BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2919
         (702 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003904_1834994 Oryza sativa (japonica cultivar-group) genom...   129   7e-29   
gb:AP003622_1831603 Oryza sativa (japonica cultivar-group) genom...   125   6e-28   
pir|T07714|T07714 probable ABC-type transport protein T23J7.80 -...    95   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AB010069_1510852 Arabidopsis thaliana genomic DNA, chromosome...    92   1e-17   
gb:AP003904_1834995 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
pir|T07713|T07713 probable ABC-type transport protein T23J7.70 -...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AY099665_1576690 Arabidopsis thaliana ABC-type transport prot...    77   3e-13   
pir|T07717|T07717 probable ABC-type transport protein T23J7.110 ...    68   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP003977_1835848 Oryza sativa (japonica cultivar-group) genom...    54   3e-06   


>gb:AP003904_1834994 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1051_A08.>gb:AP003947_1835617 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1198_B10.
          Length = 929

 Score =  129 bits (323), Expect = 7e-29
 Identities = 68/172 (39%), Positives = 97/172 (56%), Gaps = 3/172 (1%)
 Frame = +1

Query: 196 SMAEGPASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPS 375
           S + G A F TQANALLRKNL FQ+RN++TN  +  FP              N+E++KP 
Sbjct: 8   SSSRGAAGFATQANALLRKNLCFQRRNMKTNACITVFPVFLCVILVVLQGVINHEINKPK 67

Query: 376 RRCGCICIDTNGDGKCEK-KCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDF 552
            +CGC C+D   DG C + +CG+E+STL+Q  SC                 E RAV+   
Sbjct: 68  YQCGCACVDAAPDGTCRRTECGVEHSTLDQVGSCPIKSPTPWPALVQVPRPESRAVRIAS 127

Query: 553 ITYKDLPEESCKTTGSCPAAILLTGANQTFAERIGGNFFNGT--TLNSSDIL 702
             +  LP+ +C+ TGSCPA++L+TG N++ A+ + G  F     +LN +D L
Sbjct: 128 QPFDGLPDPTCRDTGSCPASVLVTGMNRSLAQSLWGGLFPAVPPSLNFTDYL 179



>gb:AP003622_1831603 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0633E08.
          Length = 949

 Score =  125 bits (315), Expect = 6e-28
 Identities = 68/165 (41%), Positives = 88/165 (53%)
 Frame = +1

Query: 196 SMAEGPASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPS 375
           ++A  P SF  Q NALLRKNL FQKRN +  + LI  P              N+ LDKP 
Sbjct: 6   AVASRPPSFTAQTNALLRKNLIFQKRNRKGTIRLIIVPIYLCLLLTILQRVINSVLDKPK 65

Query: 376 RRCGCICIDTNGDGKCEKKCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDFI 555
            RCGC C+D NG G C+  CGI+YSTL+QA SC                 EYRA+Q   +
Sbjct: 66  FRCGCKCVDVNGTGSCQNVCGIQYSTLDQAGSCPIPNPPEWPALLQLPRPEYRAMQESSL 125

Query: 556 TYKDLPEESCKTTGSCPAAILLTGANQTFAERIGGNFFNGTTLNS 690
            Y   P+ SC+ + SC A I  TGAN+T +  +  N F  + L++
Sbjct: 126 -YAGFPDVSCRKSQSCAATIPFTGANETLSNIVMQNLFTSSPLSN 169



>pir|T07714|T07714 probable ABC-type transport protein T23J7.80 -
           Arabidopsis thaliana>gb:ATT23J7_1555372 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T23J7.
          Length = 895

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 56/137 (40%), Positives = 72/137 (52%), Gaps = 2/137 (1%)
 Frame = +1

Query: 211 PASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPS-RRCG 387
           PASF T+ANAL RKNLT+QKRN+ +N+ LI  P              + +++  +  RCG
Sbjct: 6   PASFLTRANALFRKNLTYQKRNIWSNVRLIVIPFYLCVLLVGIQVLFDTQVNNSADNRCG 65

Query: 388 CICIDTNGDGKCEKK-CGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDFITYK 564
           C CI  NGDGKCE+K CG++YS+L QA+ C                 E R V        
Sbjct: 66  CRCIHKNGDGKCERKSCGLQYSSLTQASFCAFPNPPPLLPLLQIPRPETRLV-------- 117

Query: 565 DLPEESCKTTGSCPAAI 615
           D    SC+ TGSCP  I
Sbjct: 118 DPARSSCRRTGSCPGTI 134



>gb:AB010069_1510852 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAC9.
          Length = 907

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 58/164 (35%), Positives = 79/164 (48%), Gaps = 1/164 (0%)
 Frame = +1

Query: 214 ASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPSRRCGCI 393
           ASFW QANALLRKNLT+Q+R++ TN+ L+  P              +  ++K +    C 
Sbjct: 7   ASFWAQANALLRKNLTYQRRHIWTNIRLVLVPLLLCLFLLGIQLLLDVVVNKAADLTKCG 66

Query: 394 CIDTNGDGKCEKKCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDFITYKDLP 573
             D    G C          L Q                     E RAV   F +Y DLP
Sbjct: 67  SQDDFSIGDCPIPNPPLLPPLLQIPE-----------------PESRAVSGGFFSYNDLP 109

Query: 574 EESCKTTGSCPAAILLTGANQTFAERIGGNFFNGT-TLNSSDIL 702
           ++SC+ TG+CP  ILLTG N +  + + GN F G+  +NSSD+L
Sbjct: 110 DKSCRKTGTCPVTILLTGNNHSLGQALSGNMFGGSFAVNSSDLL 153



>gb:AP003904_1834995 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1051_A08.>gb:AP003947_1835618 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1198_B10.
          Length = 956

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 51/164 (31%), Positives = 74/164 (45%), Gaps = 5/164 (3%)
 Frame = +1

Query: 193 LSMAEGPASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKP 372
           ++ A   + F+ Q +ALL KNL+FQ+RN + N  + +FP              + ELD+P
Sbjct: 1   MAAAGSCSRFFRQVHALLLKNLSFQRRNAKANAAIAAFPALLCVLLVTIQAVIDGELDRP 60

Query: 373 SRRCGCICIDTNGD----GKC-EKKCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRA 537
             RCGC C+  +G     G C   +CG+++ST  QA SC                  YRA
Sbjct: 61  PFRCGCACVRRDGGRAGAGACAATECGVQHSTATQALSCAVPAPPRWPAVTQVPDEPYRA 120

Query: 538 VQNDFITYKDLPEESCKTTGSCPAAILLTGANQTFAERIGGNFF 669
           +             S  +   CP A+L TG N+   E +G  FF
Sbjct: 121 LTPVHPARCRGDGGSGASEAPCPVAVLTTGQNRRLTEGLGRGFF 164



>pir|T07713|T07713 probable ABC-type transport protein T23J7.70 -
           Arabidopsis thaliana>gb:ATT23J7_1555371 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T23J7.
          Length = 925

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 52/151 (34%), Positives = 67/151 (44%), Gaps = 5/151 (3%)
 Frame = +1

Query: 265 QKRNVRTNLWLISFPXXX----XXXXXXXXXXXNNELDKPSRRCGCICIDTNGDGKCEKK 432
           QKRN+ +N+ LI  P                  NN LD    +CGC CID  GDGKC+  
Sbjct: 12  QKRNIWSNVRLIMIPFYLCIVLVFIQALFDSQVNNSLDN---QCGCQCIDKLGDGKCQMT 68

Query: 433 CGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDFITYKDLPEESCKTTGSCPAA 612
           CG+EYST +Q   C                 EYRA+  +F        +SC+   SCP  
Sbjct: 69  CGLEYSTRDQGFFCAIPKPQPWPPLILIPRPEYRALDANF------TNDSCRRKNSCPVT 122

Query: 613 ILLTGANQTFAERIGGNFFNGT-TLNSSDIL 702
           IL TG N +    +  N       +NSSD+L
Sbjct: 123 ILFTGNNHSLGAVLSRNLLRRPFAMNSSDLL 153



>gb:AY099665_1576690 Arabidopsis thaliana ABC-type transport
           protein-like protein (At3g47790) mRNA, complete cds.
          Length = 901

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 54/163 (33%), Positives = 73/163 (44%)
 Frame = +1

Query: 211 PASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPSRRCGC 390
           PASF TQA+ALLRKNL FQKRN+ +N+ LI+ P              + + +    +CGC
Sbjct: 6   PASFLTQADALLRKNLVFQKRNIWSNIRLITIPFFLCLLLLVIQMLFDTQFNDVHGQCGC 65

Query: 391 ICIDTNGDGKCEKKCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAVQNDFITYKDL 570
                      EK CG+ YST EQAA C                 EYRA     I Y   
Sbjct: 66  ----------NEKTCGLRYSTSEQAAFCAIPNPPQWTPLLQIPAPEYRAA----IPY--- 108

Query: 571 PEESCKTTGSCPAAILLTGANQTFAERIGGNFFNGTTLNSSDI 699
                  + + PA  L TG NQ+    + GN ++ ++    D+
Sbjct: 109 ------PSHTSPATFLFTGNNQSLGNILMGNMYSNSSGFDGDL 145



>pir|T07717|T07717 probable ABC-type transport protein T23J7.110 -
           Arabidopsis thaliana>gb:ATT23J7_1555375 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T23J7.
          Length = 900

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 2/119 (1%)
 Frame = +1

Query: 352 NNELDKPSRRCGCICIDTNGDGKCEKK-CGIEYSTLEQAASCXXXXXXXXXXXXXXXXXE 528
           NN  D    RCGC CI+ N  GKC+++ CG+E+S  +QA  C                 E
Sbjct: 22  NNSADN---RCGCECIERNRAGKCQRELCGLEHSKPDQAFFCSIPRPPLWPPLLQIPRPE 78

Query: 529 YRAVQNDFITYKDLPEESCKTTGSCPAAILLTGANQTFAERIGGNFF-NGTTLNSSDIL 702
            R V+        L ++SC+ TGSCP  IL TG N++    +  N F +  + N+S+IL
Sbjct: 79  SRDVRG-------LRDDSCRRTGSCPVTILFTGNNRSLGTTVSENLFTSSVSANASEIL 130



>gb:AP003977_1835848 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1006_A02.
          Length = 919

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 50/168 (29%), Positives = 67/168 (39%), Gaps = 6/168 (3%)
 Frame = +1

Query: 214 ASFWTQANALLRKNLTFQKRNVRTNLWLISFPXXXXXXXXXXXXXXNNELDKPSRRCGCI 393
           AS   Q NAL RK+L  Q+R  +TN  ++ FP              N E+ +        
Sbjct: 3   ASCLAQTNALFRKSLVIQRRAGKTNCCIVLFPLLLFSAIGGLQIAINVEMLREF--AAAA 60

Query: 394 CIDTNGDGKCEKKCGIEYSTLEQAASCXXXXXXXXXXXXXXXXXEYRAV-QNDFITYK-D 567
            ID  G G            L+    C                 E RAV   D ++   D
Sbjct: 61  SIDCGGCGGGVAVAANATGGLDCPTRCALPRAPKWPPLLQIPPPERRAVGDGDLLSSAGD 120

Query: 568 LPEE-SCKTTGSCPAAILLTGANQTFAERIGGNFF---NGTTLNSSDI 699
           LP+  SC+  GSC AA L+TG N++F  R+  N F   N +    SDI
Sbjct: 121 LPDAASCRAAGSCAAAFLVTGGNRSFVARVMDNMFPAHNSSAKLPSDI 168


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 655,358,067
Number of Sequences: 1806583
Number of extensions: 12649996
Number of successful extensions: 31739
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 30736
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31722
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 40692000384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)