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSM-SPL 454
           P SN   + E   +FAL L+N+AIE+ G     HP L++L+ + + +++++   +  SP 
Sbjct: 373 P-SNQYQHMESTRVFALSLMNTAIEVSGHDIPKHPSLMSLVSDPVSKHVVQIMTTTDSPA 431

Query: 455 ILST----VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSK-----HDTSYQL----- 592
           +L       ++I + L   L+++++L L   F+ +             ++TS        
Sbjct: 432 LLQASLQLFSTIAIVLGRQLKSQIELTLLLLFNSISPDSVEKNDTINGNETSVATRISGS 491

Query: 593 QEVAMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           +E+ +E+L + + R  +F T ++ ++DC+   +++   F   L K S P
Sbjct: 492 KEMLIESLSLLWTRSPVFFTHLFIDYDCNFDRTDLSRKFLEFLCKLSLP 540



>gb:AP000366_1819738 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0437H03.
          Length = 1687

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 37/141 (26%), Positives = 70/141 (49%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + +L L+   I+  G  + ++ K L  I++ L  +L++     +  I   + SI L L  
Sbjct: 307 VLSLELLKMVIDNAGAFWRTNEKYLGAIKQYLCLSLLKNSALSAMSIYQLLCSIFLGLLS 366

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             R+ LK ++  FF  ++LR+  + H  S+  +   +  L   C+    + +++ N+DCD
Sbjct: 367 RFRSGLKEEIGIFFPMLVLRVLENVHQPSFLQKMTVLNLLEKICKDSQVIIDVFVNYDCD 426

Query: 677 ISCSNIFEDFANLLSKSSFPV 739
           +   NIFE   N L K++  V
Sbjct: 427 VDAPNIFERIVNGLLKTALGV 447



>gb:AY144930_1583721 Saccharomyces castellii clone Contig636+1278
           GEA1 gene, complete cds.
          Length = 1482

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 54/203 (26%), Positives = 93/203 (45%), Gaps = 22/203 (10%)
 Frame = +2

Query: 194 EPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFG 373
           + YG+P   + L  L SL+            N   +     +F L LIN+ +EI GD   
Sbjct: 326 DKYGLPITKQYLSLLLSLI---------VPENQAKHTNSTRIFGLQLINTIVEIVGDKIP 376

Query: 374 SHPKLLALIQEELFQNLMRF-----GLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFF 538
            HP L  LI + +F+ L+        LS+    L   TS+V+ L +HL  +++L L   F
Sbjct: 377 LHPPLFTLISDPIFKCLLFIIQNTNRLSLLQATLQLFTSLVVILGNHLPMQIELTLSRIF 436

Query: 539 SGVLLRIAHSKHDTSYQ----------------LQEVAMETL-VDFCRQHMFMTEMYANF 667
           + +LL  +   +D+  +                ++E+ +E L + + R   F T  + N+
Sbjct: 437 T-ILLDDSSGTNDSDGKSSNNSNDNGSPRKPAAIKELLIEQLSILWTRSPSFFTSTFINY 495

Query: 668 DCDISCSNIFEDFANLLSKSSFP 736
           DC++  ++I  +F   L+K S P
Sbjct: 496 DCNLERADIAVNFIKALTKLSLP 518



>gb:CR380955_1651648 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 1454

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 60/226 (26%), Positives = 105/226 (46%), Gaps = 16/226 (7%)
 Frame = +2

Query: 107 NVSSDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRS 286
           N S + + SK     Q + N    E S  EPYG+P   + L  L SL        I P  
Sbjct: 325 NESFNSIESKTNVEVQNENNRIINE-SEEEPYGLPVARQYLSLLLSL--------ILP-D 374

Query: 287 NPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRF-----GLSMSP 451
             I +     +FAL LIN A E+ GD    HP+L  L+ + +F++++        LS+  
Sbjct: 375 QKIKHTTTTRIFALKLINVATEVTGDKLPLHPRLFNLVSDPIFKSVLFIIQSTDKLSLLQ 434

Query: 452 LILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDT----------SYQLQEV 601
             L   T+ V+ L   L+ +++L L+  F+ +      S+  T          S  ++E+
Sbjct: 435 AALQLFTTFVVILGQRLQPQIELTLKRIFAILSDDDGKSQKKTGNNTEKTKFKSPAVKEL 494

Query: 602 AMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
            +E + + + R  ++ T  + +FDC++  +++   F  +L+K S P
Sbjct: 495 LVEQIAILWSRSPLYFTSTFIDFDCNLDRTDLSIKFLKVLAKLSLP 540



>gb:AP003539_1830616 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0040H10.
          Length = 1693

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 34/141 (24%), Positives = 71/141 (50%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + +L L+ + ++  G  + S+   L  I++ LF +L++     +  +   + SI + L  
Sbjct: 314 VLSLELLRTVVDNAGPFWKSNEMYLEAIKKHLFLSLLKNSALSAMSVFQLLCSIFVGLLS 373

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             R+ LK ++  FF  ++LR+  +    S+  +   +  L   C++   + +++ N+DCD
Sbjct: 374 RFRSGLKEEIGLFFPMLILRVLENVLQPSFLQKMTVLNFLEKICKEPQVIIDIFVNYDCD 433

Query: 677 ISCSNIFEDFANLLSKSSFPV 739
           +   NIFE   N L K++  V
Sbjct: 434 VDAPNIFERIVNGLVKTALGV 454



>gb:AC116984_1207340 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 2048

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 42/165 (25%), Positives = 81/165 (49%), Gaps = 1/165 (0%)
 Frame = +2

Query: 233 FLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLAL-IQEE 409
           +L  LL  +   +IS   +P   +  V +F+L LI++  +  G     +P  +   I+E 
Sbjct: 417 YLFRLLCDLSLKDISDYDSP---EVKVRIFSLELISNIFDDYGRFIKHYPSFINYEIREG 473

Query: 410 LFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQ 589
           LF +++  G S    I     ++ L++  H R  L+  +  +F+ ++LR+  S   T  Q
Sbjct: 474 LFPSVLNSGFSSHSTIFRLSLTLFLSMVVHYRDYLRDPIGQYFTLIVLRVLESPTSTLQQ 533

Query: 590 LQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
            + + ++ L   C  +  + + Y N+DC++S  +IF+     LSK
Sbjct: 534 -RWMVLQVLARICENYQILVDFYINYDCNLSSKDIFQKTIESLSK 577



>gb:AE017343_1755740 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 1526

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 40/147 (27%), Positives = 74/147 (50%), Gaps = 2/147 (1%)
 Frame = +2

Query: 134 KDEKVGQRKENANSGERS--MMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDE 307
           +DE + + +E     + +  M  PYG+P ++E+L  L +LL+  D           A+ +
Sbjct: 267 QDEMITESEEKPTEPQVNTPMFTPYGLPTILELLRVLIALLDPNDQ----------AHTD 316

Query: 308 DVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLN 487
            +   AL ++N+A+E+GG   G+ P+L   + +E  + L +   + SP +L+        
Sbjct: 317 SMRFSALAILNTALEVGGLGLGNWPELREGVTDEGCKYLFQLTRADSPSLLAQSLRTTST 376

Query: 488 LYHHLRTKLKLQLETFFSGVLLRIAHS 568
           L+  L   L+ QLE F S ++ R+  S
Sbjct: 377 LFSTLLPHLRPQLELFLSYLIDRLTPS 403



 Score = 35.0 bits (79), Expect = 1.5
 Identities = 14/56 (25%), Positives = 28/56 (50%)
 Frame = +2

Query: 587 QLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFPVNDPLS 754
           + +E+ +++L     +  FM + + NFDC     ++FE     L++  +P   P S
Sbjct: 462 ETRELMLDSLTQVALRPSFMVDCWVNFDCSTDSEDLFERLIAFLTRGVYPHGPPKS 517



>pir|T06119|T06119 hypothetical protein F23E12.60 - Arabidopsis
           thaliana>gb:ATCHRIV83_1547499 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           83.>gb:ATF23E12_1549723 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E12 (ESSA project).
          Length = 1711

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 37/137 (27%), Positives = 71/137 (51%), Gaps = 1/137 (0%)
 Frame = +2

Query: 323 ALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHL 502
           +L L+   I+ GG  + ++   +  +++ L  +L++        I     +I ++L   L
Sbjct: 328 SLELLKVIIDNGGSVWRTNESFINAVKQYLCLSLLKNSAVSIMSIFQLQCAIFMSLLSKL 387

Query: 503 RTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQH-MFMTEMYANFDCDI 679
           R+ LK ++  FF  ++LR+  +    SY LQ++ +  L+D   Q    M +++ N+DCD+
Sbjct: 388 RSVLKAEIGIFFPMIVLRVLENVLQPSY-LQKMTVLNLLDKMSQDPQLMVDIFVNYDCDV 446

Query: 680 SCSNIFEDFANLLSKSS 730
             SNI E   N L K++
Sbjct: 447 ESSNILERIVNGLLKTA 463



>gb:AP003705_1832159 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1112_E08.>gb:AP003932_1835430 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1773_H01.
          Length = 1256

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 38/160 (23%), Positives = 70/160 (43%)
 Frame = +2

Query: 245 LLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNL 424
           L   +  M +   S+ +A      L +L L+   +E   DSF  +   +  ++  L   +
Sbjct: 268 LFRTLCKMSMKEESDEVA--TKTRLLSLELLQGLLEGVSDSFTKNFHFIDSVKAYLSYAI 325

Query: 425 MRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVA 604
           +R  +S S ++      I   L    R  LK ++  FF  ++LR   S  D+    +   
Sbjct: 326 LRAAVSSSAVVFQYACGIFAVLLLRFRESLKGEIGVFFPLIVLRSLDSS-DSPLSQRASV 384

Query: 605 METLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
           +  L   C+    + +M+ N+DCD+   N+FE   + LS+
Sbjct: 385 LRMLEKVCKDSQMLADMFVNYDCDLEGPNLFERMVSALSR 424



>gb:AF129515_1243451 Paramecium tetraurelia SEC7-related protein
           (SEC7) mRNA, complete cds.
          Length = 1135

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 44/203 (21%), Positives = 91/203 (44%), Gaps = 5/203 (2%)
 Frame = +2

Query: 122 PLASKDEK---VGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNP 292
           P+ SK+ K   + Q    + S   S      +    EIL  LC L       +  P++  
Sbjct: 297 PICSKECKFIHLNQMFNFSQSHSHSTFSEQYVKDAYEILEMLCQL------SQRDPQNPQ 350

Query: 293 IAYDE-DVPLFALGLINSAIEIGGDSFGSH-PKLLALIQEELFQNLMRFGLSMSPLILST 466
           +A       + +L LI  A+         H PKL+++++E+L ++L++  LS    +L  
Sbjct: 351 LAQMIIKCKVLSLELIYEALAQSDTIILQHKPKLISILKEQLLESLLKNSLSAEKQLLIL 410

Query: 467 VTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFM 646
             +I + L   +R+ LK +LE     V  +   S + +S+  ++  ++       +   +
Sbjct: 411 TLNIFIQLIWRVRSHLKKELEALIENVYFKFLESSN-SSFDHKQYTLKVFNKILTRPKVV 469

Query: 647 TEMYANFDCDISCSNIFEDFANL 715
            E++ N+DC +  +N+ +   ++
Sbjct: 470 IEIFVNYDCSVGQNNLLKKILDM 492



>gb:CEY6B3A_1370966 Caenorhabditis elegans YAC Y6B3A, complete
           sequence.
          Length = 551

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 30/138 (21%), Positives = 67/138 (48%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           L AL ++   ++       S    + +I+  L   L R  +S +  +     +I + L  
Sbjct: 304 LLALEMLLLVLQNSSSILQSSQPCIIVIKRTLCMALTRNAVSNNIQVFEKSLAIFVELLD 363

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             +T LK  +E FF+ V+L +  S +  +++ + + + T+         + +M+ N+DCD
Sbjct: 364 KFKTHLKASIEVFFNSVILPMLDS-NTCAFEQKWIVLNTIGKILANPQSVVDMFVNYDCD 422

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++  N+F+    ++SK++
Sbjct: 423 MTSPNLFKSIVEVVSKTT 440



>gb:CEY6B3A_1370965 Caenorhabditis elegans YAC Y6B3A, complete
           sequence.>gb:CEY87G2A_1371197 Caenorhabditis elegans YAC
           Y87G2A, complete sequence.
          Length = 1628

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 30/138 (21%), Positives = 67/138 (48%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           L AL ++   ++       S    + +I+  L   L R  +S +  +     +I + L  
Sbjct: 304 LLALEMLLLVLQNSSSILQSSQPCIIVIKRTLCMALTRNAVSNNIQVFEKSLAIFVELLD 363

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             +T LK  +E FF+ V+L +  S +  +++ + + + T+         + +M+ N+DCD
Sbjct: 364 KFKTHLKASIEVFFNSVILPMLDS-NTCAFEQKWIVLNTIGKILANPQSVVDMFVNYDCD 422

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++  N+F+    ++SK++
Sbjct: 423 MTSPNLFKSIVEVVSKTT 440



>pir|T27321|T27321 hypothetical protein Y6B3A.1 - Caenorhabditis
           elegans  (fragment)
          Length = 894

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 30/138 (21%), Positives = 67/138 (48%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           L AL ++   ++       S    + +I+  L   L R  +S +  +     +I + L  
Sbjct: 304 LLALEMLLLVLQNSSSILQSSQPCIIVIKRTLCMALTRNAVSNNIQVFEKSLAIFVELLD 363

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             +T LK  +E FF+ V+L +  S +  +++ + + + T+         + +M+ N+DCD
Sbjct: 364 KFKTHLKASIEVFFNSVILPMLDS-NTCAFEQKWIVLNTIGKILANPQSVVDMFVNYDCD 422

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++  N+F+    ++SK++
Sbjct: 423 MTSPNLFKSIVEVVSKTT 440



>pir|T50338|T50338 probable guanine-nucleotide exchange factor with
           sec7 domain [imported] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC211_1719500 S.pombe
           chromosome II cosmid c211.
          Length = 1462

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 48/250 (19%), Positives = 96/250 (38%), Gaps = 45/250 (18%)
 Frame = +2

Query: 113 SSDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNP 292
           +S+  + K E+   +K        + ++P+GI  + E+   L S ++             
Sbjct: 252 ASEEHSIKGEEFHYKKITEGDEISNEIDPFGIGSIREVFRVLVSFIDFGKQK-------- 303

Query: 293 IAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVT 472
             + +++   AL  IN+A+E+ G      P L  LI + L ++L++   S    +L+   
Sbjct: 304 --FSDNIKAMALRFINTALEVSGSHISDFPSLRVLITDTLCKSLLQLIRSDHTALLTNSL 361

Query: 473 SIVLNLYHHLRTKLKLQLETFFSGVLL--------------------------------- 553
            ++  L   +   LKLQ E F S ++                                  
Sbjct: 362 LVMTTLLQAMPGSLKLQQELFISYLISCLHIPSTTPRERNVETSLHKVVSSLDLSEEISP 421

Query: 554 ------------RIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIF 697
                       R A    +   +++E+ +E L    R   F+ ++Y N+DCD   S++ 
Sbjct: 422 DRATPTSFTERKRFAFDTRNRPPEVRELIVECLGSLSRIPYFLIDLYVNYDCDPQMSDLA 481

Query: 698 EDFANLLSKS 727
            D   +L+++
Sbjct: 482 IDLLKVLTRN 491



>pir|B87990|B87990 protein Y6B3A.1 [imported] - Caenorhabditis
           elegans
          Length = 894

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 30/138 (21%), Positives = 67/138 (48%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           L AL ++   ++       S    + +I+  L   L R  +S +  +     +I + L  
Sbjct: 304 LLALEMLLLVLQNSSSILQSSQPCIIVIKRTLCMALTRNAVSNNIQVFEKSLAIFVELLD 363

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
             +T LK  +E FF+ V+L +  S +  +++ + + + T+         + +M+ N+DCD
Sbjct: 364 KFKTHLKASIEVFFNSVILPMLDS-NTCAFEQKWIVLNTIGKILANPQSVVDMFVNYDCD 422

Query: 677 ISCSNIFEDFANLLSKSS 730
           ++  N+F+    ++SK++
Sbjct: 423 MTSPNLFKSIVEVVSKTT 440



>gb:AE016820_1749808 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 1896

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 43/172 (25%), Positives = 75/172 (43%), Gaps = 12/172 (6%)
 Frame = +2

Query: 245 LLNVMDHMEISPRSNPI---AYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELF 415
           +  VM  + + P  + +   +Y     L AL +I+S +    D F SH  LL   Q    
Sbjct: 445 VFRVMSKLSVKPLDDNLDMRSYAVRSKLLALHIIHSIMRDHIDVFLSHNVLLPGKQNTTL 504

Query: 416 QNLMRFGLSM-------SPL--ILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHS 568
            N ++  L +       SP+  +      I+  L  +LR++ K ++  F + +   I+H 
Sbjct: 505 LNGVKQYLCLALARNAASPIAPVFEITFEIMWLLVSNLRSEFKREIPVFLTEIYFPISHM 564

Query: 569 KHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
           K  T +Q +   +  +   C     + E Y N+DCD S  NI E   + L++
Sbjct: 565 KSSTPHQ-KRYFLSVIQRLCNDPRTLIEFYLNYDCDSSMPNIVETVVDYLTR 615



>gb:AY144931_1583722 Saccharomyces castellii clone Contig420
           truncated GEA2 gene, partial sequence.
          Length = 627

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 54/227 (23%), Positives = 99/227 (43%), Gaps = 12/227 (5%)
 Frame = +2

Query: 92  NVAPSNVSSDPLASKDEKVGQRKENANSGERSMM------EPYGIPCMVEILHFLCSLLN 253
           N  P  +S D  AS      + +E+ NS   S++      + YGI  +    + L SL  
Sbjct: 238 NDLPIRISDDRTASNITPSIKEEESINSEVESIISDNDFDKSYGIGIIANYCNLLLSL-- 295

Query: 254 VMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRF 433
                 I P  N   +     +  L +  +  E  GD F SHPKL  L+ + +F+ ++  
Sbjct: 296 ------ILPE-NRTKHTSSSRILGLKIFTTMFETAGDVFLSHPKLFNLLSDPIFKCVLFI 348

Query: 434 -----GLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQE 598
                 +S+    L   T+I +     L+ +L+L L+  F  VLL +   ++     ++E
Sbjct: 349 IQTSDKISILEAALELFTTIAVTFGSRLKMQLELTLKYCFD-VLLDLQPKQN----IIKE 403

Query: 599 VAMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           + +E L + +     F    + ++DCD+  S+I   F  ++ + + P
Sbjct: 404 LIVEHLALLWTHSETFFLSTFISYDCDLDSSDIATRFLEIMVQLTKP 450



>pir|T05647|T05647 hypothetical protein F20D10.320 - Arabidopsis
           thaliana>gb:ATCHRIV89_1547774 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           89.>gb:ATF20D10_1549499 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20D10 (ESSA project).
          Length = 1643

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 37/147 (25%), Positives = 70/147 (47%), Gaps = 11/147 (7%)
 Frame = +2

Query: 323 ALGLINSAIEIGGDSFGSHPKLLALIQEEL--FQNLMRFGLSMSPLILSTVT-------- 472
           +L L+   I+ GG  + S  + L L  +++  F N ++  L +S L  S ++        
Sbjct: 307 SLELLKVIIDNGGPIWLSDERQLTLPPQKICRFLNAIKQLLCLSLLKNSALSVMSIFQLQ 366

Query: 473 -SIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
            +I   L    R+ +K ++  FF  ++LR+  +    S+  +   +  L + C     + 
Sbjct: 367 CAIFTTLLRKYRSGMKSEVGIFFPMLVLRVLENVLQPSFVQKMTVLSLLENICHDPNLII 426

Query: 650 EMYANFDCDISCSNIFEDFANLLSKSS 730
           +++ NFDCD+   NIFE   N L K++
Sbjct: 427 DIFVNFDCDVESPNIFERIVNGLLKTA 453



>pir|T49244|T49244 guanine nucleotide-exchange-like protein -
           Arabidopsis thaliana>gb:ATF7K15_1551023 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F7K15.
          Length = 1669

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 8/144 (5%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           + +L L+   +E    SF  +   +  ++  L   L+R  +S S +I    + I   L  
Sbjct: 361 ILSLELLQGMLEGVSHSFTKNFHFIDSVKAYLSYALLRASVSQSSVIFQYASGIFSVLLL 420

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTS--------YQLQEVAMETLVDFCRQHMFMTE 652
             R  LK ++  FF  ++LR   +    +        Y +  +    L   C+    + +
Sbjct: 421 RFRDSLKGEIGIFFPIIVLRSLDNSECPNDQKMGVLRYNIFLLVQMMLEKVCKDPQMLVD 480

Query: 653 MYANFDCDISCSNIFEDFANLLSK 724
           +Y N+DCD+   N+FE     LSK
Sbjct: 481 VYVNYDCDLEAPNLFERMVTTLSK 504



>gb:AE017344_1756205 Cryptococcus neoformans var. neoformans JEC21
            chromosome 4, complete sequence.
          Length = 2016

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 1/131 (0%)
 Frame = +2

Query: 335  INSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKL 514
            +N  + I  +S       L   ++ L  +L R  LS    +      I   +   +R +L
Sbjct: 650  VNPLVCIPSNSSLEMTPFLQATKQYLALSLSRNALSPVNQVFELSVEIFWCMLKDMRAQL 709

Query: 515  KLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD-ISCSN 691
            K ++E   + + + I   +H T  Q + + +   +  C     + E+Y N+DCD  S  N
Sbjct: 710  KKEIEVLLNEIFIPILEMRHSTIRQ-KSIILGVFIRLCHDPQALVEIYINYDCDRSSLEN 768

Query: 692  IFEDFANLLSK 724
            I+E   N++SK
Sbjct: 769  IYERLMNIVSK 779



>gb:CR382131_1664263 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 1499

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 19/52 (36%), Positives = 32/52 (61%)
 Frame = +2

Query: 581 SYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
           S +++E  +ETL   CR+  F  E++ NFDCD+   N+ E+    L +S++P
Sbjct: 550 SPEIREAMVETLSTLCREPYFFAELFLNFDCDVDRVNLCENMMQFLCRSAYP 601



>gb:BX897674_1644324 Neurospora crassa DNA linkage group IV BAC clone
            B2N18.
          Length = 1626

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 61/286 (21%), Positives = 116/286 (40%), Gaps = 57/286 (19%)
 Frame = +2

Query: 50   AESNHKAPSDEGSVNVAPSNV---SSDPLASKDEKVGQRKENANSGERSM----MEPYGI 208
            A+ N +  +   S +  PS      +   +S       R+ + +SG  S     + PY +
Sbjct: 346  AQGNERPGTATSSADPRPSTAVETENGDRSSTASAADARRSSTSSGTGSTASIDLRPYSL 405

Query: 209  PCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKL 388
            P + E+   L S LN  D      R +P    + + + AL +I+ A+E+ G S   HP L
Sbjct: 406  PSVRELFRVLVSFLNPHD------RKHP----DQMRVMALRIIHVALEVAGPSIARHPAL 455

Query: 389  LALIQEE----LFQ-------NLMRFGLSMSPLILST---VTSIVLNLYHH-----LRTK 511
              + +++    LFQ        +++  L ++  +LST   V  +   LY       L   
Sbjct: 456  ATIAEDQLCSYLFQLVRSDNMAVLQEALVVAGTLLSTCRGVLKLQQELYLSYLVACLHPA 515

Query: 512  LKLQLE-----TFFSGV-----LLRIAHSKHDTSYQL---------------------QE 598
            +++  E     + +SG+     L++   S+  +                         ++
Sbjct: 516  VEIPREPGIDPSLYSGIPQAPKLVKPPPSQAGSGRSTPVPVKDRQKLGLEGGARKPDARQ 575

Query: 599  VAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSKSSFP 736
              +E +    R   FM E++ N+DCD    ++ ED   LL++++ P
Sbjct: 576  AMVENIGVLVRMPSFMVELFVNYDCDEDRVDLCEDLIGLLARNALP 621



>gb:CR382134_1667381 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1846

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 51/258 (19%), Positives = 103/258 (39%), Gaps = 30/258 (11%)
 Frame = +2

Query: 47   NAESNHKAPSDEGSVNVAPSNVSSDPLASKDEKVGQR---------KENANSGER----- 184
            +A  N  + SD  S   +P N+S + + S +E   +R          ++ N  +R     
Sbjct: 316  SAMRNKSSKSDSNSNIKSPQNMSEEVVNSVEETTQERLTLENLEKINDDTNDNDRVNEAN 375

Query: 185  ---SMMEPYGIPCMVEILHFLCSL-LNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIE 352
                  E   +     I   +C L +  ++   +  RS+ +       L +L +I++ ++
Sbjct: 376  KATEKDEDLVVKDAFLIFRAMCKLSVKPLESDALDMRSHSVRSK----LLSLHIIHTVLK 431

Query: 353  IGGDSFGSHP------------KLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
               + F SH             +L+  +++ +  +L R   S    +      I   +  
Sbjct: 432  EHIEIFLSHDVVILSSHSNEQTRLINAVRQYVCLSLSRNAASSLAPVFELSLEIFWLIIS 491

Query: 497  HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
            +LR++ K ++  F+  +   +A  K  T +Q +   +  +   C     + E Y N+DCD
Sbjct: 492  NLRSEFKREIPVFWDEIYFPVAEMKTSTPHQ-KRYLLSIIEKLCNDSRCIIEFYLNYDCD 550

Query: 677  ISCSNIFEDFANLLSKSS 730
             S  N+ E   + L+K S
Sbjct: 551  SSMPNVCEKVIDYLTKLS 568



>gb:AY762831_1350312 Tetrahymena thermophila guanine nucleotide
           exchange factor (SEC7) gene, complete cds; macronuclear.
          Length = 2053

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/136 (19%), Positives = 67/136 (49%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYH 496
           +  L +I +  ++   +F    + + +I+E+LF  +++  L+    I S    I L L  
Sbjct: 519 VITLEMIYAIFDLRDSTFFRKEQAIKVIKEKLFDGILKCCLNNEKSIFSLSFGIFLQLLI 578

Query: 497 HLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCD 676
           + + + K ++  F + + L++  S + +S   + +A++ L    ++   + + Y N+DC 
Sbjct: 579 YHKEEFKNEISIFINEIFLQLLESPNSSSNH-RHLALQVLNKAFQKTRVVLDFYVNYDCS 637

Query: 677 ISCSNIFEDFANLLSK 724
            +   + +   ++LSK
Sbjct: 638 FNQVQLVDRIVSILSK 653



>gb:CR380951_1649969 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 1825

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 39/145 (26%), Positives = 59/145 (40%), Gaps = 9/145 (6%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHP---------KLLALIQEELFQNLMRFGLSMSPLILSTV 469
           L +L LI S +    D F SH           LL  I++ L  +L R   S    +  T 
Sbjct: 388 LLSLQLIYSMLRDHIDVFLSHHIYLPGKEKVTLLDSIRQYLCLSLSRNAASPLSAVFETT 447

Query: 470 TSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
             I+  +  +LR   K ++  F + +   I   K  T+ Q +   +  +   C     + 
Sbjct: 448 LEIMWLMIANLRADFKREIPVFLTEIYFPITELKTSTAQQ-KRYFLHIIQRLCTDPRALI 506

Query: 650 EMYANFDCDISCSNIFEDFANLLSK 724
           E Y N+DCD    NI E   + LSK
Sbjct: 507 EFYLNYDCDPGMPNITEMLVDYLSK 531



>gb:CR380959_1653998 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 1310

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 34/182 (18%), Positives = 82/182 (45%), Gaps = 9/182 (4%)
 Frame = +2

Query: 203 GIPCMVEILHFLCSLLNVMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHP 382
           G+P +   L  L SLL +    +         + + V      LI   IE+ G      P
Sbjct: 291 GLPVIKRYLQLLLSLLTIDQDNK---------HTKQVKALGFSLIICGIEVAGKDIILFP 341

Query: 383 KLLALIQEELFQNLMR-----FGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGV 547
            L +++ +++F+ ++      +   +  + L    ++ +N+  +LR +++L        +
Sbjct: 342 SLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIELTFSHICDIL 401

Query: 548 L---LRIAHSKHDTSYQLQEVAMETL-VDFCRQHMFMTEMYANFDCDISCSNIFEDFANL 715
           L   +        T  +L+E+ +E++ + + R+  ++ + + N+DC+++      D AN+
Sbjct: 402 LDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLNRM----DLANI 457

Query: 716 LS 721
           +S
Sbjct: 458 IS 459



>gb:CR382124_1657091 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 1848

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 27/113 (23%), Positives = 50/113 (44%)
 Frame = +2

Query: 386 LLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAH 565
           L+  + + L  +L R   S    +      I+  +  +LR++ K ++  F + +   IA 
Sbjct: 429 LVHAVNQYLCLSLARNAASPIAPVYEITLEIMWLIISNLRSEFKREIPVFLTDIYFPIAD 488

Query: 566 SKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLLSK 724
            K  T++Q +   +  +   C     + E Y N+DCD    N+ E   N L+K
Sbjct: 489 LKSSTNHQ-KRYFLSIIQRVCNDPRTLIEFYLNYDCDSHMPNVVELIINYLTK 540



>sp|Q9P7V5|SC72_SCHPO Protein transport protein
           sec72.>pir|T50207|T50207 probable protein transport
           protein [imported] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPAC30_1717649 S.pombe chromosome I cosmid
           c30.
          Length = 1822

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 1/110 (0%)
 Frame = +2

Query: 422 LMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEV 601
           L R  +S  P +      I   +   LR   K ++E FF  V   +   K+ TSY  +  
Sbjct: 468 LSRNAVSPVPQVFEVCCDIFYLMVFSLRAHFKQEIEVFFREVYFPMLDLKN-TSYNQKLH 526

Query: 602 AMETLVDFCRQHMFMTEMYANFDCD-ISCSNIFEDFANLLSKSSFPVNDP 748
            +  +   C     + E+Y N+DCD  S +N+FE    L S S    N P
Sbjct: 527 TLLIIQRICLNPRALVELYINYDCDRSSTTNVFEQL--LFSISKVTTNGP 574



>gb:BC044050_2548455 Xenopus laevis similar to ubiquitin specific
           protease 1, mRNA (cDNA clone IMAGE:5572674), partial
           cds.
          Length = 294

 Score = 39.7 bits (91), Expect = 0.060
 Identities = 23/80 (28%), Positives = 42/80 (52%)
 Frame = +2

Query: 116 SDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPI 295
           S+ ++ K E V + +E     +    E   +P   E++  L SL++ M+H++IS  SNP 
Sbjct: 119 SEIISKKVENVSKEREQTQDKDTVKHE---LPASYEVISSLSSLIHSMEHLKISFLSNPD 175

Query: 296 AYDEDVPLFALGLINSAIEI 355
            YD ++      L+N+  E+
Sbjct: 176 NYDSELAAQPRRLLNTLREV 195



>gb:CR382130_1663283 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 1861

 Score = 39.3 bits (90), Expect = 0.078
 Identities = 23/107 (21%), Positives = 47/107 (43%)
 Frame = +2

Query: 398 IQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHD 577
           +++ +   L +   S++P +      I   L  +LR + K +++   + V   I   K  
Sbjct: 559 VRQYICLTLAKNASSITPAVFELSAEIFWLLLSNLRGQFKKEIDVVLTEVYFHIVEMKTS 618

Query: 578 TSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDFANLL 718
           T++Q +   +  +   C     + E++ N+DC     NI+E   N L
Sbjct: 619 TAHQ-KLYFLGIISRLCNDPRALVEVFLNYDCTRGVGNIYETLINYL 664



>gb:AY136340_1581841 Arabidopsis thaliana putative protein
           (At5g23110) mRNA, complete cds.>gb:BT000162_1634440
           Arabidopsis thaliana putative protein (At5g23110) mRNA,
           complete cds.
          Length = 620

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 56/214 (26%), Positives = 86/214 (40%), Gaps = 17/214 (7%)
 Frame = +2

Query: 77  DEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNV 256
           D G  +V     + D L+   +  G R+ N N           +  ++EILHFLC  +N 
Sbjct: 77  DLGLNDVLSVAAAKDILSKLQKLCGYRRLNPNE----------LRAVMEILHFLCDEINT 126

Query: 257 MDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGS-HPKLLALIQEELFQNLM-- 427
               EI    N I  D  VP     L+++   +  DSFGS + + +   +  L   L+  
Sbjct: 127 TKPPEI----NTIKSDVIVPDDGCRLVHALSCVYVDSFGSRYVRYIDTARLRLVHPLLPE 182

Query: 428 RFGLSMSPLILSTVTSIVLNLYHHLRT------------KLKLQLETFFSGV--LLRIAH 565
           R  L +    LS V    L    H+ T            + KLQ ETF + +  + R A 
Sbjct: 183 RICLDLGVRKLSDVVIEELENAEHIETLDNIGSISLKAVRRKLQSETFQAALWTVSRQAT 242

Query: 566 SKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANF 667
           +  D S+   EV   +L     +  F+  +Y  F
Sbjct: 243 TVDDLSF---EVMQHSLQSAAEKIGFVRNIYTRF 273



>gb:AB006708_1510055 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MYJ24.
          Length = 4706

 Score = 38.1 bits (87), Expect = 0.17
 Identities = 56/214 (26%), Positives = 86/214 (40%), Gaps = 17/214 (7%)
 Frame = +2

Query: 77   DEGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNV 256
            D G  +V     + D L+   +  G R+ N N           +  ++EILHFLC  +N 
Sbjct: 4163 DLGLNDVLSVAAAKDILSKLQKLCGYRRLNPNE----------LRAVMEILHFLCDEINT 4212

Query: 257  MDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGS-HPKLLALIQEELFQNLM-- 427
                EI    N I  D  VP     L+++   +  DSFGS + + +   +  L   L+  
Sbjct: 4213 TKPPEI----NTIKSDVIVPDDGCRLVHALSCVYVDSFGSRYVRYIDTARLRLVHPLLPE 4268

Query: 428  RFGLSMSPLILSTVTSIVLNLYHHLRT------------KLKLQLETFFSGV--LLRIAH 565
            R  L +    LS V    L    H+ T            + KLQ ETF + +  + R A 
Sbjct: 4269 RICLDLGVRKLSDVVIEELENAEHIETLDNIGSISLKAVRRKLQSETFQAALWTVSRQAT 4328

Query: 566  SKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANF 667
            +  D S+   EV   +L     +  F+  +Y  F
Sbjct: 4329 TVDDLSF---EVMQHSLQSAAEKIGFVRNIYTRF 4359



>gb:BC081032_2561941 Xenopus laevis MGC81700 protein, mRNA (cDNA
           clone MGC:81700 IMAGE:6864910), complete cds.
          Length = 766

 Score = 36.6 bits (83), Expect = 0.51
 Identities = 20/80 (25%), Positives = 42/80 (52%)
 Frame = +2

Query: 116 SDPLASKDEKVGQRKENANSGERSMMEPYGIPCMVEILHFLCSLLNVMDHMEISPRSNPI 295
           S+ ++ K E + + +E     +    E   +P   +++  L SL++ M+H++I+  SNP 
Sbjct: 118 SEIISKKAENISKEREQTQDKDTVKHE---LPASYDVICSLSSLVHSMEHLQITFLSNPE 174

Query: 296 AYDEDVPLFALGLINSAIEI 355
            YD ++      L+N+  E+
Sbjct: 175 NYDSELAAQPRRLLNTLREV 194



>gb:AE014187_938873 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014822_1227949 Plasmodium falciparum 3D7
           chromosome 14 section 7 of 13 of the complete sequence.
          Length = 3384

 Score = 36.2 bits (82), Expect = 0.66
 Identities = 36/163 (22%), Positives = 80/163 (49%), Gaps = 5/163 (3%)
 Frame = +2

Query: 233 FLCSLLNVMDHMEISPR--SNPIAYD--EDVPLFALGLINSAIEIGGDSF-GSHPKLLAL 397
           F+  LLN  D++ +      N ++++  E++ + +  L+N  +EI G S    +   ++ 
Sbjct: 377 FVLDLLNKKDYINLYNELFENEMSHENLENINILSFSLLNILMEIYGYSLINKNFDSISN 436

Query: 398 IQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHD 577
           I   LF ++     S S +++       +N++   +    +  E F + +L  +   K  
Sbjct: 437 IIRCLFIHIT----SSSYVLICKALRSYINIFILYKKHFFIYNEIFINILLNTL---KKG 489

Query: 578 TSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDISCSNIFEDF 706
           +S  + E A+ TL  FC +++   E+Y N+D ++  S++ ++F
Sbjct: 490 SSKNITETALLTLSHFCLENVLF-EIYYNYDVNLYASDLLQNF 531



>gb:AF265459_1781905 Pleurothallis costaricensis trnK gene, intron
           sequence; and maturase (matK) gene, complete cds;
           chloroplast genes for chloroplast products.
          Length = 517

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 15/41 (36%), Positives = 26/41 (63%)
 Frame = +3

Query: 6   VKLLGMDNLTVVLLMQNLITRHHRMKVLLMWLLQMYPQTRW 128
           V++LG DN + ++L++ LITR ++ K L+ WL      + W
Sbjct: 51  VEILGYDNKSSLVLVKRLITRMYQQKSLIYWLNDSNQNSFW 91



>gb:AE017341_1754590 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 1669

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 10/127 (7%)
 Frame = +2

Query: 320 FALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSMSPL--ILSTVTSIVLNLY 493
           FAL L+ S +    D     P+LL L+Q  L   L++  L+  P   I   V  ++  L 
Sbjct: 253 FALELVESILSGYEDGVKKRPELLFLLQHSLHPLLLKL-LAEKPTFPIALRVCRLIFLLI 311

Query: 494 HHLRTKLKLQLETFFSGVLL--------RIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
                +L  ++ET+   ++              K +T   L+ +A+E L   C  +  + 
Sbjct: 312 RSFIDQLPKEIETYLVSLVKLGTGDAEGEEGKGKENTPPWLKALALEILRGICGDYALLQ 371

Query: 650 EMYANFD 670
            +Y ++D
Sbjct: 372 NIYTHYD 378



>gb:YSCSEC7_1730564 Yeast (S.cerevisaie) Sec7 gene encoding a
           protein required for membrane traffic from the yeast
           Golgi apparatus, complete cds.
          Length = 2009

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 9/145 (6%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSM-------SPL--ILSTV 469
           L +L +I S I+   D F SH   L   +   F + +R  L +       SPL  +    
Sbjct: 530 LLSLHIIYSIIKDHIDVFLSHNIFLPGKERVCFIDSIRQYLRLVLSRNAASPLAPVFEVT 589

Query: 470 TSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
             I+  L  +LR     ++  F + +   I+     TS Q +   +  +   C     + 
Sbjct: 590 LEIMWLLIANLRADFVKEIPVFLTEIYFPISELTTSTSQQ-KRYFLSVIQRICNDPRTLV 648

Query: 650 EMYANFDCDISCSNIFEDFANLLSK 724
           E Y N+DC+    N+ E   + L++
Sbjct: 649 EFYLNYDCNPGMPNVMEITVDYLTR 673



>gb:SC9489_1705942 S.cerevisiae chromosome IV cosmid 9489.
          Length = 1806

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 9/145 (6%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSM-------SPL--ILSTV 469
           L +L +I S I+   D F SH   L   +   F + +R  L +       SPL  +    
Sbjct: 327 LLSLHIIYSIIKDHIDVFLSHNIFLPGKERVCFIDSIRQYLRLVLSRNAASPLAPVFEVT 386

Query: 470 TSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
             I+  L  +LR     ++  F + +   I+     TS Q +   +  +   C     + 
Sbjct: 387 LEIMWLLIANLRADFVKEIPVFLTEIYFPISELTTSTSQQ-KRYFLSVIQRICNDPRTLV 445

Query: 650 EMYANFDCDISCSNIFEDFANLLSK 724
           E Y N+DC+    N+ E   + L++
Sbjct: 446 EFYLNYDCNPGMPNVMEITVDYLTR 470



>sp|P11075|SEC7_YEAST Protein transport protein
           SEC7.>pir|S49764|S49764 SEC7 protein - yeast
           (Saccharomyces cerevisiae)
          Length = 2009

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 9/145 (6%)
 Frame = +2

Query: 317 LFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRFGLSM-------SPL--ILSTV 469
           L +L +I S I+   D F SH   L   +   F + +R  L +       SPL  +    
Sbjct: 530 LLSLHIIYSIIKDHIDVFLSHNIFLPGKERVCFIDSIRQYLRLVLSRNAASPLAPVFEVT 589

Query: 470 TSIVLNLYHHLRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMT 649
             I+  L  +LR     ++  F + +   I+     TS Q +   +  +   C     + 
Sbjct: 590 LEIMWLLIANLRADFVKEIPVFLTEIYFPISELTTSTSQQ-KRYFLSVIQRICNDPRTLV 648

Query: 650 EMYANFDCDISCSNIFEDFANLLSK 724
           E Y N+DC+    N+ E   + L++
Sbjct: 649 EFYLNYDCNPGMPNVMEITVDYLTR 673



>gb:AF265464_1781909 Stelis argentata trnK gene, intron sequence;
           and maturase (matK) gene, complete cds; chloroplast
           genes for chloroplast products.
          Length = 517

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 14/32 (43%), Positives = 24/32 (75%)
 Frame = +3

Query: 6   VKLLGMDNLTVVLLMQNLITRHHRMKVLLMWL 101
           V++LG DN + ++L++ LITR ++ K L+ WL
Sbjct: 51  VEILGYDNKSSLVLVKRLITRMYQQKSLIYWL 82



>gb:SPAC4D7_1717928 S.pombe chromosome I cosmid c4D7.
          Length = 1570

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +2

Query: 500 LRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDC-D 676
           L+   K +LE FF+ +   I   +  +S Q + V +      C +   + E+Y N+DC  
Sbjct: 480 LKNFFKSELEVFFTEIFFPILEMR-TSSNQQKIVLLNIFHRMCEEPQTLIELYLNYDCIS 538

Query: 677 ISCSNIFEDFANLLSK-SSFPVNDP 748
            +  NI+E     LS+ +S   +DP
Sbjct: 539 GNTENIYERAIVTLSRIASQSTSDP 563



>pir|T38792|T38792 probable protein transport protein sec7 homolog -
           fission yeast (Schizosaccharomyces pombe) (fragment)
          Length = 1570

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +2

Query: 500 LRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDC-D 676
           L+   K +LE FF+ +   I   +  +S Q + V +      C +   + E+Y N+DC  
Sbjct: 480 LKNFFKSELEVFFTEIFFPILEMR-TSSNQQKIVLLNIFHRMCEEPQTLIELYLNYDCIS 538

Query: 677 ISCSNIFEDFANLLSK-SSFPVNDP 748
            +  NI+E     LS+ +S   +DP
Sbjct: 539 GNTENIYERAIVTLSRIASQSTSDP 563



>sp|Q9UT02|SC71_SCHPO Protein transport protein
           sec71.>pir|T39252|T39252 probable protein transport
           protein - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAP8A3_1718618 S.pombe chromosome I p1 p8A3.
          Length = 1811

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
 Frame = +2

Query: 500 LRTKLKLQLETFFSGVLLRIAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDC-D 676
           L+   K +LE FF+ +   I   +  +S Q + V +      C +   + E+Y N+DC  
Sbjct: 480 LKNFFKSELEVFFTEIFFPILEMR-TSSNQQKIVLLNIFHRMCEEPQTLIELYLNYDCIS 538

Query: 677 ISCSNIFEDFANLLSK-SSFPVNDP 748
            +  NI+E     LS+ +S   +DP
Sbjct: 539 GNTENIYERAIVTLSRIASQSTSDP 563



>gb:CNS07EGF_1373955 chromosome VIII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 261

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 21/101 (20%), Positives = 46/101 (45%)
 Frame = +2

Query: 377 HPKLLALIQEELFQNLMRFGLSMSPLILSTVTSIVLNLYHHLRTKLKLQLETFFSGVLLR 556
           H + L L+QE     L++  L      L  + S    L+  ++T  +L+L+   + +  +
Sbjct: 17  HDRYLNLLQE---MRLLKEDLLEDKCRLDKLVSTSNMLFKRIKTSSELKLDAKITALSTK 73

Query: 557 IAHSKHDTSYQLQEVAMETLVDFCRQHMFMTEMYANFDCDI 679
           +A ++ +    L+++   TLV+  R+ +         DC +
Sbjct: 74  LACTRMEKDINLEDITPGTLVELARKDLLHDFYRYAMDCSV 114



>gb:CR543861_105144 Acinetobacter sp. ADP1 complete genome.
          Length = 732

 Score = 32.3 bits (72), Expect = 9.6
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 11/171 (6%)
 Frame = +2

Query: 80  EGSVNVAPSNVSSDPLASKDEKVGQRKENANSGERSMMEP--YGIPCMVEILHFLCSLLN 253
           +G+ N+    +   P+ S    + +   NAN+G RS      +G+  ++ +L F+  L+N
Sbjct: 294 QGTGNIVSGFIGGMPITSV---IVRSSVNANTGARSKCSTIIHGVLLLLAVLFFV-PLMN 349

Query: 254 VMDHMEISPRSNPIAYDEDVPLFALGLINSAIEIGGDSFGSHPKLLALIQEELFQNLMRF 433
           +                  +PL AL  I   + + G    +HPK+   + ++ ++  + F
Sbjct: 350 M------------------IPLSALAAI---LILTGFKL-THPKMFKKLYQQGWKQFIPF 387

Query: 434 GLSMSPLILSTV---------TSIVLNLYHHLRTKLKLQLETFFSGVLLRI 559
            +++  ++L+ +         TSI   LY +L   +++  E    GV+ RI
Sbjct: 388 IITLVAILLTDLLIGILIGLATSIAFILYGNLHKGVRVYKEKHLHGVITRI 438


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 833,307,935
Number of Sequences: 1806583
Number of extensions: 18252942
Number of successful extensions: 48244
Number of sequences better than 10.0: 81
Number of HSP's better than 10.0 without gapping: 46903
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48199
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 46996930370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)