BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2877
         (600 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:PFMAL13_1191105 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   1.2     
gb:PFA929356_1393290 Plasmodium falciparum strain 3D7, chromosom...    34   2.1     
gb:PFMAL13_1191711 Plasmodium falciparum 3D7 chromosome 13, *** ...    33   4.7     
gb:AE014187_938515 Plasmodium falciparum 3D7 chromosome 14 compl...    32   6.1     
sp|P34769|RK20_ASTLO|RK20_ASTLO Chloroplast 50S ribosomal protein L20.>pir|...    32   6.1     Euglena longa


>gb:PFMAL13_1191105 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 213

 Score = 34.7 bits (78), Expect = 1.2
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = -1

Query: 453 ILSQNNISE-LNISKPTNI**THLKARQSNQRTLKANNLSYFHT--EKFSSFMISSLCLT 283
           IL++NN +  LN +   NI     K    N++ L  N L  F T  +K+  F  +S+   
Sbjct: 71  ILNENNKNNILNENNKNNILNESNKNNILNEKEL-LNFLDRFTTINKKYKGFCETSVFKN 129

Query: 282 QKFNSNFTNTR*KEFKVDSYFTKAVYFDRSKLNKNLQASPKICQVLYILHLYLYSNFLYN 103
             F+SN  N    E+  D  F   +  D+ K + + + S K  Q     +L+LY+N +YN
Sbjct: 130 SSFSSNMKN----EYS-DGTFNTYLVIDKWKNHNDFEKSKKEFQ-----NLFLYNNDIYN 179

Query: 102 HELK 91
            +++
Sbjct: 180 KKMQ 183



>gb:PFA929356_1393290 Plasmodium falciparum strain 3D7, chromosome
           9; segment 2/5.
          Length = 1261

 Score = 33.9 bits (76), Expect = 2.1
 Identities = 28/136 (20%), Positives = 52/136 (38%), Gaps = 28/136 (20%)
 Frame = -1

Query: 390 HLKARQSNQRTLKANNLSYFHTEKFSSFMISSLCLTQKFNSNFT-----NTR*KEFKVDS 226
           H K ++   R LK N+  ++H    ++F          FNS F      N   K   ++ 
Sbjct: 97  HKKKKEKKNRMLKDNHHYHYHHHNNNNFT--------NFNSRFNQIIIYNVILKNDIIND 148

Query: 225 YFTKAVYFDRSKLNKNLQASPKICQVLYILHLY-----------------------LYSN 115
            + + ++FD   L+  +  +   C ++  L ++                       +YSN
Sbjct: 149 IYLEVLFFDLDALSNVILNNSYGCMMINYLQIFYKKLKRVHIKNKLINLYTSKINNIYSN 208

Query: 114 FLYNHELKVAKGYLVH 67
            L+ H  K  K +L+H
Sbjct: 209 LLFYHTYKNKKNFLLH 224



>gb:PFMAL13_1191711 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 646

 Score = 32.7 bits (73), Expect = 4.7
 Identities = 20/75 (26%), Positives = 30/75 (40%)
 Frame = -1

Query: 378 RQSNQRTLKANNLSYFHTEKFSSFMISSLCLTQKFNSNFTNTR*KEFKVDSYFTKAVYFD 199
           R SN  T   NN ++ +         +S  +    NSNF N      +   Y  K  YFD
Sbjct: 52  RNSNISTFNNNNFTFMNFNNLKVENKNSQHVYFNRNSNFNNNIKDNIRSSIYSNKQNYFD 111

Query: 198 RSKLNKNLQASPKIC 154
           +  +N N   + + C
Sbjct: 112 QDNINYNTLINSQTC 126



>gb:AE014187_938515 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014816_1227591 Plasmodium falciparum 3D7
            chromosome 14 section 1 of 13 of the complete sequence.
          Length = 1025

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 6/130 (4%)
 Frame = -1

Query: 474  HLFQKLYILSQ--NNISELNISKPTNI**THLKARQSNQRTLKANNLSYFHTEKFSSFMI 301
            + F+ LY   Q  N+I+++NI+   NI   +      +   +  NN+ Y +++   +   
Sbjct: 662  YYFENLYEKKQINNDINDININNTHNINNNNNNNNNIHNIIINNNNIHYINSDNIKNV-- 719

Query: 300  SSLCLTQKFNSNFTNTR*KEFKVDSY----FTKAVYFDRSKLNKNLQASPKICQVLYILH 133
                    F  N  N+    FK+  +      K   FD+  + +NL+    I ++L+  +
Sbjct: 720  -------DFKFNHMNSSNNSFKLLKHKNICIPKNNTFDKYVI-QNLEHFHNILKILFFWN 771

Query: 132  LYLYSNFLYN 103
              LY NF  N
Sbjct: 772  FELYKNFRKN 781



>sp|P34769|RK20_ASTLO Chloroplast 50S ribosomal protein
           L20.>pir|S38601|S38601 ribosomal protein L20 - euglenid
           (Astasia longa) plastid>gb:ALO294725_1819050 Astasia
           longa complete chloroplast genome.
          Length = 117

 Score = 32.3 bits (72), Expect = 6.1
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 3/62 (4%)
 Frame = -1

Query: 279 KFNSNFTNTR*KEFKVDSY-FTKAVYFDRSKLNKNLQASPKIC--QVLYILHLYLYSNFL 109
           K +  F  +  K FK+ +    KA+YF  S   K  +++ KI   ++ Y L  Y ++NF 
Sbjct: 19  KLSKGFIGSNSKIFKISNQKIMKALYFSFSDRKKKKRSNKKIWINRINYFLKNYFFNNFN 78

Query: 108 YN 103
           YN
Sbjct: 79  YN 80


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 536,254,717
Number of Sequences: 1806583
Number of extensions: 9252257
Number of successful extensions: 19788
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 19464
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19785
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 29868035661
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)