BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2846
         (813 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:STPPC1_1722877 S.tuberosum ppc1 gene.                              343   2e-93   
pir|S40304|S40304 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   343   2e-93   Solanum tuberosum [potatoes]
sp|P29196|CAPP_SOLTU|CAPP_SOLTU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   343   2e-93   Solanum tuberosum [potatoes]
gb:AB078718_1523750 Nicotiana sylvestris Nsppc1 gene for phospho...   343   2e-93   
gb:LES243416_1684494 Lycopersicon esculentum mRNA for phosphoeno...   342   5e-93   
sp|P27154|CAPP_TOBAC|CAPP_TOBAC Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   340   1e-92   Nicotiana tabacum [American tobacco]
gb:AB078720_1523752 Nicotiana sylvestris Nsppc3 gene for phospho...   340   2e-92   
gb:CSA417435_1673831 Cucumis sativus partial mRNA for phosphoeno...   338   9e-92   
pir|T09846|T09846 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   335   5e-91   Gossypium hirsutum [American cotton]
gb:AF248080_1780629 Flaveria trinervia phosphoenolpyruvate carbo...   333   2e-90   
gb:AF248079_1780628 Flaveria trinervia phosphoenolpyruvate carbo...   333   2e-90   
gb:AB078719_1523751 Nicotiana sylvestris Nsppc2 gene for phospho...   333   2e-90   
gb:CSA417436_1673832 Cucumis sativus partial mRNA for phosphoeno...   333   3e-90   
gb:AF008940_1761056 Gossypium hirsutum phosphoenolpyruvate carbo...   331   9e-90   
pir|T09847|T09847 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   331   9e-90   Gossypium hirsutum [American cotton]
gb:AB092821_1525120 Lotus corniculatus var. japonicus LjPEPC2 mR...   330   1e-89   
gb:AF314923_1785361 Phaseolus vulgaris phosphoenolpyruvate carbo...   329   3e-89   
gb:VFA011303_1727074 Vicia faba mRNA for phosphoenolpyruvate-car...   329   3e-89   
pir|S52853|S52853 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   329   3e-89   Flaveria pringlei
sp|Q01647|CAP1_FLAPR|CAP1_FLAPR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   329   3e-89   Flaveria pringlei
gb:AF494192_1805149 Flaveria pubescens phosphoenolpyruvate carbo...   329   4e-89   
gb:AF159051_1773194 Picea abies phosphoenolpyruvate carboxylase ...   328   7e-89   
sp|P51063|CAPP_PICAB|CAPP_PICAB Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   328   7e-89   Picea abies
sp|Q02909|CAP1_SOYBN|CAP1_SOYBN Phosphoenolpyruvate carboxylase, housekeepi...   328   7e-89   Glycine max [soybeans]
gb:AF494191_1805148 Flaveria brownii phosphoenolpyruvate carboxy...   328   1e-88   
pir|S68416|S68416 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   327   2e-88   Kalanchoe blossfeldiana
pir|S68415|S68415 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   327   2e-88   Kalanchoe blossfeldiana
gb:AP003913_1835124 Oryza sativa (japonica cultivar-group) genom...   326   3e-88   
gb:AY187619_1588160 Oryza sativa (indica cultivar-group) phospho...   326   3e-88   
gb:STU011844_1722943 Solanum tuberosum ppc2 gene.                     326   4e-88   
gb:STPPC2_1722878 S.tuberosum ppc2 gene.                              326   4e-88   
gb:BT004642_1637676 Arabidopsis thaliana At3g14940 gene, complet...   325   5e-88   
pir|T52186|T52186 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   325   5e-88   Arabidopsis thaliana [mouse-ear cress]
gb:AP005802_1858075 Oryza sativa (japonica cultivar-group) genom...   325   6e-88   
sp|P16097|CAP2_MESCR|CAP2_MESCR Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   325   8e-88   Mesembryanthemum crystallinum
gb:AY663386_1620487 Lupinus albus phosphoenolpyruvate carboxylas...   324   1e-87   
gb:AF512995_1807386 Citrus junos phosphoenolpyruvate carboxylase...   323   2e-87   
gb:DFAJ2942_1675831 Dendrobium fimbriatum partial mRNA for phosp...   323   2e-87   
gb:PAM300742_1698747 Phalaenopsis amabilis partial ppc gene for ...   323   3e-87   
gb:PEQ300741_1699811 Phalaenopsis equestris partial ppc gene for...   322   7e-87   
sp|Q9MAH0|CAPP_ARATH|CAPP_ARATH Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   322   7e-87   Arabidopsis thaliana [mouse-ear cress]
sp|P29194|CAP2_SORBI|CAP2_SORBI Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   322   7e-87   Sorghum bicolor [broomcorn]
gb:AF459644_1801729 Lupinus albus phosphoenolpyruvate carboxylas...   321   1e-86   
gb:LBI312670_1683972 Leptotes bicolor partial mRNA for phosphoen...   321   1e-86   
gb:AY563044_1615006 Glycine max phosphoenolpyruvate carboxylase ...   321   1e-86   
sp|Q42730|CAPP_FLAAU|CAPP_FLAAU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   321   1e-86   
sp|P30694|CAP2_FLATR|CAP2_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   321   1e-86   Flaveria trinervia
sp|Q01648|CAP1_FLATR|CAP1_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   321   1e-86   Flaveria trinervia
gb:AP003409_1828980 Oryza sativa (japonica cultivar-group) genom...   320   2e-86   
gb:VPL312626_1727323 Vanilla planifolia partial mRNA for phospho...   320   2e-86   
gb:VPL312624_1727321 Vanilla planifolia partial mRNA for phospho...   320   2e-86   
gb:VPAJ2929_1727311 Vanilla pompona partial mRNA for phosphoenol...   320   2e-86   
pir|S18318|S18318 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   320   2e-86   Flaveria trinervia
gb:AF236126_1779583 Vitis vinifera PEP carboxylase (GPEPC) mRNA,...   320   3e-86   
gb:AF271163_1782130 Hydrilla verticillata phosphoenolpyruvate ca...   319   3e-86   
sp|P29193|CAP1_SACHY|CAP1_SACHY Phosphoenolpyruvate carboxylase, housekeepi...   319   3e-86   Saccharum sp.
gb:AF271161_1782128 Hydrilla verticillata phosphoenolpyruvate ca...   319   4e-86   
gb:LES313434_1684576 Lycopersicon esculentum ppc2 gene for phosp...   318   8e-86   
gb:LES243417_1684495 Lycopersicon esculentum mRNA for phosphoeno...   318   8e-86   
gb:ETI312659_1677067 Euphorbia tirucalli partial mRNA for phosph...   318   1e-85   
sp|P51059|CAP2_MAIZE|CAP2_MAIZE Phosphoenolpyruvate carboxylase 2 (EC 4.1.1...   318   1e-85   Zea mays [maize]
gb:ATH532902_1552867 Arabidopsis thaliana mRNA for phosphoenolpy...   317   1e-85   
gb:AY210895_1589694 Arabidopsis thaliana phosphoenolpyruvate car...   317   2e-85   
gb:KPI312652_1683760 Kalanchoe pinnata partial mRNA for phosphoe...   316   4e-85   
gb:KPI312651_1683759 Kalanchoe pinnata partial mRNA for phosphoe...   316   4e-85   
sp|Q02735|CAPP_MEDSA|CAPP_MEDSA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   316   4e-85   Medicago sativa [alfalfa]
gb:TAE7705_1724514 Triticum aestivum PEPC gene.                       315   5e-85   
gb:KSAJ2925_1683786 Kalanchoe streptantha partial mRNA for phosp...   315   5e-85   
gb:KPI312650_1683758 Kalanchoe pinnata partial mRNA for phosphoe...   315   5e-85   
gb:BRJ223496_1634162 Brassica juncea mRNA for phosphoenolpyruvat...   315   5e-85   
gb:AY349298_1601537 Hordeum vulgare subsp. spontaneum NPGS PI 21...   315   5e-85   
pir|T08138|T08138 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   315   5e-85   Brassica napus [oilseed rape]
gb:ETI312658_1677066 Euphorbia tirucalli partial mRNA for phosph...   315   6e-85   
gb:ETI312657_1677065 Euphorbia tirucalli partial mRNA for phosph...   315   6e-85   
gb:BRJ223497_1634163 Brassica juncea mRNA for phosphoenolpyruvat...   315   6e-85   
gb:KBRNAPCC4_1683425 K.blossfeldiana mRNA for phosphoenolpyruvat...   314   1e-84   
gb:VAAJ2928_1726953 Vanilla aphylla partial mRNA for phosphoenol...   313   2e-84   
gb:KDA312632_1683434 Kalanchoe daigremontiana partial mRNA for p...   313   3e-84   
gb:KPI312647_1683755 Kalanchoe pinnata partial mRNA for phosphoe...   312   5e-84   
gb:VPAJ2930_1727312 Vanilla phalaenopsis partial mRNA for phosph...   311   7e-84   
gb:KPI312648_1683756 Kalanchoe pinnata partial mRNA for phosphoe...   311   7e-84   
gb:KBRNAPPC3_1683428 K.blossfeldiana mRNA for phosphoenolpyruvat...   311   7e-84   
gb:KDA312635_1683437 Kalanchoe daigremontiana partial mRNA for p...   311   9e-84   
gb:AY663387_1620488 Lupinus albus phosphoenolpyruvate carboxylas...   310   2e-83   
gb:KDA312633_1683435 Kalanchoe daigremontiana partial mRNA for p...   310   2e-83   
gb:AB055075_1521415 Oryza sativa (japonica cultivar-group) mRNA ...   310   2e-83   
gb:MCR312641_1685818 Mesembryanthemum crystallinum partial mRNA ...   310   3e-83   
gb:KFE312681_1683458 Kalanchoe fedtschenkoi partial mRNA for pho...   310   3e-83   
gb:GLE310350_1680265 Gnetum leyboldii partial mRNA for phosphoen...   309   4e-83   
gb:EST400987_1676973 Epidendrum stamfordianum partial mRNA for p...   309   5e-83   
gb:DPA17844_1676004 Drosanthemum paxianum mRNA for phosphoenolpy...   309   5e-83   
gb:AB085948_1524434 Eleocharis vivipara pep1 mRNA for phosphoeno...   308   6e-83   
sp|P10490|CAP1_MESCR|CAP1_MESCR Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   308   8e-83   Mesembryanthemum crystallinum
gb:KFE312683_1683460 Kalanchoe fedtschenkoi partial mRNA for pho...   308   1e-82   
gb:AF271162_1782129 Hydrilla verticillata phosphoenolpyruvate ca...   307   2e-82   
gb:AP004117_1837801 Oryza sativa (japonica cultivar-group) genom...   306   2e-82   
gb:AF271995_1782197 Oryza sativa phosphoenolpyruvate carboxylase...   306   2e-82   
gb:TAPEPC_1724601 Triticum aestivum mRNA for phosphoenolpyruvate...   306   4e-82   
pir|T06547|T06547 probable phosphoenolpyruvate carboxylase (EC 4...   306   4e-82   Triticum aestivum [Canadian hard winter wheat]
gb:AY663388_1620489 Lupinus albus phosphoenolpyruvate carboxylas...   305   7e-82   
gb:AY491400_1608695 Setaria italica C3 phosphoenolpyruvate carbo...   305   7e-82   
sp|P51061|CAP2_SOYBN|CAP2_SOYBN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   305   7e-82   Glycine max [soybeans]
pir|JH0381|JH0381 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   305   9e-82   Sorghum bicolor [broomcorn]
gb:SRO286750_1722426 Sesbania rostrata mRNA for phosphoenolpyruv...   304   1e-81   
gb:CUV312637_1674373 Clusia uvitana partial mRNA for phosphoenol...   304   1e-81   
gb:CUV312636_1674372 Clusia uvitana partial mRNA for phosphoenol...   304   1e-81   
gb:AB097087_1525935 Glycine max GmPEPC15 gene for phosphoenolpyr...   304   1e-81   
gb:AB092820_1525119 Lotus corniculatus var. japonicus LjPEPC1 mR...   304   1e-81   
sp|P29195|CAP1_SORBI|CAP1_SORBI Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   304   1e-81   Sorghum bicolor [broomcorn]
gb:CRE312616_1673268 Cycas revoluta partial mRNA for phosphoenol...   303   2e-81   
gb:AB012228_1511657 Zea mays mRNA for phosphoenolpyruvate carbox...   303   2e-81   
gb:AB008540_1510531 Glycine max mRNA for phosphoenolpyruvate car...   303   2e-81   
gb:VFA011302_1727073 Vicia faba mRNA for phosphoenolpyruvate-car...   303   3e-81   
gb:AB097088_1525936 Glycine max GmPEPC7 gene for phosphoenolpyru...   303   3e-81   
gb:PCA312612_1699093 Pinus caribaea partial mRNA for phosphoenol...   303   3e-81   
gb:ZDR312615_1731371 Zamia dressleri partial mRNA for phosphoeno...   302   4e-81   
gb:MEX312661_1686022 Microcoelia exilis partial mRNA for phospho...   302   4e-81   
gb:KPAJ2922_1683748 Kalanchoe pinnata partial mRNA for phosphoen...   302   4e-81   
gb:LBI312668_1683970 Leptotes bicolor partial mRNA for phosphoen...   302   6e-81   
gb:CUV312639_1674375 Clusia uvitana partial mRNA for phosphoenol...   302   6e-81   
gb:AEX312622_1760468 Araucaria excelsa partial mRNA for phosphoe...   301   1e-80   
gb:AY251482_1592766 Echinochloa crus-galli phosphoenolpyruvate c...   301   1e-80   
gb:AEX312619_1760465 Araucaria excelsa partial mRNA for phosphoe...   301   1e-80   
gb:SWI17843_1723284 Selenicereus wittii mRNA for phosphoenolpyru...   301   1e-80   
gb:MCR312640_1685817 Mesembryanthemum crystallinum partial mRNA ...   300   2e-80   
pir|H84855|H84855 phosphoenolpyruvate carboxylase [imported] - A...   300   3e-80   Arabidopsis thaliana [mouse-ear cress]
gb:SAP312665_1704746 Solenangis aphylla partial mRNA for phospho...   299   4e-80   
gb:TUS312654_1726111 Tillandsia usneoides partial mRNA for phosp...   298   6e-80   
gb:TUS312653_1726110 Tillandsia usneoides partial mRNA for phosp...   298   6e-80   
gb:GBI312614_1679700 Ginkgo biloba partial mRNA for phosphoenolp...   298   6e-80   
gb:CUV312638_1674374 Clusia uvitana partial mRNA for phosphoenol...   298   6e-80   
gb:AEX312621_1760467 Araucaria excelsa partial mRNA for phosphoe...   298   8e-80   
sp|Q9AU12|CAPP_PHAVU|CAPP_PHAVU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   298   1e-79   Phaseolus vulgaris [French bean]
gb:AF135371_1771078 Lotus corniculatus phosphoenol pyruvate carb...   297   1e-79   
gb:MEX312662_1686023 Microcoelia exilis partial mRNA for phospho...   297   1e-79   
gb:VPPPCGE1_1727330 V.planifolia mRNA for phosphoenolpyruvate ca...   297   2e-79   
gb:TUS312656_1726112 Tillandsia usneoides partial mRNA for phosp...   297   2e-79   
gb:MCR312642_1685819 Mesembryanthemum crystallinum partial mRNA ...   297   2e-79   
gb:MEX312663_1686024 Microcoelia exilis partial mRNA for phospho...   296   2e-79   
gb:VPL312625_1727322 Vanilla planifolia partial mRNA for phospho...   296   4e-79   
gb:WWPPC_1727779 W.mirabilis mRNA for phosphoenolpyruvate carbox...   295   7e-79   
gb:MCR312643_1685820 Mesembryanthemum crystallinum partial mRNA ...   294   1e-78   
gb:KSAJ1303_1683783 Kalanchoe streptantha partial mRNA for phosp...   294   1e-78   
gb:PCA312613_1699094 Pinus caribaea partial mRNA for phosphoenol...   293   2e-78   
gb:DFAJ2943_1675832 Dendrobium fimbriatum partial mRNA for phosp...   293   2e-78   
gb:KGAJ1288_1683470 Kalanchoe gracilipes partial mRNA for phosph...   293   3e-78   
gb:DFAJ2940_1675830 Dendrobium farmeri partial mRNA for phosphoe...   293   3e-78   
gb:VPPPCGEN_1727331 V.planifolia mRNA for phosphoenolpyruvate ca...   293   3e-78   
gb:KPAJ1295_1683744 Kalanchoe petitiana partial mRNA for phospho...   292   4e-78   
pir|S68413|S68413 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   292   4e-78   Kalanchoe blossfeldiana
gb:AEX312620_1760466 Araucaria excelsa partial mRNA for phosphoe...   292   6e-78   
gb:HVU65227_1682833 Hydrilla verticillata phosphoenolpyruvate ca...   292   6e-78   
gb:PAPPC1_1698836 Pereskia aculeata mRNA for phosphoenolpyruvate...   291   8e-78   
gb:ABA312674_1529727 Aloe vera partial mRNA for phosphoenolpyruv...   291   8e-78   
gb:ACO312630_1745386 Ananas comosus partial mRNA for phosphoenol...   291   1e-77   
gb:ABA312673_1529726 Aloe vera partial mRNA for phosphoenolpyruv...   291   1e-77   
gb:CSP310348_1674035 Cupressus sp. HHG-2001 partial mRNA for pho...   291   1e-77   
gb:ACO312628_1745384 Ananas comosus partial mRNA for phosphoenol...   290   2e-77   
gb:DFAJ2939_1675829 Dendrobium farmeri partial mRNA for phosphoe...   290   2e-77   
gb:DTAJ2936_1676189 Dendrobium thyrsifolium partial mRNA for pho...   290   2e-77   
gb:SSP318338_1722549 Saccharum spontaneum mRNA for putative C4 p...   290   3e-77   
gb:MCR312644_1685821 Mesembryanthemum crystallinum partial mRNA ...   290   3e-77   
gb:AY135709_1581780 Saccharum hybrid cultivar putative C4 phosph...   290   3e-77   
sp|P51062|CAPP_PEA|CAPP_PEA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)...   290   3e-77   Pisum sativum [garden pea]
gb:DDAJ2944_1675796 Dendrobium delicatum partial mRNA for phosph...   289   4e-77   
gb:ACO312631_1745387 Ananas comosus partial mRNA for phosphoenol...   289   5e-77   
pir|S68414|S68414 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...   289   5e-77   Kalanchoe blossfeldiana
gb:AF530570_1809082 X Mokara cv. 'Yellow' phosphoenolpyruvate ca...   288   6e-77   
gb:SOF293346_1715673 Saccharum officinarum mRNA for putative C4 ...   288   6e-77   
gb:LBI312672_1683974 Leptotes bicolor partial mRNA for phosphoen...   288   8e-77   
gb:DMAJ2941_1675960 Dendrobium moschatum partial mRNA for phosph...   288   8e-77   
gb:LBI312671_1683973 Leptotes bicolor partial mRNA for phosphoen...   287   1e-76   
gb:VPAJ2931_1727313 Vanilla phalaenopsis partial mRNA for phosph...   286   2e-76   
gb:ZMPEP_1731956 Z.mays gene for phosphoenolpyruvate carboxylase...   286   3e-76   
gb:ZMA536629_1731578 Zea mays mRNA for phosphoenolpyruvate carbo...   286   3e-76   
pir|S04546|QYZM phosphoenolpyruvate carboxylase (EC 4.1.1.31) - ...   286   3e-76   
sp|P04711|CAP1_MAIZE|CAP1_MAIZE Phosphoenolpyruvate carboxylase 1 (EC 4.1.1...   286   3e-76   Zea mays [maize]
sp|Q43299|CAPP_AMAHP|CAPP_AMAHP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   286   4e-76   Amaranthus hypochondriacus [prince's feather]
gb:ZMPEPCR_1731963 Maize mRNA for phosphoenolpyruvate carboxylas...   284   1e-75   
gb:VPPPC1_1727329 Vanilla planifolia mRNA for phosphoenolpyruvat...   284   1e-75   
gb:DTAJ2935_1676188 Dendrobium thyrsifolium partial mRNA for pho...   282   5e-75   
gb:VAAJ2927_1726952 Vanilla aphylla partial mRNA for phosphoenol...   282   6e-75   
gb:AF268091_1782031 Chloris gayana phosphoenolpyruvate carboxyla...   281   8e-75   
gb:KPAJ2921_1683747 Kalanchoe pinnata partial mRNA for phosphoen...   281   8e-75   
gb:ETI312660_1677068 Euphorbia tirucalli partial mRNA for phosph...   281   1e-74   
gb:DCAJ2938_1675642 Dendrobium crumentatum partial mRNA for phos...   281   1e-74   
gb:MEPPCGENE_1686014 M.exilis mRNA for phosphoenolpyruvate carbo...   280   2e-74   
gb:KPAJ2919_1683745 Kalanchoe pinnata partial mRNA for phosphoen...   280   2e-74   
gb:DLAJ2934_1675941 Dendrobium loddigesii partial mRNA for phosp...   280   2e-74   
gb:AF495586_1805546 Setaria italica putative C4 phosphoenolpyruv...   280   3e-74   
gb:KSAJ2924_1683785 Kalanchoe streptantha partial mRNA for phosp...   280   3e-74   
gb:KPI312649_1683757 Kalanchoe pinnata partial mRNA for phosphoe...   280   3e-74   
gb:KPAJ2926_1683749 Kalanchoe petitiana partial mRNA for phospho...   280   3e-74   
gb:KKAJ2915_1683485 Kalanchoe kewensis partial mRNA for phosphoe...   280   3e-74   
gb:KBRNAPPC1_1683426 K.blossfeldiana mRNA for phosphoenolpyruvat...   280   3e-74   
gb:KGAJ2945_1683472 Kalanchoe grandiflora partial mRNA for phosp...   279   4e-74   
gb:KGAJ2918_1683471 Kalanchoe grandiflora partial mRNA for phosp...   279   4e-74   
gb:KFE312682_1683459 Kalanchoe fedtschenkoi partial mRNA for pho...   279   4e-74   
gb:KTAJ2917_1683813 Kalanchoe tomentosa partial mRNA for phospho...   278   7e-74   
gb:KTAJ2916_1683812 Kalanchoe tomentosa partial mRNA for phospho...   278   7e-74   
gb:KFE312678_1683455 Kalanchoe fedtschenkoi partial mRNA for pho...   278   7e-74   
gb:KDA312634_1683436 Kalanchoe daigremontiana partial mRNA for p...   278   7e-74   
gb:KBRNAPPC2_1683427 K.blossfeldiana mRNA for phosphoenolpyruvat...   278   9e-74   
gb:TUPPC_1726101 T.usneoides mRNA for phosphoenolpyruvate decarb...   278   1e-73   
gb:KPAJ2920_1683746 Kalanchoe pinnata partial mRNA for phosphoen...   277   1e-73   
gb:DLAJ2933_1675940 Dendrobium loddigesii partial mRNA for phosp...   277   1e-73   
gb:KKAJ2914_1683484 Kalanchoe kewensis partial mRNA for phosphoe...   276   3e-73   
gb:KFE312680_1683457 Kalanchoe fedtschenkoi partial mRNA for pho...   275   6e-73   
sp|P15804|CAP3_SORBI|CAP3_SORBI Phosphoenolpyruvate carboxylase 3 (EC 4.1.1...   275   6e-73   Sorghum bicolor [broomcorn]
gb:VAPPCGENE_1726969 V.aphylla mRNA for phosphoenolpyruvate carb...   271   8e-72   
gb:AP003052_1824492 Oryza sativa (japonica cultivar-group) genom...   271   1e-71   
gb:SAP312667_1704748 Solenangis aphylla partial mRNA for phospho...   271   1e-71   
pir|S08216|QYMG phosphoenolpyruvate carboxylase (EC 4.1.1.31) - ...   271   1e-71   
gb:KPI312646_1683754 Kalanchoe pinnata partial mRNA for phosphoe...   270   2e-71   
gb:SAPPCGENE_1704750 S.aphylla mRNA for phosphoenolpyruvate carb...   269   5e-71   
gb:SAP312664_1704745 Solenangis aphylla partial mRNA for phospho...   268   1e-70   
gb:CRE312617_1673269 Cycas revoluta partial mRNA for phosphoenol...   266   3e-70   
gb:AEPPCGENE_1760455 A.eburneum mRNA for phosphoenolpyruvate car...   264   2e-69   
gb:NAPPC1_1688123 Neoregelia ampullacea mRNA for phosphoenolpyru...   263   4e-69   
gb:VPAJ2948_1727315 Vanilla phalaenopsis partial mRNA for phosph...   256   3e-67   
gb:SNAJ1300_1715549 Scapania nemorea partial mRNA for phosphoeno...   252   5e-66   
gb:MCAJ1292_1685728 Marchantia calcarata partial mRNA for phosph...   252   5e-66   
gb:LCAJ1289_1684004 Lunularia cruciata partial mRNA for phosphoe...   252   5e-66   
gb:PQAJ1297_1701764 Preissia quadrata partial mRNA for phosphoen...   250   3e-65   
gb:BRAJ1280_1634150 Bucegia romanica partial mRNA for phosphoeno...   246   5e-64   
gb:AEPPCGEN1_1760454 A.eburneum mRNA for phosphoenolpyruvate car...   245   6e-64   
gb:GSP310353_1680940 Sticherus bifidus partial mRNA for phosphoe...   244   1e-63   
gb:CPPPCGENE_1648686 C.pusilla mRNA for phosphoenolpyruvate carb...   244   1e-63   
gb:SSPPPC1_1722587 Sphagnum sp. HG-1998 mRNA for phosphoenolpyru...   244   2e-63   
gb:GSP310352_1680939 Sticherus bifidus partial mRNA for phosphoe...   243   2e-63   
gb:PPE243415_1701305 Prunus persica partial partial mRNA for pho...   241   2e-62   
gb:GSP310351_1680938 Sticherus bifidus partial mRNA for phosphoe...   241   2e-62   
gb:IHPPC1_1683095 Isoetes histrix mRNA for phosphoenolpyruvate c...   240   3e-62   
gb:PLO312677_1700645 Pyrrosia longifolia partial mRNA for phosph...   239   3e-62   
gb:PLO312676_1700644 Pyrrosia longifolia partial mRNA for phosph...   239   6e-62   
gb:PLO312675_1700643 Pyrrosia longifolia partial mRNA for phosph...   239   6e-62   
gb:SPAJ1301_1718551 Sphagnum palustre partial mRNA for phosphoen...   238   1e-61   
gb:DSAJ1284_1676085 Dicranum scoparium partial mRNA for phosphoe...   237   2e-61   
gb:PCAJ1294_1699107 Polytrichum commune partial mRNA for phospho...   236   3e-61   
gb:HCAJ1286_1681636 Hypnum cupressiforme partial mRNA for phosph...   236   3e-61   
gb:GSP310354_1680941 Sticherus bifidus partial mRNA for phosphoe...   236   5e-61   
gb:BPAJ1279_1633981 Bartramia pomiformis partial mRNA for phosph...   236   5e-61   
gb:LAPPC1_1683916 Lycopodium annotium mRNA for phosphoenolpyruva...   235   7e-61   
gb:JLAJ1287_1683360 Jungermannia leiantha partial mRNA for phosp...   234   1e-60   
gb:LPAJ1291_1685233 Leptobryum pyriforme partial mRNA for phosph...   234   2e-60   
gb:PNPPC_1700913 P.nudum mRNA for phosphoenolpyruvate decarboxyl...   233   2e-60   
gb:SBAJ1299_1704855 Symphyogyna brongniartii partial mRNA for ph...   233   3e-60   
gb:AB055074_1521414 Oryza sativa (japonica cultivar-group) mRNA ...   233   3e-60   
gb:FHAJ1285_1679041 Funaria hygrometrica partial mRNA for phosph...   231   9e-60   
gb:SPAJ1302_1718552 Scleropodium purum partial mRNA for phosphoe...   231   1e-59   
gb:RSAJ1298_1703983 Rhytidiadelphus squarrosus partial mRNA for ...   231   1e-59   
gb:PFAJ1296_1699916 Polytrichum formosum partial mRNA for phosph...   230   2e-59   
gb:BSAJ1281_1634212 Brachythecium salebrosum partial mRNA for ph...   230   2e-59   
gb:CCAJ1282_1645762 Calliergonella cuspidata partial mRNA for ph...   229   5e-59   
gb:LCE310347_1684012 Lycopodiella cernua partial mRNA for phosph...   228   8e-59   
gb:IDPPC1_1683009 Isoetes durieui mRNA for phosphoenolpyruvate c...   227   2e-58   
gb:MHAJ1293_1686142 Mnium hornum partial mRNA for phosphoenolpyr...   221   1e-56   
gb:LJAJ1290_1684999 Leucobryum juniperoideum partial mRNA for ph...   221   1e-56   
gb:SSP318342_1722553 Saccharum hybrid cultivar R570 partial pepc...   211   1e-53   
gb:SSP318343_1722554 Saccharum hybrid cultivar R570 partial pepc...   211   1e-53   
gb:HVU65226_1682832 Hydrilla verticillata phosphoenolpyruvate ca...   209   5e-53   
gb:SSP318339_1722550 Saccharum hybrid cultivar R570 partial pepc...   208   1e-52   
gb:SSP318340_1722551 Saccharum hybrid cultivar R570 partial pepc...   206   4e-52   
gb:DHAJ1283_1675877 Dicranella heteromalla partial mRNA for phos...   203   3e-51   
gb:CFPPC1_1646317 Chara fragalis mRNA for phosphoenolpyruvate ca...   197   3e-49   
gb:AX172585_1463014 Sequence 75 from Patent WO0144476.                184   2e-45   
gb:EHPPC13_1676540 Equisetum hyemale mRNA for phosphoenolpyruvat...   175   8e-43   
gb:CCPPC1_1645903 Conocephalum conicum mRNA for phosphoenolpyruv...   168   1e-40   
gb:VZI318583_1727555 Vetiveria zizanioides partial 3' end mRNA f...   157   2e-37   
gb:SVE293347_1723226 Sorghum verticilliflorum partial mRNA for p...   156   4e-37   
gb:CLA293348_1647721 Coix lacryma-jobi partial mRNA for putative...   155   7e-37   
gb:EAU318582_1676258 Eulalia aurea partial 3' end mRNA for putat...   151   2e-35   
gb:DTAJ2937_1676190 Dendrobium thyrsifolium partial mRNA for pho...   149   8e-35   
gb:CFPPC3_1646318 Chara fragalis mRNA for phosphoenolpyruvate ca...   139   6e-32   
gb:AY517644_1610773 Chlamydomonas reinhardtii phosphoenolpyruvat...   130   4e-29   
gb:AY517643_1610772 Chlamydomonas reinhardtii phosphoenolpyruvat...   121   1e-26   
gb:APAJ1278_1541909 Anthoceros punctatus partial mRNA for phosph...   121   1e-26   
gb:AAAJ1277_1508144 Anthoceros agrestis partial mRNA for phospho...   121   1e-26   
gb:AY563043_1615005 Glycine max phosphoenolpyruvate carboxylase ...   120   4e-26   
gb:F24J5_1677991 Arabidopsis thaliana chromosome 1 BAC F24J5 seq...   117   2e-25   
gb:ATH532903_1552868 Arabidopsis thaliana mRNA for phosphoenolpy...   117   2e-25   
pir|C96712|C96712 hypothetical protein F14K14.14 [imported] - Ar...   117   2e-25   
gb:LBI312669_1683971 Leptotes bicolor partial mRNA for phosphoen...   115   1e-24   
gb:FPPPCB_1679180 F.pringlei ppcB gene (partial).                     114   2e-24   
gb:CP000020_872484 Vibrio fischeri ES114 chromosome I, complete ...   114   2e-24   
gb:AE016827_342646 Mannheimia succiniciproducens MBEL55E, comple...   114   2e-24   
gb:FTPPCB_1679463 F.trinervia ppcB gene (partial).                    114   3e-24   
gb:CR378663_93681 Photobacterium profundum SS9; segment 1/12.         111   2e-23   
gb:AY587266_1616476 Jatropha curcas phosphoenolpyruvate carboxyl...   109   5e-23   
pir|D82049|D82049 phosphoenolpyruvate carboxylase VC2646 [import...   109   5e-23   
pir|B86087|B86087 phosphoenolpyruvate carboxylase [imported] - E...   109   5e-23   
sp|Q9KNT4|CAPP_VIBCH|CAPP_VIBCH Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   5e-23   
sp|P43920|CAPP_HAEIN|CAPP_HAEIN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   5e-23   
sp|Q8X743|CAPP_ECO57|CAPP_ECO57 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   5e-23   
sp|Q83IS7|CAPP_SHIFL|CAPP_SHIFL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   7e-23   
sp|P00864|CAPP_ECOLI|CAPP_ECOLI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   7e-23   
sp|Q8FB98|CAPP_ECOL6|CAPP_ECOL6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   109   7e-23   
gb:CSP310349_1674036 Cupressus sp. HHG-2001 partial mRNA for pho...   108   9e-23   
gb:BX936398_834753 Yersinia pseudotuberculosis IP32953 genome, c...   108   2e-22   
gb:AE017138_388868 Yersinia pestis biovar Medievalis str. 91001 ...   108   2e-22   
gb:AE013630_298641 Yersinia pestis KIM section 30 of 415 of the ...   108   2e-22   
sp|Q8ZA84|CAPP_YERPE|CAPP_YERPE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   108   2e-22   
sp|Q7MAX5|CAPP_PHOLL|CAPP_PHOLL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   108   2e-22   
gb:AP002882_1823608 Oryza sativa (japonica cultivar-group) genom...   107   2e-22   
gb:CP000026_78604 Salmonella enterica subsp. enterica serovar Pa...   107   3e-22   
sp|Q8ZKM0|CAPP_SALTY|CAPP_SALTY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   107   3e-22   
sp|Q8Z307|CAPP_SALTI|CAPP_SALTI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   107   3e-22   
sp|Q8EK30|CAPP_SHEON|CAPP_SHEON Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   106   5e-22   
sp|Q7UZT0|CAPP_PROMP|CAPP_PROMP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   106   5e-22   
sp|Q9CN89|CAPP_PASMU|CAPP_PASMU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   106   5e-22   
gb:ACO312629_1745385 Ananas comosus partial mRNA for phosphoenol...   106   6e-22   
gb:BA000031_708221 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   105   1e-21   
sp|Q87L54|CAPP_VIBPA|CAPP_VIBPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   105   1e-21   
gb:BA000037_723830 Vibrio vulnificus YJ016 DNA, chromosome I, co...   104   2e-21   
sp|Q7MH68|CAPP_VIBVY|CAPP_VIBVY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   104   2e-21   
sp|Q8DCN2|CAPP_VIBVU|CAPP_VIBVU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   104   2e-21   
gb:BX950851_838943 Erwinia carotovora subsp. atroseptica SCRI104...   104   2e-21   
sp|Q8DV10|CAPP_STRMU|CAPP_STRMU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   103   3e-21   
gb:CRE312618_1673270 Cycas revoluta partial mRNA for phosphoenol...   103   5e-21   
sp|P74299|CAPP_SYNY3|CAPP_SYNY3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   103   5e-21   
gb:AY458648_620069 Uncultured bacterium 581 clone EBAC000-69B03 ...   102   9e-21   
sp|Q94QB2|CAPP_SYNEL|CAPP_SYNEL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   102   9e-21   
sp|Q886R9|CAPP_PSESM|CAPP_PSESM Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   100   2e-20   
gb:AE008919_246236 Uncultured proteobacterium BAC EBAC000-65D09 ...   100   3e-20   
sp|Q8DPW5|CAPP_STRR6|CAPP_STRR6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   100   3e-20   
sp|Q97QX6|CAPP_STRPN|CAPP_STRPN Phosphoenolpyruvate carboxylase (EC 4.1.1.3...   100   3e-20   
gb:CR543861_105357 Acinetobacter sp. ADP1 complete genome.             99   9e-20   
sp|Q9HXV3|CAPP_PSEAE|CAPP_PSEAE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    99   9e-20   
gb:AY830136_646928 Synechococcus sp. PCC 7002 phosphoenolpyruvat...    98   2e-19   
sp|Q8E647|CAPP_STRA3|CAPP_STRA3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    98   2e-19   
pir|AE2413|AE2413 phosphoenolpyruvate carboxylase [imported] - N...    97   5e-19   
pir|A44831|A44831 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    97   5e-19   
sp|P28594|CAPP_ANASP|CAPP_ANASP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    97   5e-19   
gb:CP000024_876561 Streptococcus thermophilus CNRZ1066, complete...    96   6e-19   
gb:CP000023_874659 Streptococcus thermophilus LMG 18311, complet...    96   6e-19   
sp|P06516|CAPP_SYNP6|CAPP_SYNP6 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    96   6e-19   
gb:CP000003_860451 Streptococcus pyogenes MGAS10394, complete ge...    96   8e-19   
sp|Q8P1W7|CAPP_STRP8|CAPP_STRP8 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    96   8e-19   
sp|Q8K873|CAPP_STRP3|CAPP_STRP3 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    96   8e-19   
gb:AF346498_503252 Photorhabdus luminescens strain W14 toxin com...    96   1e-18   
gb:AE017203_404483 Lactobacillus johnsonii NCC 533, section 4 of...    94   3e-18   
sp|Q9A0U7|CAPP_STRPY|CAPP_STRPY Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    94   3e-18   
sp|Q7V561|CAPP_PROMM|CAPP_PROMM Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    93   5e-18   
sp|Q9RNU9|CAPP_STRCO|CAPP_STRCO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    91   2e-17   
sp|Q88MR4|CAPP_PSEPK|CAPP_PSEPK Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    91   2e-17   
sp|Q7NNJ7|CAPP_GLOVI|CAPP_GLOVI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    91   2e-17   
sp|Q7V9U4|CAPP_PROMA|CAPP_PROMA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    91   3e-17   
gb:CP000033_89351 Lactobacillus acidophilus NCFM, complete genome.     90   6e-17   
sp|Q59757|CAPP_RHOMR|CAPP_RHOMR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    89   1e-16   
sp|Q7U4M0|CAPP_SYNPX|CAPP_SYNPX Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    88   2e-16   
gb:SAP312666_1704747 Solenangis aphylla partial mRNA for phospho...    87   3e-16   
gb:CR555306_106020 Azoarcus sp. EbN1 complete genome.                  86   6e-16   
sp|Q7P206|CAPP_CHRVO|CAPP_CHRVO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    84   3e-15   
gb:AE014187_938712 Plasmodium falciparum 3D7 chromosome 14 compl...    84   4e-15   
sp|Q82WS3|CAPP_NITEU|CAPP_NITEU Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    84   4e-15   
sp|Q8P336|CAPP_XANCP|CAPP_XANCP Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    83   5e-15   
pir|S72765|S72765 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    83   7e-15   
sp|Q82HE3|CAPP_STRAW|CAPP_STRAW Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    83   7e-15   
sp|P46710|CAPP_MYCLE|CAPP_MYCLE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    83   7e-15   
sp|Q89R17|CAPP_BRAJA|CAPP_BRAJA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    81   3e-14   
gb:AY596297_632041 Haloarcula marismortui ATCC 43049 chromosome ...    80   6e-14   
gb:AE014295_311973 Bifidobacterium longum NCC2705, complete genome.    80   6e-14   
gb:AE013598_297497 Xanthomonas oryzae pv. oryzae KACC10331, comp...    79   8e-14   
sp|Q8PP82|CAPP_XANAC|CAPP_XANAC Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    79   8e-14   
gb:BX571662_779142 Wolinella succinogenes, complete genome; segm...    79   1e-13   
sp|P51060|CAPP_THES7|CAPP_THES7 Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    78   2e-13   
gb:AE017301_435900 Thermus thermophilus HB27 section 1 of 7 of t...    77   4e-13   
gb:AP003052_1824493 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AB008542_1510533 Glycine max mRNA for phosphoenolpyruvate car...    76   7e-13   
sp|O32483|CAPP_RHOPA|CAPP_RHOPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    76   9e-13   
gb:D89668_121217 Rhodopseudomonas palustris gene for phosphoenol...    75   1e-12   
gb:AP006618_558323 Nocardia farcinica IFM 10152 DNA, complete ge...    74   3e-12   
sp|P61449|CAPP_MYCPA|CAPP_MYCPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    71   2e-11   
gb:AB008544_1510535 Glycine max mRNA for phosphoenolpyruvate car...    70   5e-11   
pir|T05704|T05704 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    70   5e-11   
sp|Q8RQL3|CAPP_COREF|CAPP_COREF Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    69   1e-10   
gb:FTPPCC_1679465 F.trinervia ppcC gene (partial).                     69   1e-10   
gb:BA000026_694286 Mycoplasma penetrans HF-2 DNA, complete genome.     68   2e-10   
gb:AX064983_1459405 Sequence 109 from Patent WO0100844.                68   2e-10   
gb:CGL007732_846097 Corynebacterium glutamicum 3' ppc gene, secG...    68   2e-10   
gb:BX571965_790797 Burkholderia pseudomallei strain K96243, chro...    68   2e-10   
gb:BA000036_719312 Corynebacterium glutamicum ATCC 13032 DNA, co...    68   2e-10   
sp|P12880|CAPP_CORGL|CAPP_CORGL Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    68   2e-10   
gb:AB115089_13996 Corynebacterium glutamicum ppc gene for phosph...    67   3e-10   
sp|Q93MH3|CAPP_CORCT|CAPP_CORCT Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    67   3e-10   
pir|F75415|F75415 phosphoenolpyruvate carboxylase - Deinococcus ...    67   5e-10   
gb:AE017147_390956 Helicobacter hepaticus ATCC 51449 section 4 o...    66   9e-10   
sp|Q9JXG5|CAPP_NEIMB|CAPP_NEIMB Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    65   1e-09   
pir|D81953|D81953 phosphoenolpyruvate carboxylase (EC 4.1.1.31) ...    65   2e-09   
pir|S05512|QYFKG phosphoenolpyruvate carboxylase (EC 4.1.1.31) -...    65   2e-09   
sp|Q9JWH1|CAPP_NEIMA|CAPP_NEIMA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    65   2e-09   
gb:AE008692_241234 Zymomonas mobilis subsp. mobilis ZM4, complet...    64   3e-09   
sp|Q7W0D0|CAPP_BORPE|CAPP_BORPE Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    64   3e-09   
sp|Q8XWW2|CAPP_RALSO|CAPP_RALSO Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    63   8e-09   
sp|Q7WQB3|CAPP_BORBR|CAPP_BORBR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    62   1e-08   
gb:AE004969_61657 Neisseria gonorrhoeae FA 1090, complete genome.      61   2e-08   
sp|Q7WCA9|CAPP_BORPA|CAPP_BORPA Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    61   3e-08   
sp|P61448|CAPP_CORDI|CAPP_CORDI Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    59   1e-07   
sp|Q9A871|CAPP_CAUCR|CAPP_CAUCR Phosphoenolpyruvate carboxylase (EC 4.1.1.3...    56   7e-07   
gb:MEU72662_143328 Methylobacterium extorquens methylotrophy reg...    44   0.005   
gb:CR628336_111687 Legionella pneumophila str. Paris complete ge...    43   0.006   
gb:BX842647_823604 Bdellovibrio bacteriovorus complete genome, s...    43   0.008   
gb:CR628337_114622 Legionella pneumophila str. Lens complete gen...    42   0.014   
sp|Q62267|CORB_MOUSE|CORB_MOUSE Cornifin B (Small proline-rich protein 1B) ...    21   0.034   
gb:AE017354_459973 Legionella pneumophila subsp. pneumophila str...    40   0.040   
gb:CP000020_871152 Vibrio fischeri ES114 chromosome I, complete ...    39   0.089   
gb:AE012919_287107 Chlorobium tepidum TLS section 140 of 194 of ...    36   0.99    
pir|S23948|A45456 NADH2 dehydrogenase (ubiquinone) (EC 1.6.5.3) ...    36   0.99    
sp|P29915|NQO3_PARDE|NQO3_PARDE NADH-quinone oxidoreductase chain 3 (EC 1.6...    36   0.99    
gb:AY234137_601018 Streptococcus pyogenes strain D488 streptokin...    35   1.3     
gb:AY234129_601010 Streptococcus pyogenes strain 88-019 streptok...    35   1.3     
gb:AE014169_305175 Streptococcus pyogenes MGAS315, section 34 of...    35   1.3     
gb:AB073400_1523177 Brassica napus mitochondrial linear plasmid ...    34   2.9     
gb:A20016_1447867 SEQ ID NO: 24; Nucleotide sequence for strepto...    34   3.8     
gb:A20015_1447866 SEQ ID NO: 23; Nucleotide sequence for methion...    34   3.8     
gb:A20009_1447865 SEQ ID NO: 17; OmpAL fused to a mature strepto...    34   3.8     
gb:A20006_1447864 SEQ ID NO: 14; Streptokinase gene.                   34   3.8     
gb:AY368335_613602 Streptococcus dysgalactiae subsp. equisimilis...    34   3.8     
gb:S46536_168623 SKC-2=streptokinase [Streptococcus equisimilis,...    34   3.8     
pir|S02724|S02724 streptokinase A precursor - Streptococcus pyog...    34   3.8     
sp|P10520|STRP_STRPY|STRP_STRPY Streptokinase A precursor.>gb:AE006620_2207...    34   3.8     
sp|P00779|STRP_STREQ|STRP_STREQ Streptokinase C precursor.>pir|A22801|A2280...    34   3.8     
gb:AY045887_1561396 Arabidopsis thaliana unknown protein (At4g36...    33   4.9     
pir|F85436|F85436 hypothetical protein AT4g36970 [imported] - Ar...    33   4.9     
gb:AP004380_1841027 Oryza sativa (japonica cultivar-group) genom...    33   6.4     
gb:SME591792_187007 Sinorhizobium meliloti 1021 complete chromos...    33   6.4     
sp|P08080|HEM1_RHIME|HEM1_RHIME 5-aminolevulinic acid synthase (EC 2.3.1.37...    33   6.4     
gb:BX248585_763873 Blochmannia floridanus complete genome; segme...    33   8.4     


>gb:STPPC1_1722877 S.tuberosum ppc1 gene.
          Length = 965

 Score =  343 bits (881), Expect = 2e-93
 Identities = 168/192 (87%), Positives = 180/192 (93%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL+M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL+DKLLVS+DLWSFGE LRS YE+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALFDKLLVSEDLWSFGELLRSKYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDPDY VT RPHISK+Y+++K A ELV LNPTS+YAPGLEDTLILT
Sbjct: 894  TTLNVCQAYTLKRIRDPDYSVTPRPHISKEYMEAKPATELVNLNPTSEYAPGLEDTLILT 953

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 954  MKGIAAGMQNTG 965



>pir|S40304|S40304 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            potato  (fragment)
          Length = 956

 Score =  343 bits (881), Expect = 2e-93
 Identities = 168/192 (87%), Positives = 180/192 (93%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL+M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 765  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDP 824

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL+DKLLVS+DLWSFGE LRS YE+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 825  GIAALFDKLLVSEDLWSFGELLRSKYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 884

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDPDY VT RPHISK+Y+++K A ELV LNPTS+YAPGLEDTLILT
Sbjct: 885  TTLNVCQAYTLKRIRDPDYSVTPRPHISKEYMEAKPATELVNLNPTSEYAPGLEDTLILT 944

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 945  MKGIAAGMQNTG 956



>sp|P29196|CAPP_SOLTU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:STPPC_1722876 S.tuberosum ppc mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  343 bits (881), Expect = 2e-93
 Identities = 168/192 (87%), Positives = 180/192 (93%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL+M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL+DKLLVS+DLWSFGE LRS YE+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALFDKLLVSEDLWSFGELLRSKYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDPDY VT RPHISK+Y+++K A ELV LNPTS+YAPGLEDTLILT
Sbjct: 894  TTLNVCQAYTLKRIRDPDYSVTPRPHISKEYMEAKPATELVNLNPTSEYAPGLEDTLILT 953

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 954  MKGIAAGMQNTG 965



>gb:AB078718_1523750 Nicotiana sylvestris Nsppc1 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 750

 Score =  343 bits (880), Expect = 2e-93
 Identities = 168/192 (87%), Positives = 181/192 (94%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI KDIKNL+M QEMYN WPFFRVTIDLVEMVFAKG+P
Sbjct: 559  FAWTQTRFHLPVWLGFGAAFKYAINKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGNP 618

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAALYDKLLVS+DLWSFGE+LRSNYE+TKSLLLQIAGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 619  SIAALYDKLLVSEDLWSFGEQLRSNYEETKSLLLQIAGHKDLLEGDPYLRQRLRLRDSYI 678

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP+Y VT RPHISK+Y++SK A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 679  TTLNVCQAYTLKRIRDPNYSVTPRPHISKEYMESKPAAELVKLNPTSEYAPGLEDTLILT 738

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 739  MKGIAAGMQNTG 750



>gb:LES243416_1684494 Lycopersicon esculentum mRNA for
            phosphoenolpyruvate carboxylase 1 (ppc1 gene).
          Length = 964

 Score =  342 bits (877), Expect = 5e-93
 Identities = 169/192 (88%), Positives = 180/192 (93%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL+M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL+DKLLVS+DL SFGE LRSNYE+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 833  GIAALFDKLLVSEDLLSFGELLRSNYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDPDY VT RPHISK+Y++SK A ELV LNPTS+YAPGLEDTLILT
Sbjct: 893  TTLNVCQAYTLKRIRDPDYSVTPRPHISKEYMESKPATELVNLNPTSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>sp|P27154|CAPP_TOBAC Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S17440|QYNT phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - common
            tobacco>gb:NTPPC_1691705 N.tabacum mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 964

 Score =  340 bits (873), Expect = 1e-92
 Identities = 167/192 (86%), Positives = 181/192 (94%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI KDIKNL+MF EMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKYAIDKDIKNLRMFHEMYNEWPFFRVTIDLVEMVFAKGNP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DL  FGE LRSNYE+T+SLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 833  GIAALYDKLLVSEDLLPFGELLRSNYEETRSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLN+ QAYTLKRIRDP+YHVTLRPHISKDY++SK A ELV+LNPTS+YAPGLEDTLILT
Sbjct: 893  TTLNLLQAYTLKRIRDPNYHVTLRPHISKDYMESKSAAELVQLNPTSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAG+QNTG
Sbjct: 953  MKGIAAGLQNTG 964



>gb:AB078720_1523752 Nicotiana sylvestris Nsppc3 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 657

 Score =  340 bits (872), Expect = 2e-92
 Identities = 166/192 (86%), Positives = 182/192 (94%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL+MF EMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 466  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLRMFHEMYNEWPFFRVTIDLVEMVFAKGNP 525

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DL  FGE LRSNYE+T+SLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 526  GIAALYDKLLVSEDLLPFGELLRSNYEETRSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 585

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLN+ QAYTLKRIRDP+YHVTLRPHISKDY++SK A EL++LNPTS+YAPGLEDTLILT
Sbjct: 586  TTLNLLQAYTLKRIRDPNYHVTLRPHISKDYMESKSAAELLQLNPTSEYAPGLEDTLILT 645

Query: 263  MKGIAAGMQNTG 228
            MKGIAAG+QNTG
Sbjct: 646  MKGIAAGLQNTG 657



>gb:CSA417435_1673831 Cucumis sativus partial mRNA for
           phosphoenolpyruvate carboxylase (pepc1 gene).
          Length = 198

 Score =  338 bits (866), Expect = 9e-92
 Identities = 165/193 (85%), Positives = 181/193 (93%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQK++KNL+M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 6   FAWTQTRFHLPVWLGFGAAFKHIIQKNVKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDP 65

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGERLR+NYE+TKSLLL+IAGH DLLEGDPYLKQ+L+LRDSYI
Sbjct: 66  GIAALYDKLLVSEDLWSFGERLRANYEETKSLLLKIAGHSDLLEGDPYLKQRLRLRDSYI 125

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP+YHV +RPHISK+ ++ SK ADEL+ LNP S+YAPGLEDTLIL
Sbjct: 126 TTLNVCQAYTLKRIRDPNYHVKVRPHISKEIMEASKPADELIHLNPQSEYAPGLEDTLIL 185

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 186 TMKGIAAGMQNTG 198



>pir|T09846|T09846 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 1 -
            upland cotton>gb:AF008939_1761055 Gossypium hirsutum
            phosphoenolpyruvate carboxylase 1 (PEPC1) mRNA, complete
            cds.
          Length = 965

 Score =  335 bits (860), Expect = 5e-91
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  IQKDIKNL M QEM+N+WPFFRVT+DL+EMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKHVIQKDIKNLHMLQEMHNQWPFFRVTMDLIEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVSK+LW FGE LR+NYEDTK L+LQ+AGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 833  GIAALYDKLLVSKELWPFGENLRANYEDTKRLVLQVAGHRDLLEGDPYLKQRLRLRDAYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDPDYHV +RPH+S++Y++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 893  TTLNVCQAYTLKRIRDPDYHVKVRPHLSREYMESSKAAAELVKLNPTSEYAPGLEDTLIL 952

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 953  TMKGIAAGMQNTG 965



>gb:AF248080_1780629 Flaveria trinervia phosphoenolpyruvate
            carboxylase (ppcC) mRNA, complete cds.
          Length = 967

 Score =  333 bits (855), Expect = 2e-90
 Identities = 164/194 (84%), Positives = 178/194 (91%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKYAIEKDIKNLHMLQEMYKTWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLWSFGE LR+NYE+TK+LLL+IAGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 834  GIAALNDKLLVSEDLWSFGESLRANYEETKNLLLKIAGHKDLLEGDPYLRQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD--SKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVT RPHISK+Y +  SK ADE +KLNP S+YAPGLEDTLI
Sbjct: 894  TTLNVCQAYTLKRIRDPNYHVTFRPHISKEYSEPSSKPADEYIKLNPKSEYAPGLEDTLI 953

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 954  LTMKGIAAGMQNTG 967



>gb:AF248079_1780628 Flaveria trinervia phosphoenolpyruvate
            carboxylase (ppcB) mRNA, complete cds.
          Length = 965

 Score =  333 bits (855), Expect = 2e-90
 Identities = 165/193 (85%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AIQKD KNL+M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKQAIQKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLW FGE LR+NYE+TK  LL+IAGHKDLLEGDPYLKQ+LKLRDSYI
Sbjct: 833  GIAALNDKLLVSEDLWPFGESLRANYEETKDYLLKIAGHKDLLEGDPYLKQRLKLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKR RDP+YHVTLRPHISK+Y + SK ADEL+ LNPTS+YAPGLEDTLIL
Sbjct: 893  TTLNVCQAYTLKRTRDPNYHVTLRPHISKEYAEPSKPADELIHLNPTSEYAPGLEDTLIL 952

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 953  TMKGIAAGMQNTG 965



>gb:AB078719_1523751 Nicotiana sylvestris Nsppc2 gene for
            phosphoenolpyruvate carboxylase, partial cds.
          Length = 820

 Score =  333 bits (854), Expect = 2e-90
 Identities = 163/192 (84%), Positives = 179/192 (93%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK A+ KD+KNL + Q+MYN+WPFFRVTIDLVEMVF KGDP
Sbjct: 630  FAWTQTRFHLPVWLGFGAAFKYALNKDVKNLHILQDMYNKWPFFRVTIDLVEMVFGKGDP 689

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLWSFGE LR+NYE+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 690  GIAALYDKLLVSEDLWSFGELLRANYEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 749

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKR+RDP+Y VTLRPHI+K+Y++SK A ELVKLNP S YAPGLEDTLILT
Sbjct: 750  TTLNVCQAYTLKRVRDPNYLVTLRPHITKEYMESKPAAELVKLNPRS-YAPGLEDTLILT 808

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 809  MKGIAAGMQNTG 820



>gb:CSA417436_1673832 Cucumis sativus partial mRNA for
           phosphoenolpyruvate carboxylase (pepc2 gene).
          Length = 198

 Score =  333 bits (853), Expect = 3e-90
 Identities = 161/193 (83%), Positives = 182/193 (94%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK AI+KD+KNL M QEMY++WPFFRVTIDLVEMVFAKGDP
Sbjct: 6   FAWTQTRFHLPVWLGFGAAFKYAIEKDVKNLHMLQEMYSQWPFFRVTIDLVEMVFAKGDP 65

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGE+LR+NYE+TK+LLLQ+A HKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 66  GIAALYDKLLVSEDLWSFGEQLRANYEETKNLLLQVAKHKDLLEGDPYLRQRLRLRDSYI 125

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP+Y+V +RPH+SK+Y++ SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 126 TTLNVCQAYTLKRIRDPNYNVKVRPHLSKEYLESSKSAAELVKLNPQSEYAPGLEDTLIL 185

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 186 TMKGIAAGMQNTG 198



>gb:AF008940_1761056 Gossypium hirsutum phosphoenolpyruvate
           carboxylase 2 (PEPC2) mRNA, partial cds.
          Length = 192

 Score =  331 bits (849), Expect = 9e-90
 Identities = 164/189 (86%), Positives = 177/189 (93%), Gaps = 1/189 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKDIKNL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 4   FAWTQTRFHLPVWLGFGAAFKHVIQKDIKNLLMLQEMYNEWPFFRVTIDLVEMVFAKGDP 63

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++LWSFGERLR+N+E+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 64  GIAALYDKLLVSEELWSFGERLRTNFEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 123

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP+Y V LRPHIS++ ++ SK ADELVKLNPTS+Y PGLEDTLIL
Sbjct: 124 TTLNVCQAYTLKRIRDPNYSVKLRPHISREIMESSKPADELVKLNPTSEYTPGLEDTLIL 183

Query: 266 TMKGIAAGM 240
           TMKGIAAGM
Sbjct: 184 TMKGIAAGM 192



>pir|T09847|T09847 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 2 -
           upland cotton (fragment)
          Length = 192

 Score =  331 bits (849), Expect = 9e-90
 Identities = 164/189 (86%), Positives = 177/189 (93%), Gaps = 1/189 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKDIKNL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 4   FAWTQTRFHLPVWLGFGAAFKHVIQKDIKNLLMLQEMYNEWPFFRVTIDLVEMVFAKGDP 63

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++LWSFGERLR+N+E+TKSLLLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 64  GIAALYDKLLVSEELWSFGERLRTNFEETKSLLLQIAGHKDLLEGDPYLKQRLRLRDSYI 123

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP+Y V LRPHIS++ ++ SK ADELVKLNPTS+Y PGLEDTLIL
Sbjct: 124 TTLNVCQAYTLKRIRDPNYSVKLRPHISREIMESSKPADELVKLNPTSEYTPGLEDTLIL 183

Query: 266 TMKGIAAGM 240
           TMKGIAAGM
Sbjct: 184 TMKGIAAGM 192



>gb:AB092821_1525120 Lotus corniculatus var. japonicus LjPEPC2 mRNA
            for phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  330 bits (847), Expect = 1e-89
 Identities = 162/193 (83%), Positives = 178/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I KDI+NL M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKHVIAKDIRNLNMLQEMYNQWPFFRVTIDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS+DLWSFGE+LR+ +E+TK LLLQ+A HKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALYDRLLVSEDLWSFGEQLRTMFEETKQLLLQVAAHKDLLEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP+Y+V LRPHISK+ +D SK ADELV LNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNVCQAYTLKRIRDPNYNVKLRPHISKEAIDVSKPADELVTLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 955  TMKGIAAGMQNTG 967



>gb:AF314923_1785361 Phaseolus vulgaris phosphoenolpyruvate
           carboxylase housekeeping isozyme pepc2 mRNA, partial
           cds.
          Length = 391

 Score =  329 bits (844), Expect = 3e-89
 Identities = 159/193 (82%), Positives = 179/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF+  ++KD KNL+M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 199 FAWTQTRFHLPVWLGFGAAFRHVVKKDPKNLQMLQDMYNQWPFFRVTIDLVEMVFAKGDP 258

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV+++LWSFGERLRS YE+TK LLLQ+AGH+DLLEGDPYLKQ+L+LRDSY 
Sbjct: 259 GIAALYDKLLVTEELWSFGERLRSMYEETKRLLLQVAGHRDLLEGDPYLKQRLRLRDSYT 318

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDPDYHV L+PH+SKDY++S + A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 319 TTLNVLQAYTLKRIRDPDYHVNLKPHLSKDYMESSNPAAELVKLNPTSEYAPGLEDTLIL 378

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 379 TMKGIAAGMQNTG 391



>gb:VFA011303_1727074 Vicia faba mRNA for
            phosphoenolpyruvate-carboxylase, pepc2 isoform, partial.
          Length = 704

 Score =  329 bits (844), Expect = 3e-89
 Identities = 160/193 (82%), Positives = 178/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I KDI+NL+M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 512  FAWTQTRFHLPVWLGFGAAFKHVIDKDIRNLQMLQEMYNQWPFFRVTIDLVEMVFAKGDP 571

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS DLWSFGE LR+ +E+TK LLLQ+A HKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 572  GIAALYDRLLVSDDLWSFGELLRTKFEETKQLLLQVAAHKDLLEGDPYLKQRLRLRDSYI 631

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP+Y+V LRPHISK++++ SK ADELV LNPTS+YAPGLEDTLIL
Sbjct: 632  TTLNVCQAYTLKRIRDPNYNVKLRPHISKEFIEISKAADELVTLNPTSEYAPGLEDTLIL 691

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 692  TMKGIAAGLQNTG 704



>pir|S52853|S52853 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            Flaveria pringlei>gb:FPPPCAMR_1679178 F.pringlei ppcA
            mRNA for phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  329 bits (844), Expect = 3e-89
 Identities = 162/194 (83%), Positives = 176/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KD KNL+M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKHAIKKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLW FGE LR+NYE+TK  LL+IAGH+DLLEGDPYLKQ+++LRDSYI
Sbjct: 833  GIAALNDKLLVSEDLWPFGESLRANYEETKDYLLKIAGHRDLLEGDPYLKQRIRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>sp|Q01647|CAP1_FLAPR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S25081|S25081 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Flaveria
            pringlei>gb:FPPPCA_1679177 Flaveria pringlei ppcA1 gene
            for phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  329 bits (844), Expect = 3e-89
 Identities = 162/194 (83%), Positives = 176/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK AI+KD KNL+M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKHAIKKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLW FGE LR+NYE+TK  LL+IAGH+DLLEGDPYLKQ+++LRDSYI
Sbjct: 834  GIAALNDKLLVSEDLWPFGESLRANYEETKDYLLKIAGHRDLLEGDPYLKQRIRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 894  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 953

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 954  LTMKGIAAGMQNTG 967



>gb:AF494192_1805149 Flaveria pubescens phosphoenolpyruvate
            carboxylase FPUB966 (ppcA) mRNA, complete cds.
          Length = 966

 Score =  329 bits (843), Expect = 4e-89
 Identities = 162/194 (83%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK AI+KD KNL+M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGTAFKHAIKKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLW FGE LR+NYE+TK  LL+IAGHKDLLEGDPYLKQ+++LRDSYI
Sbjct: 833  GIAALNDKLLVSEDLWPFGESLRANYEETKDYLLKIAGHKDLLEGDPYLKQRIRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>gb:AF159051_1773194 Picea abies phosphoenolpyruvate carboxylase
            (PEPC-1) gene, PEPC-1b allele, complete cds.
          Length = 955

 Score =  328 bits (841), Expect = 7e-89
 Identities = 159/192 (82%), Positives = 176/192 (91%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  ++KDI+NL M Q+MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 765  FAWTQTRFHLPVWLGFGAAFKHVMEKDIRNLHMLQQMYNEWPFFRVTIDLIEMVFAKGDP 824

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DLW+ GE+LR+NY +TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 825  GIAALYDKLLVSDDLWAIGEKLRANYGETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 884

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP+YHV LRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 885  TTLNVCQAYTLKRIRDPNYHVNLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 943

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 944  MKGIAAGMQNTG 955



>sp|P51063|CAPP_PICAB Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S49344|S49344 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Norway
            spruce>gb:PAPPCG_1698837 P.abies (L.)Karst. ppc mRNA.
          Length = 963

 Score =  328 bits (841), Expect = 7e-89
 Identities = 159/192 (82%), Positives = 176/192 (91%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  ++KDI+NL M Q+MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKHVMEKDIRNLHMLQQMYNEWPFFRVTIDLIEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DLW+ GE+LR+NY +TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 833  GIAALYDKLLVSDDLWAIGEKLRANYGETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP+YHV LRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVNLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 951

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 952  MKGIAAGMQNTG 963



>sp|Q02909|CAP1_SOYBN Phosphoenolpyruvate carboxylase, housekeeping
            isozyme (EC 4.1.1.31) (PEPCase).>pir|S28428|S28428
            phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            soybean>gb:SOYGMPPC_1716015 Glycine max mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  328 bits (841), Expect = 7e-89
 Identities = 157/193 (81%), Positives = 180/193 (93%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KD++N+ + QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKHVIEKDVRNIHVLQEMYNQWPFFRVTIDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS+DLWSFGE+LR+ YE+TK LLLQ+AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALYDRLLVSEDLWSFGEQLRTMYEETKELLLQVAGHRDLLEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP+Y+V LRPHISK+ ++ SK ADEL+ LNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNVCQAYTLKRIRDPNYNVKLRPHISKESIEISKPADELITLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 955  TMKGIAAGLQNTG 967



>gb:AF494191_1805148 Flaveria brownii phosphoenolpyruvate carboxylase
            FB966 (ppcA) mRNA, complete cds.
          Length = 966

 Score =  328 bits (840), Expect = 1e-88
 Identities = 161/194 (82%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK AI+KD KNL+M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGTAFKHAIKKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DLW FGE LR+NYE+TK  LL+IAGHKDLLEGDPYLKQ+++LRD+YI
Sbjct: 833  GIAALNDKLLVSEDLWPFGESLRANYEETKDYLLKIAGHKDLLEGDPYLKQRIRLRDAYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>pir|S68416|S68416 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 4 -
           Kalanchoe blossfeldiana (fragment)
          Length = 370

 Score =  327 bits (838), Expect = 2e-88
 Identities = 159/193 (82%), Positives = 177/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYNRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIR+P+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIREPNYHVTVRPRLSKEIMESNKAASELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 358 TMKGIAAGMQNTG 370



>pir|S68415|S68415 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 3 -
           Kalanchoe blossfeldiana (fragment)
          Length = 370

 Score =  327 bits (837), Expect = 2e-88
 Identities = 160/193 (82%), Positives = 177/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYNRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNGCQAYTLKRIRDPNYHVTVRPRLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 358 TMKGIAAGMQNTG 370



>gb:AP003913_1835124 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1484_G09.
          Length = 964

 Score =  326 bits (836), Expect = 3e-88
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G+AFK  ++KDI+NL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 772  FAWTQTRFHLPVWLGFGSAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDP 831

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW  GE+LR+N E+TK LLLQ+AGHKDLLEGD YLKQ+L+LR++YI
Sbjct: 832  GIAALYDKLLVSEELWPLGEKLRANCEETKQLLLQVAGHKDLLEGDLYLKQRLRLRNAYI 891

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYT+KRIRDPDYHVTLRPH+SK+ +D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 892  TTLNVCQAYTMKRIRDPDYHVTLRPHMSKEIMDWSKPAAELVKLNPTSEYAPGLEDTLIL 951

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 952  TMKGIAAGMQNTG 964



>gb:AY187619_1588160 Oryza sativa (indica cultivar-group)
            phosphoenolpyruvate carboxylase (PEPC) mRNA, complete
            cds.
          Length = 964

 Score =  326 bits (836), Expect = 3e-88
 Identities = 159/193 (82%), Positives = 178/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G+AFK  ++KDI+NL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 772  FAWTQTRFHLPVWLGFGSAFKHILEKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGDP 831

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW  GE+LR+N E+TK LLLQ+AGHKDLLEGD YLKQ+L+LR++YI
Sbjct: 832  GIAALYDKLLVSEELWPLGEKLRANCEETKQLLLQVAGHKDLLEGDLYLKQRLRLRNAYI 891

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYT+KRIRDPDYHVTLRPH+SK+ +D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 892  TTLNVCQAYTMKRIRDPDYHVTLRPHMSKEIMDWSKPAAELVKLNPTSEYAPGLEDTLIL 951

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 952  TMKGIAAGMQNTG 964



>gb:STU011844_1722943 Solanum tuberosum ppc2 gene.
          Length = 964

 Score =  326 bits (835), Expect = 4e-88
 Identities = 158/192 (82%), Positives = 176/192 (91%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK A+ KD KNL M Q+M+ +WPFFRVT DL+EMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKYALNKDKKNLNMLQDMHKKWPFFRVTADLIEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLWSFGE LRS+YE+TKSLLLQ+AGHK+LLEGDP LKQ+L+LRDSYI
Sbjct: 833  GIAALYDKLLVSEDLWSFGELLRSDYEETKSLLLQVAGHKELLEGDPCLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP Y+VTLRPHI+K+Y++SK A ELV LNP S+YAPGLEDTLILT
Sbjct: 893  TTLNVCQAYTLKRIRDPTYNVTLRPHITKEYIESKPAAELVCLNPESEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>gb:STPPC2_1722878 S.tuberosum ppc2 gene.
          Length = 283

 Score =  326 bits (835), Expect = 4e-88
 Identities = 158/192 (82%), Positives = 176/192 (91%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK A+ KD KNL M Q+M+ +WPFFRVT DL+EMVFAKGDP
Sbjct: 92  FAWTQTRFHLPVWLGFGAAFKYALNKDKKNLNMLQDMHKKWPFFRVTADLIEMVFAKGDP 151

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGE LRS+YE+TKSLLLQ+AGHK+LLEGDP LKQ+L+LRDSYI
Sbjct: 152 GIAALYDKLLVSEDLWSFGELLRSDYEETKSLLLQVAGHKELLEGDPCLKQRLRLRDSYI 211

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP Y+VTLRPHI+K+Y++SK A ELV LNP S+YAPGLEDTLILT
Sbjct: 212 TTLNVCQAYTLKRIRDPTYNVTLRPHITKEYIESKPAAELVCLNPESEYAPGLEDTLILT 271

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 272 MKGIAAGMQNTG 283



>gb:BT004642_1637676 Arabidopsis thaliana At3g14940 gene, complete
            cds.
          Length = 968

 Score =  325 bits (834), Expect = 5e-88
 Identities = 156/193 (80%), Positives = 180/193 (93%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+ AI+KD++NL M Q+MY +WPFFRVTIDL+EMVFAKGDP
Sbjct: 776  FAWTQTRFHLPVWLGFGAAFRYAIKKDVRNLHMLQDMYKQWPFFRVTIDLIEMVFAKGDP 835

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLW+FGE+LR+N+++TK+L+LQ AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 836  GIAALYDKLLVSEDLWAFGEKLRANFDETKNLVLQTAGHKDLLEGDPYLKQRLRLRDSYI 895

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRD +Y+VTLRPHISK+ +  SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 896  TTLNVCQAYTLKRIRDANYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLIL 955

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 956  TMKGIAAGLQNTG 968



>pir|T52186|T52186 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            [imported] - Arabidopsis thaliana>gb:ATH131710_1551995
            Arabidopsis thaliana pepc gene, exons
            1-10.>gb:AF071788_1765809 Arabidopsis thaliana
            phosphoenolpyruvate carboxylase (PPC) mRNA, complete
            cds.>gb:AP000370_1819759 Arabidopsis thaliana genomic
            DNA, chromosome 3, TAC clone:K15M2.
          Length = 968

 Score =  325 bits (834), Expect = 5e-88
 Identities = 156/193 (80%), Positives = 180/193 (93%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+ AI+KD++NL M Q+MY +WPFFRVTIDL+EMVFAKGDP
Sbjct: 776  FAWTQTRFHLPVWLGFGAAFRYAIKKDVRNLHMLQDMYKQWPFFRVTIDLIEMVFAKGDP 835

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLW+FGE+LR+N+++TK+L+LQ AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 836  GIAALYDKLLVSEDLWAFGEKLRANFDETKNLVLQTAGHKDLLEGDPYLKQRLRLRDSYI 895

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRD +Y+VTLRPHISK+ +  SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 896  TTLNVCQAYTLKRIRDANYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLIL 955

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 956  TMKGIAAGLQNTG 968



>gb:AP005802_1858075 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBa0057D11.
          Length = 972

 Score =  325 bits (833), Expect = 6e-88
 Identities = 158/193 (81%), Positives = 178/193 (92%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK A+QKDI+NL M QEMYNEWPFFRVT+DL+EMVFAKG+P
Sbjct: 780  FAWTQTRFHLPVWLGFGAAFKHALQKDIRNLHMLQEMYNEWPFFRVTLDLIEMVFAKGNP 839

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DL   GE+LR+NY +T+ LLLQ+AGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 840  GIAALYDKLLVSEDLQPLGEKLRANYVETQKLLLQVAGHRDLLEGDPYLKQRLRLRDAYI 899

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDPDYHVTLRPH+SK+ +D SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 900  TTLNVCQAYTLKRIRDPDYHVTLRPHLSKEVMDGSKPAAELVKLNPGSEYAPGLEDTLIL 959

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 960  TMKGIAAGLQNTG 972



>sp|P16097|CAP2_MESCR Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2).>pir|S05550|QYIX2 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) 2 - common ice
            plant>gb:MCPPCB_1685805 Mesembryanthemum crystallinum
            ppc2 gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 960

 Score =  325 bits (832), Expect = 8e-88
 Identities = 159/195 (81%), Positives = 179/195 (91%), Gaps = 3/195 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF  AIQKD+KNL + Q+MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 766  FAWTQTRFHLPVWLGFGAAFGYAIQKDVKNLSVLQKMYNEWPFFRVTIDLVEMVFAKGDP 825

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW FGERLR+++E+TK L+L+IAGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 826  GIAALYDKLLVSEELWPFGERLRADFEETKGLILKIAGHKDLLEGDPYLRQRLRLRDSYI 885

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS---KHADELVKLNPTSDYAPGLEDTL 273
            TTLN  QAYTLKRIRDP+Y+V LRPHISK+Y+DS   K A ELVKLNP+S+YAPGLEDTL
Sbjct: 886  TTLNALQAYTLKRIRDPNYNVQLRPHISKEYMDSTSNKPAAELVKLNPSSEYAPGLEDTL 945

Query: 272  ILTMKGIAAGMQNTG 228
            ILTMKGIAAGMQNTG
Sbjct: 946  ILTMKGIAAGMQNTG 960



>gb:AY663386_1620487 Lupinus albus phosphoenolpyruvate carboxylase 2
            mRNA, complete cds.
          Length = 967

 Score =  324 bits (831), Expect = 1e-87
 Identities = 156/193 (80%), Positives = 177/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+  I KD++NL M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFRQVITKDVRNLNMLQEMYNQWPFFRVTIDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS+DLWSFGE+LR+ +E+TK LLLQ+A HKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALYDRLLVSEDLWSFGEQLRTKFEETKKLLLQVAAHKDLLEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP+Y V LRPHISK+ ++ SK ADEL+ LNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNVCQAYTLKRIRDPNYDVKLRPHISKECIEISKAADELITLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            T+KGIAAG+QNTG
Sbjct: 955  TVKGIAAGLQNTG 967



>gb:AF512995_1807386 Citrus junos phosphoenolpyruvate carboxylase
           (pepc) mRNA, partial cds.
          Length = 410

 Score =  323 bits (828), Expect = 2e-87
 Identities = 160/195 (82%), Positives = 177/195 (90%), Gaps = 3/195 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKDI+NL M QEMYN WPFFRVTIDLVEMVFAKG+ 
Sbjct: 216 FAWTQTRFHLPVWLGFGAAFKHVIQKDIRNLHMLQEMYNNWPFFRVTIDLVEMVFAKGNH 275

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVSKDLWSFGE+LR NYE+TK LLLQIAGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 276 KIAALYDQLLVSKDLWSFGEKLRVNYEETKGLLLQIAGHKDLLEGDPYLKQRLRLRDAYI 335

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS---KHADELVKLNPTSDYAPGLEDTL 273
           TTLNVCQAYTLKRIRDP+YHV +RPHIS++ ++S   K ADELVKLN +S+YAPGLEDTL
Sbjct: 336 TTLNVCQAYTLKRIRDPNYHVKVRPHISREIMESESVKPADELVKLNLSSEYAPGLEDTL 395

Query: 272 ILTMKGIAAGMQNTG 228
           ILTMKGIAAG+QNTG
Sbjct: 396 ILTMKGIAAGLQNTG 410



>gb:DFAJ2942_1675831 Dendrobium fimbriatum partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  323 bits (828), Expect = 2e-87
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK AI+KDIKNL M QEMYNEWPFFRVTIDL+EMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHAIEKDIKNLHMLQEMYNEWPFFRVTIDLIEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAAL+DKLLVS DLWSFGERLR+NYE+TK+LLLQ+AGH+DLLEGDP+LKQ+L+LRDSYI
Sbjct: 238 GIAALHDKLLVSDDLWSFGERLRTNYEETKNLLLQVAGHRDLLEGDPHLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQA TLKRIRDP++HVT+RPHISKD +DS  K A ELVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQACTLKRIRDPNFHVTVRPHISKDIIDSSNKRAAELVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:PAM300742_1698747 Phalaenopsis amabilis partial ppc gene for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  323 bits (827), Expect = 3e-87
 Identities = 157/193 (81%), Positives = 175/193 (90%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQ RFHLPV LG G AFK  + KDIKNL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQARFHLPVWLGSGTAFKHVVAKDIKNLYMLQEMYNEWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DLWSFGERLR+N+E+TK+LLLQ+AGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 833  GIAALYDKLLVSDDLWSFGERLRANFEETKTLLLQVAGHRDLLEGDPYLKQRLRLRDAYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQA+TLKRIRDP +HV LR H+S++ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 893  TTLNVCQAFTLKRIRDPSFHVNLRSHLSREIMNSNKPAAELVKLNPTSEYAPGLEDTLIL 952

Query: 266  TMKGIAAGMQNTG 228
             MKGIAAGMQNTG
Sbjct: 953  AMKGIAAGMQNTG 965



>gb:PEQ300741_1699811 Phalaenopsis equestris partial ppc gene for
            phosphoenolpyruvate carboxylase.
          Length = 965

 Score =  322 bits (824), Expect = 7e-87
 Identities = 156/193 (80%), Positives = 175/193 (90%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQ RFHLPV LG G AFK  + KDIKNL M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 773  FAWTQARFHLPVWLGSGTAFKHVVAKDIKNLYMLQEMYNEWPFFRVTIDLVEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DLWSFGERLR+N+E+TK+LLLQ+AGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 833  GIAALYDKLLVSDDLWSFGERLRANFEETKTLLLQVAGHRDLLEGDPYLKQRLRLRDAYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQA+TLKRIRDP +HV LR H+S++ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 893  TTLNVCQAFTLKRIRDPSFHVNLRSHLSREIMNSNKPAAELVKLNPTSEYAPGLEDTLIL 952

Query: 266  TMKGIAAGMQNTG 228
             MKGIAAG+QNTG
Sbjct: 953  AMKGIAAGLQNTG 965



>sp|Q9MAH0|CAPP_ARATH Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|D96573|D96573 protein F12M16.21 [imported]
            - Arabidopsis thaliana>gb:AE005173_893234 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC008007_1536415 Genomic sequence for
            Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.>gb:ATH532901_1552866 Arabidopsis
            thaliana mRNA for phosphoenolpyruvate carboxylase (ppc1
            gene).>gb:AY057507_1563926 Arabidopsis thaliana
            At1g53310/F12M16_21 mRNA, complete
            cds.>gb:BT000647_1634925 Arabidopsis thaliana putative
            phosphoenolpyrovate carboxylase gb|AAC24594.1; similar to
            ESTs gb|R30301.1, gb|AI992716.1, emb|Z29154.1,
            gb|W43080.1, emb|Z30862.1, (At1g53310/F12M16_21) mRNA,
            complete cds.
          Length = 967

 Score =  322 bits (824), Expect = 7e-87
 Identities = 153/193 (79%), Positives = 175/193 (90%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G+A +  I+KD++NL M Q+MY  WPFFRVTIDL+EMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGSAIRHVIEKDVRNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW FGE+LR+N+E+TK L+LQ AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALYDKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP YHVTLRPHISK+  + SK A EL++LNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNVCQAYTLKRIRDPSYHVTLRPHISKEIAESSKPAKELIELNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 955  TMKGIAAGLQNTG 967



>sp|P29194|CAP2_SORBI Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2) (CP28).>pir|S18240|S18240 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - sorghum>gb:SVPEPCG_1723259
            S.vulgare PEPC gene for phosphoenolpyruvate carboxylase.
          Length = 960

 Score =  322 bits (824), Expect = 7e-87
 Identities = 156/193 (80%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  +QKDI+NL M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 768  FAWTQTRFHLPVWLGFGGAFKHVLQKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 827

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++L   GE+LR+NYE+T+ LLLQ+AGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 828  GIAALYDKLLVSEELRPLGEKLRANYEETQKLLLQVAGHRDLLEGDPYLKQRLRLRDAYI 887

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDPDYHV LRPH+SK+ +D +K A ELVKLNP S+YAPGLEDTLIL
Sbjct: 888  TTLNVCQAYTLKRIRDPDYHVALRPHLSKEIMDPTKAASELVKLNPGSEYAPGLEDTLIL 947

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 948  TMKGIAAGLQNTG 960



>gb:AF459644_1801729 Lupinus albus phosphoenolpyruvate carboxylase
            (PEPC1) mRNA, complete cds.
          Length = 967

 Score =  321 bits (822), Expect = 1e-86
 Identities = 154/193 (79%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+  + KD++NL M QEMYN+W FFRVTIDLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFRQVVPKDVRNLNMLQEMYNQWKFFRVTIDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVSK+LWSFGE+LR+N+E+TK LLLQ+A HKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALYDRLLVSKNLWSFGEQLRTNFEETKKLLLQVAAHKDLLEGDPYLKQKLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            +TLNVCQAYTLKRIRDP+Y V LRPHISK+ ++ SK ADEL+ LNPTS+YAPGLEDT IL
Sbjct: 895  STLNVCQAYTLKRIRDPNYDVKLRPHISKECIEISKVADELITLNPTSEYAPGLEDTFIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 955  TMKGIAAGLQNTG 967



>gb:LBI312670_1683972 Leptotes bicolor partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 364

 Score =  321 bits (822), Expect = 1e-86
 Identities = 159/187 (85%), Positives = 172/187 (91%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTR HLPV LG G AFK AI+KDIKNL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRVHLPVWLGFGTAFKYAIEKDIKNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DLWSFGERLR++YE+TK+LLLQ+AGH+DLLEGDPYLKQ+L LRDSYI
Sbjct: 238 GIAALYDKLLVSDDLWSFGERLRASYEETKNLLLQVAGHRDLLEGDPYLKQRLCLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++HV LRPHISK+ +DS K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVNLRPHISKEIMDSNKTAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AY563044_1615006 Glycine max phosphoenolpyruvate carboxylase
            (PEPC4) mRNA, complete cds.
          Length = 966

 Score =  321 bits (822), Expect = 1e-86
 Identities = 156/193 (80%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G+AFK  ++KD KNL+M Q+MYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGSAFKHVVEKDPKNLQMLQDMYNQWPFFRVTLDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL+DKLLVS++L  FGE LR+ YE+TKS LLQ+AGHKD+LEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALFDKLLVSEELRPFGENLRAKYEETKSFLLQVAGHKDILEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIRDPDYHV LRPH+SKDY++ SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 894  TTLNVLQAYTLKRIRDPDYHVKLRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTLIL 953

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 954  TMKGIAAGMQNTG 966



>sp|Q42730|CAPP_FLAAU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S37072|S37072 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - Flaveria
            australasica>gb:FAPHOCAR_1678787 F.australasica mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  321 bits (822), Expect = 1e-86
 Identities = 160/194 (82%), Positives = 174/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAFK AIQKD KNL+M QEMY  WPFFRVTIDLVEMVFAKG+P
Sbjct: 773  FSWTQTRFHLPVWLGFGAAFKHAIQKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGNP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DL  FGE LR+NYE+TK+ LL+IAGHKDLLEGDPYLKQ ++LRD YI
Sbjct: 833  GIAALNDKLLVSEDLRPFGESLRANYEETKNYLLKIAGHKDLLEGDPYLKQGIRLRDPYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>sp|P30694|CAP2_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:FTPEPC_1679461 F.trinervia mRNA for
            phosphoenolpyruvate carboxylase.
          Length = 966

 Score =  321 bits (822), Expect = 1e-86
 Identities = 160/194 (82%), Positives = 174/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAFK AIQKD KNL+M QEMY  WPFFRVTIDLVEMVFAKG+P
Sbjct: 773  FSWTQTRFHLPVWLGFGAAFKHAIQKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGNP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DL  FGE LR+NYE+TK+ LL+IAGHKDLLEGDPYLKQ ++LRD YI
Sbjct: 833  GIAALNDKLLVSEDLRPFGESLRANYEETKNYLLKIAGHKDLLEGDPYLKQGIRLRDPYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>sp|Q01648|CAP1_FLATR Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S25082|S25082 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) isoform C4  (clone ppcA1) -
            Flaveria trinervia>gb:FTPPCA_1679462 Flaveria trinervia
            ppcA1 gene for phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  321 bits (822), Expect = 1e-86
 Identities = 160/194 (82%), Positives = 174/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAFK AIQKD KNL+M QEMY  WPFFRVTIDLVEMVFAKG+P
Sbjct: 774  FSWTQTRFHLPVWLGFGAAFKHAIQKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGNP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DL  FGE LR+NYE+TK+ LL+IAGHKDLLEGDPYLKQ ++LRD YI
Sbjct: 834  GIAALNDKLLVSEDLRPFGESLRANYEETKNYLLKIAGHKDLLEGDPYLKQGIRLRDPYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 894  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 953

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 954  LTMKGIAAGMQNTG 967



>gb:AP003409_1828980 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1131G08.
          Length = 924

 Score =  320 bits (821), Expect = 2e-86
 Identities = 157/193 (81%), Positives = 174/193 (90%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 732  FAWTQTRFHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTIDLVEMVFAKGDP 791

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLW FG RLR+NYE+TK LLLQ+AGHKDLLEGDPYL+Q+L++RDSYI
Sbjct: 792  GIAALYDKLLVSEDLWPFGARLRANYEETKQLLLQVAGHKDLLEGDPYLRQRLRIRDSYI 851

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            T LNVCQA TLKRIRDP +HV+ R H+SKD +DS K A ELVKLN TS+Y PGLEDTLIL
Sbjct: 852  TALNVCQACTLKRIRDPGFHVSPRAHLSKDIMDSGKPAAELVKLNTTSEYGPGLEDTLIL 911

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 912  TMKGIAAGMQNTG 924



>gb:VPL312626_1727323 Vanilla planifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 364

 Score =  320 bits (821), Expect = 2e-86
 Identities = 156/187 (83%), Positives = 173/187 (92%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +QKDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS+DLWSF ERLR+NY++TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIASLYDKLLVSEDLWSFAERLRANYQETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++HV +RPHISK+  D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVKVRPHISKEISDASKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VPL312624_1727321 Vanilla planifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           1.>gb:VPL312627_1727324 Vanilla planifolia partial mRNA
           for phosphoenolpyruvate carboxylase (pepc gene), isoform
           4.
          Length = 364

 Score =  320 bits (821), Expect = 2e-86
 Identities = 156/187 (83%), Positives = 173/187 (92%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +QKDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS+DLWSF ERLR+NY++TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIASLYDKLLVSEDLWSFAERLRANYQETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++HV +RPHISK+  D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVKVRPHISKEISDASKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VPAJ2929_1727311 Vanilla pompona partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  320 bits (821), Expect = 2e-86
 Identities = 156/187 (83%), Positives = 173/187 (92%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +QKDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS+DLWSF ERLR+NY++TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIASLYDKLLVSEDLWSFAERLRANYQETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++HV +RPHISK+  D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVKVRPHISKEISDASKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>pir|S18318|S18318 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            isoform C4  (clone ppc1-1) - Flaveria trinervia
          Length = 966

 Score =  320 bits (821), Expect = 2e-86
 Identities = 160/194 (82%), Positives = 174/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAFK AIQKD KNL+M QEMY  WPFFRVTIDLVEMVFAKG+P
Sbjct: 773  FSWTQTRFHLPVWLGFGAAFKHAIQKDSKNLQMLQEMYKTWPFFRVTIDLVEMVFAKGNP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL DKLLVS+DL  FGE LR+NYE+TK+ LL+IAGHKDLLEGDPYLKQ ++LRD YI
Sbjct: 833  GIAALNDKLLVSEDLRPFGEYLRANYEETKNYLLKIAGHKDLLEGDPYLKQGIRLRDPYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNVCQAYTLKRIRDP+YHVTLRPHISK+Y    SK ADEL+ LNPTS+YAPGLEDTLI
Sbjct: 893  TTLNVCQAYTLKRIRDPNYHVTLRPHISKEYAAEPSKPADELIHLNPTSEYAPGLEDTLI 952

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 953  LTMKGIAAGMQNTG 966



>gb:AF236126_1779583 Vitis vinifera PEP carboxylase (GPEPC) mRNA,
           partial cds.
          Length = 339

 Score =  320 bits (819), Expect = 3e-86
 Identities = 155/193 (80%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I +D +NL M Q+MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 147 FAWTQTRFHLPVWLGFGGAFKHVIGRDPRNLPMLQQMYNEWPFFRVTIDLVEMVFAKGDP 206

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYD+LLVS++LW FG+RLR+NYE+TK LLLQIAGH+DLLEGDPYLKQ+L+LRD+YI
Sbjct: 207 GIAALYDRLLVSEELWLFGKRLRTNYEETKRLLLQIAGHRDLLEGDPYLKQRLRLRDAYI 266

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP+YHV  RPH+SK+ ++ SK A ELVKLNPTS+YAPG+EDTLIL
Sbjct: 267 TTLNVCQAYTLKRIRDPNYHVMERPHLSKEIMESSKPAAELVKLNPTSEYAPGMEDTLIL 326

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAG+QNTG
Sbjct: 327 TMKGIAAGLQNTG 339



>gb:AF271163_1782130 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 3 mRNA, complete cds.
          Length = 970

 Score =  319 bits (818), Expect = 3e-86
 Identities = 158/193 (81%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQT+FHLPV LG G+AFK  I KD KNL+M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 778  FAWTQTKFHLPVWLGFGSAFKHVIDKDPKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDP 837

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLVSKDL  FGERLR  Y +TK+LLL++AGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 838  GIAAMYDKLLVSKDLLPFGERLREKYTETKNLLLKVAGHKDLLEGDPYLRQRLRLRDSYI 897

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN CQAYTLKRIRDP Y+V LRPH+SK+ VD SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 898  TTLNACQAYTLKRIRDPGYNVQLRPHLSKEMVDSSKSAAELVKLNPGSEYAPGLEDTLIL 957

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 958  TMKGIAAGMQNTG 970



>sp|P29193|CAP1_SACHY Phosphoenolpyruvate carboxylase, housekeeping
            isozyme (EC 4.1.1.31) (PEPCase).>pir|S28614|S28614
            phosphoenolpyruvate carboxylase (EC 4.1.1.31) - sugarcane
            hybrid H32-8560>gb:SCFSCPEPCD_1708333 Saccharum hybrid
            cultivar H32-8560 phosphoenolpyruvate carboxylase
            (SCPEPCD1) gene, complete cds.
          Length = 966

 Score =  319 bits (818), Expect = 3e-86
 Identities = 156/193 (80%), Positives = 172/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  + KDI+NL+  QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKHVLDKDIRNLQTLQEMYNQWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLWSFG+RLR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L++RDSYI
Sbjct: 834  GIAALYDKLLVSEDLWSFGKRLRANYEETKQLLLQVAGHKDLLEGDPYLKQRLRIRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            T LNVCQAY LKRIRDP + V   PH+SKD +D  K A ELVKLN TS+YAPGLEDTLIL
Sbjct: 894  TALNVCQAYMLKRIRDPGFQVNPGPHLSKDIMDMGKPASELVKLNTTSEYAPGLEDTLIL 953

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 954  TMKGIAAGMQNTG 966



>gb:AF271161_1782128 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 1 mRNA, complete cds.
          Length = 970

 Score =  319 bits (817), Expect = 4e-86
 Identities = 158/193 (81%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQT+FHLPV LG G+AFK  I KD KNL+M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 778  FAWTQTKFHLPVWLGFGSAFKHVIDKDPKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDP 837

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLVSKDL  FGERLR  Y +TK+LLL++AGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 838  GIAAMYDKLLVSKDLLPFGERLREKYTETKNLLLKVAGHKDLLEGDPYLRQRLQLRDSYI 897

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN CQAYTLKRIRDP Y+V LRPH+SK+ VD SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 898  TTLNACQAYTLKRIRDPGYNVQLRPHLSKEMVDSSKSAAELVKLNPGSEYAPGLEDTLIL 957

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 958  TMKGIAAGMQNTG 970



>gb:LES313434_1684576 Lycopersicon esculentum ppc2 gene for
            phosphoenolpyruvate carboxylase 2, exons 1-10.
          Length = 964

 Score =  318 bits (815), Expect = 8e-86
 Identities = 154/192 (80%), Positives = 173/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK A+ KD KNL M ++M+ +WPFFRVT DL+EMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKYALNKDKKNLNMLRDMHKKWPFFRVTADLIEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLWSFGE LRS+YE+TKSLLL++AGHK+LLE DP LKQ+L+LRDSYI
Sbjct: 833  GIAALYDKLLVSEDLWSFGELLRSDYEETKSLLLKVAGHKELLENDPSLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP Y VT RPHI+K+Y++SK A ELV LNP S+YAPGLEDTLILT
Sbjct: 893  TTLNVCQAYTLKRIRDPTYKVTPRPHITKEYIESKPAAELVSLNPQSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>gb:LES243417_1684495 Lycopersicon esculentum mRNA for
            phosphoenolpyruvate carboxylase 2 (ppc2 gene).
          Length = 964

 Score =  318 bits (815), Expect = 8e-86
 Identities = 154/192 (80%), Positives = 173/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK A+ KD KNL M ++M+ +WPFFRVT DL+EMVFAKGDP
Sbjct: 773  FAWTQTRFHLPVWLGFGAAFKYALNKDKKNLNMLRDMHKKWPFFRVTADLIEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS+DLWSFGE LRS+YE+TKSLLL++AGHK+LLE DP LKQ+L+LRDSYI
Sbjct: 833  GIAALYDKLLVSEDLWSFGELLRSDYEETKSLLLKVAGHKELLENDPSLKQRLRLRDSYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP Y VT RPHI+K+Y++SK A ELV LNP S+YAPGLEDTLILT
Sbjct: 893  TTLNVCQAYTLKRIRDPTYKVTPRPHITKEYIESKPAAELVSLNPQSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>gb:ETI312659_1677067 Euphorbia tirucalli partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 364

 Score =  318 bits (814), Expect = 1e-85
 Identities = 155/187 (82%), Positives = 173/187 (92%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD+KNL M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHIIEKDVKNLHMLQDMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV ++L  FGE+LR NYE+TK LLLQIAGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 238 GIAALYDKLLVPEELRPFGEQLRHNYEETKHLLLQIAGHKDLLEGDPYLKQRLRLRDAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLK+IRDPDYHVT+RPH+SK+Y++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKQIRDPDYHVTVRPHLSKEYIESSKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>sp|P51059|CAP2_MAIZE Phosphoenolpyruvate carboxylase 2 (EC 4.1.1.31)
            (PEPCase 2).>pir|JH0667|JH0667 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) C3-form -
            maize>gb:ZMPHOPCAR_1731980 Zea mays pep gene for (C3
            type) phosphoenolpyruvate carboxylase.
          Length = 967

 Score =  318 bits (814), Expect = 1e-85
 Identities = 155/193 (80%), Positives = 176/193 (91%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  +QKDI+NL M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKNVLQKDIRNLHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++L   GE+LR+NYE+T+ LLLQ+AGH+DLLEGD YLKQ+L+LRD+YI
Sbjct: 835  GIAALYDKLLVSEELHPLGEKLRANYEETQKLLLQVAGHRDLLEGDLYLKQRLRLRDAYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDPDYHV LRPH+SK+ +DS K A ++VKLNP S+YAPGLEDTLIL
Sbjct: 895  TTLNVCQAYTLKRIRDPDYHVALRPHLSKEIMDSTKAAADVVKLNPGSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 955  TMKGIAAGLQNTG 967



>gb:ATH532902_1552867 Arabidopsis thaliana mRNA for
            phosphoenolpyruvate carboxylase (ppc2 gene).
          Length = 963

 Score =  317 bits (813), Expect = 1e-85
 Identities = 151/192 (78%), Positives = 173/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  IQKD KNL M +EMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 772  FAWTQTRFHLPVWLGFGGAFKRVIQKDSKNLNMLKEMYNQWPFFRVTIDLVEMVFAKGDP 831

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS++L  FGE+LR NY++T+ LLLQ+AGHKD+LEGDPYL+Q+L+LRD YI
Sbjct: 832  GIAALYDRLLVSEELQPFGEQLRVNYQETRRLLLQVAGHKDILEGDPYLRQRLQLRDPYI 891

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLK+IRDP +HV +RPH+SKDY++S  A ELVKLNP S+YAPGLEDT+ILT
Sbjct: 892  TTLNVCQAYTLKQIRDPSFHVKVRPHLSKDYMESSPAAELVKLNPKSEYAPGLEDTVILT 951

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 952  MKGIAAGMQNTG 963



>gb:AY210895_1589694 Arabidopsis thaliana phosphoenolpyruvate
            carboxylase mRNA, complete cds.
          Length = 963

 Score =  317 bits (812), Expect = 2e-85
 Identities = 151/192 (78%), Positives = 173/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  IQKD KNL M +EMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 772  FAWTQTRFHLPVWLGFGGAFKRVIQKDNKNLNMLKEMYNQWPFFRVTIDLVEMVFAKGDP 831

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS++L  FGE+LR NY++T+ LLLQ+AGHKD+LEGDPYL+Q+L+LRD YI
Sbjct: 832  GIAALYDRLLVSEELQPFGEQLRVNYQETRRLLLQVAGHKDILEGDPYLRQRLQLRDPYI 891

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLK+IRDP +HV +RPH+SKDY++S  A ELVKLNP S+YAPGLEDT+ILT
Sbjct: 892  TTLNVCQAYTLKQIRDPSFHVKVRPHLSKDYMESSPAAELVKLNPKSEYAPGLEDTVILT 951

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 952  MKGIAAGMQNTG 963



>gb:KPI312652_1683760 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           G.>gb:KPI344058_1683767 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           7.
          Length = 373

 Score =  316 bits (809), Expect = 4e-85
 Identities = 158/196 (80%), Positives = 172/196 (87%), Gaps = 10/196 (5%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK AI+KD++NL M Q MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHAIEKDVRNLHMLQAMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGERLR++Y+DTKS LLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGERLRTHYDDTKSYLLQIAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH----------ADELVKLNPTSDYA 294
           TTLNVCQAYTLKRIRDP Y VT+RPHISK+ ++S            A ELVKLN TS+YA
Sbjct: 298 TTLNVCQAYTLKRIRDPSYRVTVRPHISKEIMESSSSSSSSSTSNPAYELVKLNTTSEYA 357

Query: 293 PGLEDTLILTMKGIAA 246
           PGLEDTLILTMKGIAA
Sbjct: 358 PGLEDTLILTMKGIAA 373



>gb:KPI312651_1683759 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           F.>gb:KPI344057_1683766 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           6.
          Length = 373

 Score =  316 bits (809), Expect = 4e-85
 Identities = 158/196 (80%), Positives = 172/196 (87%), Gaps = 10/196 (5%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK AI+KD++NL M Q MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHAIEKDVRNLHMLQAMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGERLR++Y+DTKS LLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGERLRTHYDDTKSYLLQIAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH----------ADELVKLNPTSDYA 294
           TTLNVCQAYTLKRIRDP Y VT+RPHISK+ ++S            A ELVKLN TS+YA
Sbjct: 298 TTLNVCQAYTLKRIRDPSYRVTVRPHISKEIMESSSSSSSSSTSNPAYELVKLNTTSEYA 357

Query: 293 PGLEDTLILTMKGIAA 246
           PGLEDTLILTMKGIAA
Sbjct: 358 PGLEDTLILTMKGIAA 373



>sp|Q02735|CAPP_MEDSA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>pir|S26235|S26235 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) - alfalfa>gb:AX059586_1458525
            Sequence 1 from Patent WO0100852.>gb:ALFPEPC_1819001
            Medicago sativa phosphoenolpyruvate carboxylase (PEPC)
            gene, complete cds.>gb:ALFPPPCA_1819004 Medicago sativa
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 966

 Score =  316 bits (809), Expect = 4e-85
 Identities = 156/193 (80%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+  +QKD+KNL M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFRQVVQKDVKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVSKDLW FGE+LRS YE+TK LLLQ+A HK++LEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALNDRLLVSKDLWPFGEQLRSKYEETKKLLLQVAAHKEVLEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIRDP+Y V +RP ISK+  + SK ADELV LNPTS+YAPGLEDTLIL
Sbjct: 894  TTLNVFQAYTLKRIRDPNYKVEVRPPISKESAETSKPADELVTLNPTSEYAPGLEDTLIL 953

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 954  TMKGIAAGMQNTG 966



>gb:TAE7705_1724514 Triticum aestivum PEPC gene.
          Length = 972

 Score =  315 bits (808), Expect = 5e-85
 Identities = 153/193 (79%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  ++KDI+N  M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 780  FAWTQTRFHLPVWLGFGGAFKHILKKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 839

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS+ L   GE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 840  GIAALYDRLLVSEGLQPLGEKLRANYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYI 899

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TT+NVCQAYTLKRIRDPDYHV LRPH+SK+ +D SK A ELV LNP S+YAPGLEDTLIL
Sbjct: 900  TTMNVCQAYTLKRIRDPDYHVALRPHLSKEVMDTSKPAAELVTLNPASEYAPGLEDTLIL 959

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 960  TMKGIAAGLQNTG 972



>gb:KSAJ2925_1683786 Kalanchoe streptantha partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  315 bits (808), Expect = 5e-85
 Identities = 153/187 (81%), Positives = 171/187 (91%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RPH+SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPHLSKEIMESHKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KPI312650_1683758 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           E.>gb:KPI344056_1683765 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           5.
          Length = 373

 Score =  315 bits (808), Expect = 5e-85
 Identities = 158/196 (80%), Positives = 172/196 (87%), Gaps = 10/196 (5%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK AI+KD++NL M Q MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHAIEKDVRNLHMLQAMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGERLR++Y+DTKS LLQIAGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGERLRTHYDDTKSYLLQIAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH----------ADELVKLNPTSDYA 294
           TTLNVCQAYTLKRIRDP Y VT+RPHISK+ ++S            A ELVKLN TS+YA
Sbjct: 298 TTLNVCQAYTLKRIRDPSYSVTVRPHISKEIMESSSSSSSSSTSNPAYELVKLNTTSEYA 357

Query: 293 PGLEDTLILTMKGIAA 246
           PGLEDTLILTMKGIAA
Sbjct: 358 PGLEDTLILTMKGIAA 373



>gb:BRJ223496_1634162 Brassica juncea mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 964

 Score =  315 bits (808), Expect = 5e-85
 Identities = 148/192 (77%), Positives = 173/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G A +  ++KD+KNL M Q+MY  WPFFRVTIDL+EMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGGAIRHVVEKDVKNLHMLQDMYKNWPFFRVTIDLIEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW FG++LR+N+E+TK L+LQ AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 835  GIAALYDKLLVSEELWPFGDKLRANFEETKKLVLQTAGHKDLLEGDPYLKQRLRLRNSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP YHVTLRPHISK+  +S  + EL++LNPTS+YAPGLEDTLILT
Sbjct: 895  TTLNVCQAYTLKRIRDPSYHVTLRPHISKEIAES--SKELIELNPTSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKG+AAG+QNTG
Sbjct: 953  MKGVAAGLQNTG 964



>gb:AY349298_1601537 Hordeum vulgare subsp. spontaneum NPGS PI
           212305 phosphoenolpyruvate carboxylase (Pepc) gene,
           exons 8, 9, 10, and partial cds.>gb:AY349299_1601538
           Hordeum vulgare subsp. spontaneum NPGS PI 212306
           phosphoenolpyruvate carboxylase (Pepc) gene, exons 8, 9,
           10, and partial cds.>gb:AY349300_1601539 Hordeum vulgare
           subsp. spontaneum NPGS PI 219796 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349301_1601540 Hordeum vulgare subsp.
           spontaneum NPGS PI 220523 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349302_1601541 Hordeum vulgare subsp.
           spontaneum NPGS PI 236388 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349303_1601542 Hordeum vulgare subsp.
           spontaneum NPGS PI 253933 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349304_1601543 Hordeum vulgare subsp.
           spontaneum NPGS PI 254894 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349305_1601544 Hordeum vulgare subsp.
           spontaneum NPGS PI 268242 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349306_1601545 Hordeum vulgare subsp.
           spontaneum NPGS PI 293402 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349307_1601546 Hordeum vulgare subsp.
           spontaneum NPGS PI 293409 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349308_1601547 Hordeum vulgare subsp.
           spontaneum NPGS PI 293411 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349309_1601548 Hordeum vulgare subsp.
           spontaneum NPGS PI 296926 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349310_1601549 Hordeum vulgare subsp.
           spontaneum NPGS PI 366446 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349311_1601550 Hordeum vulgare subsp.
           spontaneum NPGS PI 401370 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349312_1601551 Hordeum vulgare subsp.
           spontaneum NPGS PI 401371 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349313_1601552 Hordeum vulgare subsp.
           spontaneum NPGS PI 406276 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349314_1601553 Hordeum vulgare subsp.
           spontaneum NPGS PI 420911 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349315_1601554 Hordeum vulgare subsp.
           spontaneum NPGS PI 420913 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349316_1601555 Hordeum vulgare subsp.
           spontaneum NPGS PI 420916 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349317_1601556 Hordeum vulgare subsp.
           spontaneum NPGS PI 466460 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349318_1601557 Hordeum vulgare subsp.
           spontaneum NPGS PI 531851 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349319_1601558 Hordeum vulgare subsp.
           spontaneum NPGS PI 531853 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349320_1601559 Hordeum vulgare subsp.
           spontaneum NPGS PI 531957 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349321_1601560 Hordeum vulgare subsp.
           spontaneum NPGS PI 559556 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.>gb:AY349322_1601561 Hordeum vulgare subsp.
           spontaneum NPGS PI 560559 phosphoenolpyruvate
           carboxylase (Pepc) gene, exons 8, 9, 10, and partial
           cds.
          Length = 231

 Score =  315 bits (808), Expect = 5e-85
 Identities = 153/193 (79%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  ++KDI+N  M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 39  FAWTQTRFHLPVWLGFGGAFKHILKKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 98

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYD+LLVS+ L   GE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 99  GIAALYDRLLVSEGLQPLGEKLRANYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYI 158

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TT+NVCQAYTLKRIRDPDYHV LRPH+SK+ +D SK A ELV LNP S+YAPGLEDTLIL
Sbjct: 159 TTMNVCQAYTLKRIRDPDYHVALRPHLSKEVMDTSKPAAELVTLNPASEYAPGLEDTLIL 218

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAG+QNTG
Sbjct: 219 TMKGIAAGLQNTG 231



>pir|T08138|T08138 phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            PE3-PEPCase - rape>gb:BNAPE3_1633477 Brassica napus
            PE3-PEPCase gene for phosphoenolpyruvate carboxylase,
            complete cds.
          Length = 964

 Score =  315 bits (808), Expect = 5e-85
 Identities = 152/193 (78%), Positives = 175/193 (90%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G+AFK  IQKD KNL M +EMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 772  FAWTQTRFHLPVWLGFGSAFKRVIQKDAKNLNMLKEMYNQWPFFRVTIDLVEMVFAKGDP 831

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYD+LLVS++L  FGE+LR NY++T+ LLLQ+AGHKD+LEGDPYL+Q+L+LRD YI
Sbjct: 832  GIAALYDRLLVSEELQPFGEQLRVNYQETRRLLLQVAGHKDILEGDPYLRQRLQLRDPYI 891

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLK+IRDP +HV +RPH+SKDY++ SK A ELVKLNP S+YAPGLEDT+IL
Sbjct: 892  TTLNVCQAYTLKQIRDPSFHVKVRPHLSKDYMESSKPAAELVKLNPKSEYAPGLEDTVIL 951

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 952  TMKGIAAGMQNTG 964



>gb:ETI312658_1677066 Euphorbia tirucalli partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 364

 Score =  315 bits (807), Expect = 6e-85
 Identities = 154/187 (82%), Positives = 172/187 (91%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD+KNL M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDVKNLHMLQDMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV ++L  FGE+LR NYE+TK LLLQIAGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 238 GIAALYDKLLVPEELRPFGEQLRHNYEETKQLLLQIAGHKDLLEGDPYLKQRLRLRDAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA TLK+IRDPDYHVT+RPH+SK+Y++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQACTLKQIRDPDYHVTVRPHLSKEYIESSKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:ETI312657_1677065 Euphorbia tirucalli partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 364

 Score =  315 bits (807), Expect = 6e-85
 Identities = 154/187 (82%), Positives = 172/187 (91%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD+KNL M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDVKNLHMLQDMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV ++L  FGE+LR NYE+TK LLLQIAGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 238 GIAALYDKLLVPEELRPFGEQLRHNYEETKQLLLQIAGHKDLLEGDPYLKQRLRLRDAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA TLK+IRDPDYHVT+RPH+SK+Y++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQACTLKQIRDPDYHVTVRPHLSKEYIESSKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:BRJ223497_1634163 Brassica juncea mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 964

 Score =  315 bits (807), Expect = 6e-85
 Identities = 148/192 (77%), Positives = 174/192 (90%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAA +  ++KD+KNL M Q+MY  WPFFR+TIDL+EMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAIRHVVEKDVKNLHMLQDMYQHWPFFRITIDLIEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS++LW FGE+LR+N+E+TK L+LQ AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 835  GIAALYDKLLVSEELWPFGEKLRANFEETKKLVLQTAGHKDLLEGDPYLKQRLRLRNSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP Y+VTLRPHISK+  +S  + EL++LNPTS+YAPGLEDTLILT
Sbjct: 895  TTLNVCQAYTLKRIRDPSYNVTLRPHISKEIAES--SKELIELNPTSEYAPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKG+AAG+QNTG
Sbjct: 953  MKGVAAGLQNTG 964



>gb:KBRNAPCC4_1683425 K.blossfeldiana mRNA for phosphoenolpyruvate
           carboxylase (Kb4).
          Length = 364

 Score =  314 bits (805), Expect = 1e-84
 Identities = 153/187 (81%), Positives = 171/187 (91%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYNRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIR+P+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIREPNYHVTVRPRLSKEIMESNKAASELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VAAJ2928_1726953 Vanilla aphylla partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  313 bits (802), Expect = 2e-84
 Identities = 154/187 (82%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +QKDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS+DL  FGERLR+NY++TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIASLYDKLLVSEDLLPFGERLRANYQETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP +HV +RPHISK+  D SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPSFHVKVRPHISKEISDASKPAAELVKLNPMSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KDA312632_1683434 Kalanchoe daigremontiana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 364

 Score =  313 bits (801), Expect = 3e-84
 Identities = 153/187 (81%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPRLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KPI312647_1683755 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           B.>gb:KPI344053_1683762 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           2.
          Length = 364

 Score =  312 bits (799), Expect = 5e-84
 Identities = 153/187 (81%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPPLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VPAJ2930_1727312 Vanilla phalaenopsis partial mRNA for
           phosphoenolpyruvate carboxylase.>gb:VPAJ2932_1727314
           Vanilla phalaenopsis partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  311 bits (798), Expect = 7e-84
 Identities = 153/187 (81%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +Q+DIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQEDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS+DL  FGERLR+NY++TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIASLYDKLLVSEDLLPFGERLRANYQETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP +HV +RPHISK+  D SK A ELVKLNP S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPSFHVKVRPHISKEISDASKPAAELVKLNPMSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KPI312648_1683756 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           C.>gb:KPI344054_1683763 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           3.
          Length = 364

 Score =  311 bits (798), Expect = 7e-84
 Identities = 153/187 (81%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWLFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPPLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KBRNAPPC3_1683428 K.blossfeldiana mRNA for phosphoenolpyruvate
           carboxylase (Kb3).
          Length = 364

 Score =  311 bits (798), Expect = 7e-84
 Identities = 153/187 (81%), Positives = 170/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMYN WPFFRVTIDLVEMV AKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYNRWPFFRVTIDLVEMVLAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNGCQAYTLKRIRDPNYHVTVRPRLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KDA312635_1683437 Kalanchoe daigremontiana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 364

 Score =  311 bits (797), Expect = 9e-84
 Identities = 153/187 (81%), Positives = 168/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL   QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLTLQEMYKRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDK LVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEGDPYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKALVSEDLWPFGEQLRNNYNETKTLLLQVAGHKDLLEGDPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP Y+VT+RPH+SK+  +S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPHYNVTVRPHLSKEITESNKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AY663387_1620488 Lupinus albus phosphoenolpyruvate carboxylase 3
            mRNA, complete cds.
          Length = 968

 Score =  310 bits (795), Expect = 2e-83
 Identities = 154/193 (79%), Positives = 171/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  I+KD  NL M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 776  FAWTQTRFHLPVWLGFGKAFKQVIEKDAGNLLMLQEMYNQWPFFRVTIDLVEMVFAKGDP 835

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVSKDLW FGE+LR  YE+TK+ LLQ+A HKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 836  GIAALNDRLLVSKDLWPFGEQLRKKYEETKNHLLQVAAHKDLLEGDPYLKQRLRLRDSYI 895

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIRDP+++V  RPHISKDY++ SK A ELV LNPTS+YAPGLED+LIL
Sbjct: 896  TTLNVFQAYTLKRIRDPNFNVPPRPHISKDYLEKSKSATELVSLNPTSEYAPGLEDSLIL 955

Query: 266  TMKGIAAGMQNTG 228
            +MKGIAAGMQNTG
Sbjct: 956  SMKGIAAGMQNTG 968



>gb:KDA312633_1683435 Kalanchoe daigremontiana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 364

 Score =  310 bits (794), Expect = 2e-83
 Identities = 152/187 (81%), Positives = 169/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEM FAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMGFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPRLSKEIMESNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AB055075_1521415 Oryza sativa (japonica cultivar-group) mRNA for
           phosphoenolpyruvate carboxylase, partial cds,
           clone:OsppcAUC-2.
          Length = 265

 Score =  310 bits (794), Expect = 2e-83
 Identities = 152/193 (78%), Positives = 170/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 73  FAWTQTRFHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTIDLVEMVFAKGDP 132

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FG RLR+NYE+TK LLLQ+AGHKDLLEGDPYL+Q+L++RDSYI
Sbjct: 133 GIAALYDKLLVSEDLWPFGARLRANYEETKQLLLQVAGHKDLLEGDPYLRQRLRIRDSYI 192

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           T LNVCQA T K  + P +HV+ R H+SKD +DS K A ELVKLN TS+Y PGLEDTLIL
Sbjct: 193 TALNVCQACTAKAYQGPGFHVSPRAHLSKDIMDSGKPAAELVKLNTTSEYGPGLEDTLIL 252

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 253 TMKGIAAGMQNTG 265



>gb:MCR312641_1685818 Mesembryanthemum crystallinum partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 366

 Score =  310 bits (793), Expect = 3e-83
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 3/189 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF  AIQKD+KNL + Q+MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFGYAIQKDVKNLSVLQKMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++LW FGERLR+++E+TK L+L+IAGHKDLLEGDPY +Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEELWPFGERLRADFEETKGLILKIAGHKDLLEGDPYSRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS---KHADELVKLNPTSDYAPGLEDTL 273
           TTLN  QAYTLKRIRDP+Y+V LRPHISK+Y+DS   K A ELVKLNP+S+YAPGLEDTL
Sbjct: 298 TTLNALQAYTLKRIRDPNYNVQLRPHISKEYMDSTSNKPAAELVKLNPSSEYAPGLEDTL 357

Query: 272 ILTMKGIAA 246
           ILTMKGIAA
Sbjct: 358 ILTMKGIAA 366



>gb:KFE312681_1683458 Kalanchoe fedtschenkoi partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 238

 Score =  310 bits (793), Expect = 3e-83
 Identities = 151/187 (80%), Positives = 169/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL   QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 52  FAWTQTRFHLPVWLGFGAAFKRVIDKDIKNLLTLQEMYTRWPFFRVTIDLVEMVFAKGDP 111

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 112 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 171

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S + A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 172 TTLNACQAYTLKRIRDPNYHVTVRPRLSKEIMESNNAAAELVKLNPTSEYAPGLEDTLIL 231

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 232 TMKGIAA 238



>gb:GLE310350_1680265 Gnetum leyboldii partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene), clone
           pGne-5.
          Length = 362

 Score =  309 bits (792), Expect = 4e-83
 Identities = 152/186 (81%), Positives = 168/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KDI+NL   Q+MYNEWPFFRVT+DLVEMVFAK DP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDIRNLHTLQQMYNEWPFFRVTLDLVEMVFAKHDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGE+LR NY +TK LLLQ+AGHK++LEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGEQLRKNYVETKDLLLQVAGHKEVLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNV QAYTLKRIRDP YHVTLRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVLQAYTLKRIRDPSYHVTLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:EST400987_1676973 Epidendrum stamfordianum partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 370

 Score =  309 bits (791), Expect = 5e-83
 Identities = 151/193 (78%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD+KNL++ +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDLKNLQILREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L SFGE+LR+ YE+TK LLL++AGHK+LLEGDPYLKQ+L+LR+ YI
Sbjct: 238 GIAALYDKLLVSPELLSFGEQLRAKYEETKRLLLKVAGHKELLEGDPYLKQRLRLRNPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP YH+T +PH S + ++S + A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPSYHLTGKPHPSTEMMNSNNQAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 358 TMKGIAAGMQNTG 370



>gb:DPA17844_1676004 Drosanthemum paxianum mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 370

 Score =  309 bits (791), Expect = 5e-83
 Identities = 152/193 (78%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LGVGAAF+  ++KDI+N  M ++MYN +PFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGVGAAFRHVLEKDIRNHNMLRDMYNNFPFFRVTIDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS+DL  FG RLR+NYEDTK  LL++AGH+DLLEGDPYLKQ+L+LRD YI
Sbjct: 238 EIAALYDKLLVSEDLQPFGARLRANYEDTKRRLLEVAGHRDLLEGDPYLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDPD+ VT RPH+SK+ +D +K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPDFQVTERPHLSKEIMDMNKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 358 TMKGIAAGMQNTG 370



>gb:AB085948_1524434 Eleocharis vivipara pep1 mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 968

 Score =  308 bits (790), Expect = 6e-83
 Identities = 148/195 (75%), Positives = 175/195 (89%), Gaps = 3/195 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG G AFK  I+KD++N ++ +EMYNEWPFFRVT+DLVEMVFAKGDP
Sbjct: 774  FSWTQTRFHLPVWLGFGTAFKHVIEKDVRNFQILREMYNEWPFFRVTLDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAA+YDKLLVS++L  FGE+LR+NYE+TK+LLLQ+AGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 834  KIAAMYDKLLVSEELLPFGEKLRANYEETKNLLLQVAGHKDLLEGDPYLKQRLRLRDAYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS---KHADELVKLNPTSDYAPGLEDTL 273
            TTLN+ QAYTLKRIRDP+Y+V  RPH+SK+ ++S   K ADELVKLNP S+YAPGLEDTL
Sbjct: 894  TTLNLLQAYTLKRIRDPNYNVKFRPHLSKEIMESKTDKPADELVKLNPASEYAPGLEDTL 953

Query: 272  ILTMKGIAAGMQNTG 228
            ILTMKGIAAG QNTG
Sbjct: 954  ILTMKGIAAGFQNTG 968



>sp|P10490|CAP1_MESCR Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1).>pir|S05506|QYIX1 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) 1 - common ice
            plant>gb:MCPPCA_1685804 Mesembryanthemum crystallinum
            ppc1 gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).>gb:MCPPCR_1685806 Mesembryanthemum
            crystallinum mRNA for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 966

 Score =  308 bits (789), Expect = 8e-83
 Identities = 151/193 (78%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LGVG A K  ++KDI+N  M ++MYN +PFFRVTIDL+EMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGVGGALKHVLEKDIRNHNMLRDMYNNFPFFRVTIDLLEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAALYDKLLVS++L SFGERLR+NYEDTK  LL++AGHKDLLEGDPYLKQ+L+LRD YI
Sbjct: 834  EIAALYDKLLVSEELQSFGERLRANYEDTKRRLLEVAGHKDLLEGDPYLKQRLRLRDPYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDPD+ VT RPH+SK+ +D+ K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 894  TTLNVCQAYTLKRIRDPDFKVTERPHLSKEIMDAHKAAAELVKLNPTSEYAPGLEDTLIL 953

Query: 266  TMKGIAAGMQNTG 228
            TMKG+AAG+QNTG
Sbjct: 954  TMKGVAAGLQNTG 966



>gb:KFE312683_1683460 Kalanchoe fedtschenkoi partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 6.
          Length = 364

 Score =  308 bits (788), Expect = 1e-82
 Identities = 150/187 (80%), Positives = 169/187 (90%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL   QEMY  WPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLTLQEMYTRWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLN CQAYTLKRIRDP+YHVT+RP +SK+ ++S + A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNACQAYTLKRIRDPNYHVTVRPRLSKEIMESNNAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AF271162_1782129 Hydrilla verticillata phosphoenolpyruvate
            carboxylase isoform 2 mRNA, complete cds.
          Length = 968

 Score =  307 bits (786), Expect = 2e-82
 Identities = 154/193 (79%), Positives = 168/193 (87%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQT+FHLPV LG G+AFK  I KD KNL+M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 776  FAWTQTKFHLPVWLGFGSAFKHVIGKDPKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDP 835

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAA+YDKLLVSKDL  FGE LR  Y +TK LLL++AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 836  VIAAMYDKLLVSKDLQPFGECLREKYTETKDLLLKVAGHKDLLEGDPYLKQRLQLRDSYI 895

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            T LN CQAYTLKRIRDP Y+V  RPH+SKD V++ K A ELVKLNP S+YAPGLEDTLIL
Sbjct: 896  TALNACQAYTLKRIRDPGYNVQARPHLSKDMVNNGKSAAELVKLNPGSEYAPGLEDTLIL 955

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 956  TMKGIAAGMQNTG 968



>gb:AP004117_1837801 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1134_F06.
          Length = 968

 Score =  306 bits (785), Expect = 2e-82
 Identities = 147/192 (76%), Positives = 170/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  +QKDI+N+   +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 777  FAWTQTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDP 836

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLV+ DL SFGE+LR+N+E+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 837  GIAALYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPYLKQRLRLRESYI 896

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V  +P +SK++VDS    ELV+LN  S+YAPGLEDTLILT
Sbjct: 897  TTLNVCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASEYAPGLEDTLILT 956

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 957  MKGIAAGMQNTG 968



>gb:AF271995_1782197 Oryza sativa phosphoenolpyruvate carboxylase
            mRNA, complete cds.
          Length = 959

 Score =  306 bits (785), Expect = 2e-82
 Identities = 147/192 (76%), Positives = 170/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK  +QKDI+N+   +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 768  FAWTQTRFHLPVWLGFGGAFKHIMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDP 827

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLV+ DL SFGE+LR+N+E+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 828  GIAALYDKLLVAGDLQSFGEQLRNNFEETKQLLLQVAGHKDILEGDPYLKQRLRLRESYI 887

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V  +P +SK++VDS    ELV+LN  S+YAPGLEDTLILT
Sbjct: 888  TTLNVCQAYTLKRIRDPSFEVMSQPALSKEFVDSNQPAELVQLNAASEYAPGLEDTLILT 947

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 948  MKGIAAGMQNTG 959



>gb:TAPEPC_1724601 Triticum aestivum mRNA for phosphoenolpyruvate
           carboxykinase, partial.
          Length = 328

 Score =  306 bits (783), Expect = 4e-82
 Identities = 151/194 (77%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  ++KDI+N  M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 135 FAWTQTRFHLPVWLGFGGAFKHILKKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 194

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYD+LLVS+ L   GE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 195 GIAALYDRLLVSEGLQPLGEKLRANYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYI 254

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNP-TSDYAPGLEDTLI 270
           TT+NVCQAYTLKRIRDPDYHV  RPH+SK+ +D SK A ELV LNP    YAPGLEDTLI
Sbjct: 255 TTMNVCQAYTLKRIRDPDYHVAFRPHLSKEVMDTSKPAAELVTLNPGRVSYAPGLEDTLI 314

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAG+QNTG
Sbjct: 315 LTMKGIAAGLQNTG 328



>pir|T06547|T06547 probable phosphoenolpyruvate carboxylase (EC
           4.1.1.31) - wheat (fragment)
          Length = 328

 Score =  306 bits (783), Expect = 4e-82
 Identities = 151/194 (77%), Positives = 170/194 (87%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  ++KDI+N  M QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 135 FAWTQTRFHLPVWLGFGGAFKHILKKDIRNFHMLQEMYNEWPFFRVTIDLVEMVFAKGNP 194

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYD+LLVS+ L   GE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LRD+YI
Sbjct: 195 GIAALYDRLLVSEGLQPLGEKLRANYEETQKLLLQVAGHKDLLEGDPYLKQRLRLRDAYI 254

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNP-TSDYAPGLEDTLI 270
           TT+NVCQAYTLKRIRDPDYHV  RPH+SK+ +D SK A ELV LNP    YAPGLEDTLI
Sbjct: 255 TTMNVCQAYTLKRIRDPDYHVAFRPHLSKEVMDTSKPAAELVTLNPGRVSYAPGLEDTLI 314

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAG+QNTG
Sbjct: 315 LTMKGIAAGLQNTG 328



>gb:AY663388_1620489 Lupinus albus phosphoenolpyruvate carboxylase 4
            mRNA, complete cds.
          Length = 968

 Score =  305 bits (781), Expect = 7e-82
 Identities = 151/193 (78%), Positives = 171/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KD++NL M QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 776  FAWTQTRFHLPVWLGFGAAFKQVIEKDVRNLHMLQEMYNQWPFFRVTIDLVEMVFAKGDP 835

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVSKDLW FGE+LR  YE+TK+LLL++A HKDLLEGDPYLKQ+L+LR SYI
Sbjct: 836  GIAALNDRLLVSKDLWPFGEQLRKKYEETKNLLLKVAAHKDLLEGDPYLKQRLRLRHSYI 895

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIRDP+++V  R HISK+ ++ S  A ELV LNPTS+YAPGLED+LIL
Sbjct: 896  TTLNVFQAYTLKRIRDPNFNVRPRHHISKESLEKSTSATELVSLNPTSEYAPGLEDSLIL 955

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 956  TMKGIAAGMQNTG 968



>gb:AY491400_1608695 Setaria italica C3 phosphoenolpyruvate
            carboxylase (ppc1) mRNA, complete cds.
          Length = 961

 Score =  305 bits (781), Expect = 7e-82
 Identities = 145/191 (75%), Positives = 170/191 (89%)
 Frame = -2

Query: 800  AWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDPG 621
            AWTQTRFHLPV LG GAAFK  +QKDI+N+   +EMYNEWPFFRVT+DL+EMVFAKGDPG
Sbjct: 771  AWTQTRFHLPVWLGFGAAFKHLMQKDIRNIHTLKEMYNEWPFFRVTLDLLEMVFAKGDPG 830

Query: 620  IAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYIT 441
            IAA+YDKLLV++DL SFGE+LR NYE+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYIT
Sbjct: 831  IAAVYDKLLVAEDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYIT 890

Query: 440  TLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILTM 261
            TLNVCQAYTLKRIRDP + V+ +P +SK++ D     +LV+LNP S+YAPGLEDTLILTM
Sbjct: 891  TLNVCQAYTLKRIRDPGFQVSPQPALSKEFTDESQPAQLVQLNPESEYAPGLEDTLILTM 950

Query: 260  KGIAAGMQNTG 228
            KGIAAGMQNTG
Sbjct: 951  KGIAAGMQNTG 961



>sp|P51061|CAP2_SOYBN Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:SOYPEPC_1716073 Glycine max gmppc1 mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  305 bits (781), Expect = 7e-82
 Identities = 148/193 (76%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I++++KNL M QEMYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKKVIEENVKNLNMLQEMYNQWPFFRVTLDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAAL D+LLVSKDLW FG++LR+ YE+T+ LLLQ+AGHK++LEGDPYLKQ+L+LR + I
Sbjct: 835  KIAALNDRLLVSKDLWPFGDQLRNKYEETRKLLLQVAGHKEILEGDPYLKQRLRLRHAPI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN+ QAYTLKRIRDP+Y+V +RP ISK+  + SK ADELVKLNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNIVQAYTLKRIRDPNYNVKVRPRISKESAEASKSADELVKLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 955  TMKGIAAGMQNTG 967



>pir|JH0381|JH0381 phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            sorghum
          Length = 960

 Score =  305 bits (780), Expect = 9e-82
 Identities = 146/192 (76%), Positives = 170/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAA K  +QKDI+NL + +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 769  FAWTQTRFHLPVWLGFGAAIKHIMQKDIRNLHVLKEMYNEWPFFRVTLDLLEMVFAKGDP 828

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLV++DL SFGE+LR NYE+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 829  GIAAVYDKLLVAEDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYI 888

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V+ +P +SK++ D     ELV+LN  S+YAPGLEDTLILT
Sbjct: 889  TTLNVCQAYTLKRIRDPSFQVSPQPPLSKEFTDESQPVELVQLNQQSEYAPGLEDTLILT 948

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 949  MKGIAAGMQNTG 960



>gb:SRO286750_1722426 Sesbania rostrata mRNA for phosphoenolpyruvate
            carboxylase (pepc gene).
          Length = 961

 Score =  304 bits (779), Expect = 1e-81
 Identities = 148/192 (77%), Positives = 170/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KD++NL M QEMYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKKVIEKDVRNLHMLQEMYNQWPFFRVTLDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA+L D+LLVSKDLW FGE+LR+ YE+TK LLLQ+AGH+++LEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIASLNDRLLVSKDLWPFGEQLRNKYEETKKLLLQVAGHREILEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLN  QAYTLKRIRDP+Y+V ++P ISK+      A ELV LNPTS+YAPGLEDTLILT
Sbjct: 895  TTLNAFQAYTLKRIRDPNYNVKVKPRISKE-----SAVELVTLNPTSEYAPGLEDTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>gb:CUV312637_1674373 Clusia uvitana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           2.>gb:MCR312645_1685822 Mesembryanthemum crystallinum
           partial mRNA for phosphoenolpyruvate carboxylase (pepc
           gene), isoform 6.
          Length = 364

 Score =  304 bits (779), Expect = 1e-81
 Identities = 151/187 (80%), Positives = 168/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KDI+NL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHIIKKDIRNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ALYDKLLVS+DLW+FGE LR+N E+TK LLLQIAGHKDLLEGD YLKQ+L+LRDSYI
Sbjct: 238 GITALYDKLLVSEDLWAFGENLRTNCEETKKLLLQIAGHKDLLEGDLYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA+TLKRIRDP Y+V  RPHISK+ ++ SK A+EL+ LNP+S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAFTLKRIRDPSYNVKFRPHISKEIMETSKSANELLILNPSSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:CUV312636_1674372 Clusia uvitana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 364

 Score =  304 bits (779), Expect = 1e-81
 Identities = 151/187 (80%), Positives = 168/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KDI+NL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHIIKKDIRNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ALYDKLLVS+DLW+FGE LR+N E+TK LLLQIAGHKDLLEGD YLKQ+L+LRDSYI
Sbjct: 238 GITALYDKLLVSEDLWAFGENLRTNCEETKKLLLQIAGHKDLLEGDLYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA+TLKRIRDP Y+V  RPHISK+ ++ SK A+EL+ LNP+S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAFTLKRIRDPSYNVKFRPHISKEIMETSKSANELLILNPSSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AB097087_1525935 Glycine max GmPEPC15 gene for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 967

 Score =  304 bits (778), Expect = 1e-81
 Identities = 147/193 (76%), Positives = 173/193 (89%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I++++KNL M QEMYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKKVIEENVKNLNMLQEMYNQWPFFRVTLDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAAL D+LLVSKDLW FG++LR+ YE+T+ LLLQ+AGHK++LEGDPYLKQ+L+LR + I
Sbjct: 835  KIAALNDRLLVSKDLWPFGDQLRNKYEETRKLLLQVAGHKEILEGDPYLKQRLRLRHAPI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN+ QAYTLKRIRDP+Y+V +RP ISK+  ++ K ADELVKLNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNIVQAYTLKRIRDPNYNVKVRPRISKESAEAXKSADELVKLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 955  TMKGIAAGMQNTG 967



>gb:AB092820_1525119 Lotus corniculatus var. japonicus LjPEPC1 mRNA
            for phosphoenolpyruvate carboxylase, complete cds.
          Length = 961

 Score =  304 bits (778), Expect = 1e-81
 Identities = 151/192 (78%), Positives = 171/192 (89%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAF+  I+KD++NL   QEMYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFRQLIEKDVRNLHTLQEMYNQWPFFRVTIDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVS+DLW FGE+LR+ YE+TK LLLQ+AGHK++LEGDPYLKQ+L+LRDSYI
Sbjct: 835  GIAALNDRLLVSEDLWPFGEQLRNKYEETKKLLLQVAGHKEVLEGDPYLKQRLRLRDSYI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TT+NV QAYTLKRIRDP+Y V    HISK+   SK ADELV+LNPTS+YAPGLEDTLILT
Sbjct: 895  TTMNVFQAYTLKRIRDPNYDV---KHISKE--KSKPADELVRLNPTSEYAPGLEDTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>sp|P29195|CAP1_SORBI Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1) (CP21).>pir|S31159|S31159 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) CP21 -
            sorghum>gb:SVPEPCA_1723257 Sorghum vulgare mRNA for
            phosphoenolpyruvate carboxylase
            (PEPC).>gb:SVPEPCGX_1723260 S.vulgare pepC gene for PEP
            carboxylase.
          Length = 960

 Score =  304 bits (778), Expect = 1e-81
 Identities = 145/192 (75%), Positives = 170/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAA K  +QKDI+N+ + +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 769  FAWTQTRFHLPVWLGFGAAIKHIMQKDIRNIHVLKEMYNEWPFFRVTLDLLEMVFAKGDP 828

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLV++DL SFGE+LR NYE+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 829  GIAAVYDKLLVAEDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYI 888

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V+ +P +SK++ D     ELV+LN  S+YAPGLEDTLILT
Sbjct: 889  TTLNVCQAYTLKRIRDPSFQVSPQPPLSKEFTDESQPVELVQLNQQSEYAPGLEDTLILT 948

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 949  MKGIAAGMQNTG 960



>gb:CRE312616_1673268 Cycas revoluta partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 364

 Score =  303 bits (777), Expect = 2e-81
 Identities = 148/187 (79%), Positives = 168/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  ++KDI+NL + Q+MYNEWPFFRVTIDLVEMVFA+GDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVLEKDIRNLHILQQMYNEWPFFRVTIDLVEMVFARGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+D W  G +LRS Y +TK+LLLQ+AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDXWPVGAQLRSIYVETKNLLLQVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++H  LRPH+SK+ + S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHCNLRPHLSKETMSSTKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AB012228_1511657 Zea mays mRNA for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 960

 Score =  303 bits (777), Expect = 2e-81
 Identities = 145/192 (75%), Positives = 169/192 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAA K  +QKDI+N+ + +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 769  FAWTQTRFHLPVWLGFGAAIKHIMQKDIRNIHILREMYNEWPFFRVTLDLLEMVFAKGDP 828

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLV+ DL SFGE+LR NYE+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 829  GIAAVYDKLLVADDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYI 888

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V+ +P +SK++ D     ELV+LN  S+YAPGLEDTLILT
Sbjct: 889  TTLNVCQAYTLKRIRDPSFQVSPQPPLSKEFTDESQPAELVQLNQQSEYAPGLEDTLILT 948

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 949  MKGIAAGMQNTG 960



>gb:AB008540_1510531 Glycine max mRNA for phosphoenolpyruvate
            carboxylase, complete cds, clone:GmPEPC7.
          Length = 967

 Score =  303 bits (777), Expect = 2e-81
 Identities = 147/193 (76%), Positives = 171/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+K++ NL M QEMYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKEVIEKNVNNLNMLQEMYNQWPFFRVTLDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IA L D+LLVSKDLW FG++LR+ YE+TK LLLQ+AGHK++LEGDPYLKQ+L+LR + I
Sbjct: 835  KIAGLKDRLLVSKDLWRFGDQLRNKYEETKKLLLQVAGHKEILEGDPYLKQRLRLRHAPI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN+ QAYTLKRIRDP+Y+V +RP ISK+  + SK ADEL+KLNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNIVQAYTLKRIRDPNYNVKVRPRISKESAEASKSADELIKLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 955  TMKGIAAGMQNTG 967



>gb:VFA011302_1727073 Vicia faba mRNA for
            phosphoenolpyruvate-carboxylase, pepc1 isoform.
          Length = 966

 Score =  303 bits (776), Expect = 3e-81
 Identities = 151/193 (78%), Positives = 169/193 (87%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KD+KNL M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FAWTQTRFHLPVWLGFGAAFKQVIEKDVKNLHMLQDMYNQWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVS+DLW FGE+LR+ YE+TK LLLQ+A HK++LEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALNDRLLVSEDLWPFGEQLRNKYEETKELLLQVATHKEVLEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIRDP      RP +SKD  + +K ADELV LNPTS+YAPGLEDTLIL
Sbjct: 894  TTLNVFQAYTLKRIRDPKSSANGRPPLSKDSPEATKPADELVTLNPTSEYAPGLEDTLIL 953

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 954  TMKGIAAGMQNTG 966



>gb:AB097088_1525936 Glycine max GmPEPC7 gene for phosphoenolpyruvate
            carboxylase, complete cds.
          Length = 967

 Score =  303 bits (776), Expect = 3e-81
 Identities = 147/193 (76%), Positives = 171/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+K++ NL M QEMYN+WPFFRVT+DLVEMVFAKGDP
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKEVIEKNVNNLNMLQEMYNQWPFFRVTLDLVEMVFAKGDP 834

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IA L D+LLVSKDLW FG++LR+ YE+TK LLLQ+AGHK++LEGDPYLKQ+L+LR + I
Sbjct: 835  KIAGLNDRLLVSKDLWLFGDQLRNKYEETKKLLLQVAGHKEILEGDPYLKQRLRLRHAPI 894

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLN+ QAYTLKRIRDP+Y+V +RP ISK+  + SK ADEL+KLNPTS+YAPGLEDTLIL
Sbjct: 895  TTLNIVQAYTLKRIRDPNYNVKVRPRISKESAEASKSADELIKLNPTSEYAPGLEDTLIL 954

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 955  TMKGIAAGMQNTG 967



>gb:PCA312612_1699093 Pinus caribaea partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 362

 Score =  303 bits (775), Expect = 3e-81
 Identities = 148/186 (79%), Positives = 165/186 (88%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  ++KDI+NL   Q+MYNEWPFF  TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHVMEKDIRNLHTLQQMYNEWPFFWGTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DLW+ G +LR+NY +TK LLLQ+AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSDDLWAIGGQLRANYVETKDLLLQVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP+YHV LRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNYHVNLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:ZDR312615_1731371 Zamia dressleri partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene).
          Length = 364

 Score =  302 bits (774), Expect = 4e-81
 Identities = 146/187 (78%), Positives = 168/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF+  ++KDI+NL M Q+MYNEWP FRVTIDLVEMVFA+GDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFRHVLEKDIRNLHMLQQMYNEWPVFRVTIDLVEMVFAEGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW  G +LRSN+ +TK LLL++AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWLLGSQLRSNFAETKDLLLKVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++H  LRPH+SK+ +  SK A +LVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHCNLRPHLSKETMSSSKPAADLVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:MEX312661_1686022 Microcoelia exilis partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 365

 Score =  302 bits (774), Expect = 4e-81
 Identities = 148/188 (78%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KPAJ2922_1683748 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  302 bits (774), Expect = 4e-81
 Identities = 148/188 (78%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:LBI312668_1683970 Leptotes bicolor partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 290

 Score =  302 bits (773), Expect = 6e-81
 Identities = 148/188 (78%), Positives = 165/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 103 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 162

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 163 GIAALYDKLLVSEDLWPFGEQLRDNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 222

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 223 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 282

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 283 LTMKGIAA 290



>gb:CUV312639_1674375 Clusia uvitana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 364

 Score =  302 bits (773), Expect = 6e-81
 Identities = 150/187 (80%), Positives = 167/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFH PV LG GAAFK  I+KDI+NL M QEMYN WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHSPVWLGFGAAFKHIIKKDIRNLHMLQEMYNAWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ALYDKLLVS+DLW+FGE LR+N E+TK LLLQIAGHKDLLEGD YLKQ+L+LRDSYI
Sbjct: 238 GITALYDKLLVSEDLWAFGENLRTNCEETKKLLLQIAGHKDLLEGDLYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA+TLKRIRDP Y+V  RPHISK+ ++ SK A+EL+ LNP+S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAFTLKRIRDPSYNVKFRPHISKEIMETSKSANELLILNPSSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AEX312622_1760468 Araucaria excelsa partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 362

 Score =  301 bits (771), Expect = 1e-80
 Identities = 146/186 (78%), Positives = 167/186 (89%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL   ++MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDSKNLHTLRQMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ALYDKLLVS+DLWSFGE+LR+N+ +T+ LLL++AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GITALYDKLLVSEDLWSFGEKLRANFLETRDLLLKVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++HV LRPH+SK+   +  A EL+KLN TS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVQLRPHLSKE-SSTNSAAELLKLNTTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:AY251482_1592766 Echinochloa crus-galli phosphoenolpyruvate
            carboxylase (ppc) mRNA, complete cds.
          Length = 961

 Score =  301 bits (771), Expect = 1e-80
 Identities = 145/192 (75%), Positives = 168/192 (87%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFH PV LG GAAFK  +QKDI+N    +EMYNEWPF RVT+DL+EMVFAKGDP
Sbjct: 770  FAWTQTRFHPPVWLGFGAAFKHIMQKDIRNTHTLKEMYNEWPFSRVTLDLLEMVFAKGDP 829

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAA+YDKLLV+ DL SFGE+LR NYE+TK LLLQ+AGHKD+LEGDPYLKQ+L+LR+SYI
Sbjct: 830  GIAAVYDKLLVADDLQSFGEQLRKNYEETKELLLQVAGHKDVLEGDPYLKQRLRLRESYI 889

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYTLKRIRDP + V+ +P +SK++VD     ELV+LNP S+YAPGLE+TLILT
Sbjct: 890  TTLNVCQAYTLKRIRDPSFQVSPQPALSKEFVDESQPAELVRLNPESEYAPGLENTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>gb:AEX312619_1760465 Araucaria excelsa partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 362

 Score =  301 bits (770), Expect = 1e-80
 Identities = 145/186 (77%), Positives = 168/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + ++MYNEWPFFRVTIDLVEMVFA+GDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDSKNLHILRQMYNEWPFFRVTIDLVEMVFARGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ALYDKLLVS+DLWSFGE+LR+N+ +T+ LLL++AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GITALYDKLLVSEDLWSFGEKLRANFLETRDLLLKVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++HV LRPH+SK+   +  A EL+KLN TS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVQLRPHLSKE-SSTNSAAELLKLNTTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:SWI17843_1723284 Selenicereus wittii mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 370

 Score =  301 bits (770), Expect = 1e-80
 Identities = 150/193 (77%), Positives = 169/193 (87%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FA TQTRFHLPV LG GAAFK  I+KDI+NL M +EMYN WPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAMTQTRFHLPVWLGFGAAFKHVIEKDIRNLNMLREMYNMWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS++L SFGE LR NYE+T  LLL++A HKDLLEGDPYLKQ+L+LRD YI
Sbjct: 238 EIAALYDKLLVSEELQSFGELLRKNYEETSRLLLEVAEHKDLLEGDPYLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDPD+ VT RPH+SKD ++S + A ELVKLNPTS++ PGLEDTL+L
Sbjct: 298 TTLNVSQAYTLKRIRDPDFKVTERPHLSKDIMESNNPAAELVKLNPTSEFPPGLEDTLVL 357

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 358 TMKGIAAGMQNTG 370



>gb:MCR312640_1685817 Mesembryanthemum crystallinum partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 363

 Score =  300 bits (768), Expect = 2e-80
 Identities = 145/186 (77%), Positives = 169/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILQKDIRNLQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L SFGE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 238 GIAALYDKLLVSDELKSFGEQLRANYEETEQLLLQVAGHKDLLEGDPYLKQRLRLRESYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTL+VCQAYTLKRIRDP++ V +R  +SK+ +DS    ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLSVCQAYTLKRIRDPNFQVHMRAPLSKEILDSNKPAELVKLNPTSEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>pir|H84855|H84855 phosphoenolpyruvate carboxylase [imported] -
            Arabidopsis thaliana>gb:AC007087_1535214 Arabidopsis
            thaliana chromosome 2 clone F14N22 map mi551, complete
            sequence.
          Length = 941

 Score =  300 bits (767), Expect = 3e-80
 Identities = 144/194 (74%), Positives = 167/194 (86%)
 Frame = -2

Query: 809  MDFAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKG 630
            +D        HLPV LG G AFK  IQKD KNL M +EMYN+WPFFRVTIDLVEMVFAKG
Sbjct: 748  VDLCVDSDEVHLPVWLGFGGAFKRVIQKDSKNLNMLKEMYNQWPFFRVTIDLVEMVFAKG 807

Query: 629  DPGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDS 450
            DPGIAALYD+LLVS++L  FGE+LR NY++T+ LLLQ+AGHKD+LEGDPYL+Q+L+LRD 
Sbjct: 808  DPGIAALYDRLLVSEELQPFGEQLRVNYQETRRLLLQVAGHKDILEGDPYLRQRLQLRDP 867

Query: 449  YITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLI 270
            YITTLNVCQAYTLK+IRDP +HV +RPH+SKDY++S  A ELVKLNP S+YAPGLEDT+I
Sbjct: 868  YITTLNVCQAYTLKQIRDPSFHVKVRPHLSKDYMESSPAAELVKLNPKSEYAPGLEDTVI 927

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 928  LTMKGIAAGMQNTG 941



>gb:SAP312665_1704746 Solenangis aphylla partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 235

 Score =  299 bits (766), Expect = 4e-80
 Identities = 147/188 (78%), Positives = 165/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 48  FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 107

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHK LLEG+PYL+Q+L+LRDSYI
Sbjct: 108 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKALLEGNPYLRQRLRLRDSYI 167

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 168 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 227

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 228 LTMKGIAA 235



>gb:TUS312654_1726111 Tillandsia usneoides partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 363

 Score =  298 bits (764), Expect = 6e-80
 Identities = 145/186 (77%), Positives = 168/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILQKDIRNLQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L SFGE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 238 GIAALYDKLLVSDELKSFGEQLRANYEETEQLLLQVAGHKDLLEGDPYLKQRLRLRESYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTL+VCQAYTLKRIRDP+  V +R  +SK+ +DS    ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLSVCQAYTLKRIRDPNIQVHMRAPLSKEILDSNKPAELVKLNPTSEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:TUS312653_1726110 Tillandsia usneoides partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 363

 Score =  298 bits (764), Expect = 6e-80
 Identities = 144/186 (77%), Positives = 169/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILQKDIRNLQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L SFGE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 238 GIAALYDKLLVSDELKSFGEQLRANYEETEQLLLQVAGHKDLLEGDPYLKQRLRLRESYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTL+VCQAYTLKRIRDP++ V +R  +SK+ +DS    ELVKLNP+S+YAPGLEDTLILT
Sbjct: 298 TTLSVCQAYTLKRIRDPNFQVHMRAPLSKEILDSNKPAELVKLNPSSEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:GBI312614_1679700 Ginkgo biloba partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene).
          Length = 363

 Score =  298 bits (764), Expect = 6e-80
 Identities = 143/186 (76%), Positives = 166/186 (89%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF+  ++KDI+NL M Q+MYNEWP FRVTIDLVEMVFA+ DP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFRHVLEKDIRNLHMLQQMYNEWPVFRVTIDLVEMVFAEEDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FG +LRSN+ +TK LLL++AGH++LLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWLFGSQLRSNFVETKDLLLKVAGHRELLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLN CQAYTLKRIRDP++H  LRPH+SK+   +K A +LVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNGCQAYTLKRIRDPNFHGNLRPHLSKETSSTKPAADLVKLNPTSEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:CUV312638_1674374 Clusia uvitana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 364

 Score =  298 bits (764), Expect = 6e-80
 Identities = 149/187 (79%), Positives = 166/187 (88%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KDI+NL M QEMYN WPFFR TIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHIIKKDIRNLHMLQEMYNAWPFFRGTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            I ALYDKLLVS+DLW+FGE LR+N E+TK LLLQIAGHKDLLEGD YLKQ+L+LRDSYI
Sbjct: 238 RITALYDKLLVSEDLWAFGENLRTNCEETKKLLLQIAGHKDLLEGDLYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQA+TLKRIRDP Y+V  RPHISK+ ++ SK A+EL+ LNP+S+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAFTLKRIRDPSYNVKFRPHISKEIMETSKSANELLILNPSSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AEX312621_1760467 Araucaria excelsa partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 362

 Score =  298 bits (763), Expect = 8e-80
 Identities = 143/186 (76%), Positives = 168/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  ++KD KNL+  ++MYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILRKDKKNLQHIRQMYNEWPFFRVTLDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGE+LR+N+ +T+ LLL++AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGEKLRANFLETRDLLLKVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++HV LRPH+SK+   +  A EL+KLN TS+Y PGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVQLRPHLSKE-SSTNSAAELLKLNTTSEYPPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>sp|Q9AU12|CAPP_PHAVU Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:AF288382_1783464 Phaseolus vulgaris
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 968

 Score =  298 bits (762), Expect = 1e-79
 Identities = 149/194 (76%), Positives = 168/194 (86%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIK-NLKMFQEMYNEWPFFRVTIDLVEMVFAKGD 627
            FAWTQTRFHLPV LG GAAFK  + K+ K NL M QEMYN+WPFFRVT+DLVEMVFAKGD
Sbjct: 775  FAWTQTRFHLPVWLGFGAAFKQVLDKNAKKNLSMLQEMYNQWPFFRVTLDLVEMVFAKGD 834

Query: 626  PGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSY 447
            P I AL D+LLVSKDLW FG++LR+ YE+TK LLLQ+AGHK++LEGDPYLKQ+L+LR S 
Sbjct: 835  PKIGALNDRLLVSKDLWPFGDQLRNKYEETKKLLLQVAGHKEILEGDPYLKQRLRLRHSP 894

Query: 446  ITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLI 270
            ITTLNV QAYTLKRIRDP+Y V  RP ISK+  + SK ADEL+KLNPTS+YAPGLEDTLI
Sbjct: 895  ITTLNVFQAYTLKRIRDPNYKVKARPRISKESAEASKSADELIKLNPTSEYAPGLEDTLI 954

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 955  LTMKGIAAGMQNTG 968



>gb:AF135371_1771078 Lotus corniculatus phosphoenol pyruvate
            carboxylase mRNA, complete cds.
          Length = 957

 Score =  297 bits (761), Expect = 1e-79
 Identities = 150/193 (77%), Positives = 170/193 (88%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEM-YNEWPFFRVTIDLVEMVFAKGD 627
            FAWTQTRFHLPV LG GAAF+  I+KD++NL   QEM YN+WPFFRVTIDLVEMVF KGD
Sbjct: 770  FAWTQTRFHLPVWLGFGAAFRQLIEKDVRNLHTLQEMMYNQWPFFRVTIDLVEMVFLKGD 829

Query: 626  PGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSY 447
            PGIAAL D+LLVS+DLW FGE+LR+ YE+TK LLLQ+AGHK++LEGDPYLKQ+L+LRDSY
Sbjct: 830  PGIAALNDRLLVSEDLWPFGEQLRNKYEETKKLLLQVAGHKEVLEGDPYLKQRLRLRDSY 889

Query: 446  ITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLIL 267
            ITT+NV QAYTLKRIRDP+Y V    HISK+   SK ADELV+LNPTS+YAPGLEDTLIL
Sbjct: 890  ITTMNVFQAYTLKRIRDPNYDV---KHISKE--KSKPADELVRLNPTSEYAPGLEDTLIL 944

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 945  TMKGIAAGMQNTG 957



>gb:MEX312662_1686023 Microcoelia exilis partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 365

 Score =  297 bits (761), Expect = 1e-79
 Identities = 146/188 (77%), Positives = 165/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTI LVEMVFA+GDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIYLVEMVFAQGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FGE+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFGEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:VPPPCGE1_1727330 V.planifolia mRNA for phosphoenolpyruvate
            carboxylase, air roots.
          Length = 956

 Score =  297 bits (760), Expect = 2e-79
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG G AFK    KDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 765  FAWTQTRFHLPVWLGFGTAFKHVSPKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 824

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA+LY KLLVS +LWSFGERLR+NY++TK LLLQ+AGHK  L+ +   + ++ LRDSYI
Sbjct: 825  GIASLYGKLLVSSELWSFGERLRANYQETKDLLLQVAGHKVFLK-ESLSEAEVGLRDSYI 883

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNVCQAYTLKRIRDP++HV +RPHISK+  D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 884  TTLNVCQAYTLKRIRDPNFHVKVRPHISKEISDASKPAAELVKLNPTSEYAPGLEDTLIL 943

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAGMQNTG
Sbjct: 944  TMKGIAAGMQNTG 956



>gb:TUS312656_1726112 Tillandsia usneoides partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 363

 Score =  297 bits (760), Expect = 2e-79
 Identities = 144/186 (77%), Positives = 168/186 (90%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILQKDIRNLQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS +L SFGE+LR+NYE+T+ LLLQ+AGHKDLLEGDPYLKQ+L+LR+SYI
Sbjct: 238 RIAALYDKLLVSDELKSFGEQLRANYEETEQLLLQVAGHKDLLEGDPYLKQRLRLRESYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTL+VCQAYTLKRIRDP++ V +R  +SK+ +DS    ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLSVCQAYTLKRIRDPNFQVHMRAPLSKEILDSNKPAELVKLNPTSEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:MCR312642_1685819 Mesembryanthemum crystallinum partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 364

 Score =  297 bits (760), Expect = 2e-79
 Identities = 147/187 (78%), Positives = 167/187 (89%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LGVG A K  ++KDI+N  M ++MYN +PFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGVGGALKHVLEKDIRNHNMLRDMYNNFPFFRVTIDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS++L SFGERLR+NYEDTK  LL++AGHKDLLEGDPYLKQ+L+LRD YI
Sbjct: 238 EIAALYDKLLVSEELQSFGERLRANYEDTKRRLLEVAGHKDLLEGDPYLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDPD+ VT RPH+SK+ +D+ K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPDFKVTERPHLSKEIMDAHKAAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:MEX312663_1686024 Microcoelia exilis partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 365

 Score =  296 bits (759), Expect = 2e-79
 Identities = 146/188 (77%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTR HLPV LG GAAFK  I KDIKNL M QEMY  WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRLHLPVWLGFGAAFKHVIDKDIKNLLMLQEMYTRWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW F E+LR+NY +TK+LLLQ+AGHKDLLEG+PYL+Q+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWPFVEQLRNNYNETKNLLLQVAGHKDLLEGNPYLRQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLN CQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNACQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:VPL312625_1727322 Vanilla planifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 364

 Score =  296 bits (757), Expect = 4e-79
 Identities = 147/187 (78%), Positives = 162/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KD KNL   +EMYN WPFFRVTIDL+EMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIAKDNKNLHTLREMYNGWPFFRVTIDLIEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYDKLLVS +L  FG +LR NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LRD YI
Sbjct: 238 GIASLYDKLLVSSELLPFGVQLRENYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP YHVT RPH++K+  +S K A ELVKLNPTS+Y PGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPGYHVTERPHLAKETTESIKSAAELVKLNPTSEYGPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:WWPPC_1727779 W.mirabilis mRNA for phosphoenolpyruvate
            carboxylase.
          Length = 944

 Score =  295 bits (755), Expect = 7e-79
 Identities = 148/186 (79%), Positives = 164/186 (88%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KDI+NL   Q+MYNEWPFFRVTIDLVEMVFAK  P
Sbjct: 761  FAWTQTRFHLPVWLGFGAAFKSVIEKDIRNLHTLQQMYNEWPFFRVTIDLVEMVFAK-HP 819

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IAALYDKLLVS  LW+FGE+LR NY +TK+LLLQ+AGHK++LEGDPYLKQ+L+LRDSYI
Sbjct: 820  EIAALYDKLLVSSVLWAFGEQLRKNYVETKTLLLQVAGHKEVLEGDPYLKQRLRLRDSYI 879

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLN  QAYTLKRIRDP YHVTLRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 880  TTLNALQAYTLKRIRDPSYHVTLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 938

Query: 263  MKGIAA 246
            MKGIAA
Sbjct: 939  MKGIAA 944



>gb:MCR312643_1685820 Mesembryanthemum crystallinum partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 364

 Score =  294 bits (753), Expect = 1e-78
 Identities = 146/187 (78%), Positives = 166/187 (88%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LGVG A K  ++KDI+N  M ++MYN +PFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGVGGALKHVLEKDIRNHNMLRDMYNNFPFFRVTIDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS++L SFGERLR+NYEDTK  LL++AGHKDLLEGDPYLKQ+L+LRD YI
Sbjct: 238 EIAALYDKLLVSEELQSFGERLRANYEDTKRRLLEVAGHKDLLEGDPYLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDPD+ VT RPH+SK+ +D+ K A ELVKLNPTS+YAPGL DTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPDFKVTERPHLSKEIMDAHKAAAELVKLNPTSEYAPGLGDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KSAJ1303_1683783 Kalanchoe streptantha partial mRNA for
           phosphoenolpyruvate carboxylase.>gb:KSAJ2923_1683784
           Kalanchoe streptantha partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 371

 Score =  294 bits (753), Expect = 1e-78
 Identities = 145/194 (74%), Positives = 166/194 (85%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDSKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEELRTGYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>gb:PCA312613_1699094 Pinus caribaea partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 362

 Score =  293 bits (751), Expect = 2e-78
 Identities = 145/186 (77%), Positives = 161/186 (86%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  ++KD +NL   Q+MYNEWPFF  TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHVMEKDPRNLHTLQQMYNEWPFFWGTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DLW+ G +LR+NY +TK LLLQ+AGH DLLEG+PYLKQ+LKLRDSYI
Sbjct: 238 GIAALYDKLLVSDDLWAIGGQLRANYVETKDLLLQVAGHSDLLEGNPYLKQRLKLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP  HV LRPH+SK+   +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPHVHVNLRPHLSKE-SSTKPAAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:DFAJ2943_1675832 Dendrobium fimbriatum partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  293 bits (751), Expect = 2e-78
 Identities = 146/187 (78%), Positives = 164/187 (87%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNILREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH+T +P++S + ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRIRDPSYHLTAKPNLSNEIMNSNKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KGAJ1288_1683470 Kalanchoe gracilipes partial mRNA for
           phosphoenolpyruvate carboxylase.>gb:KGAJ2946_1683473
           Kalanchoe gracilipes partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 371

 Score =  293 bits (750), Expect = 3e-78
 Identities = 146/194 (75%), Positives = 166/194 (85%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVINKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V LRP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPLRPPIAKEVMEGSISSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKG AAGMQNTG
Sbjct: 358 LTMKGNAAGMQNTG 371



>gb:DFAJ2940_1675830 Dendrobium farmeri partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  293 bits (750), Expect = 3e-78
 Identities = 146/187 (78%), Positives = 163/187 (87%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL M +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNMLREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH+  +P++S + ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRIRDPSYHLPAKPNLSNEIMNSNKSAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VPPPCGEN_1727331 V.planifolia mRNA for phosphoenolpyruvate
            carboxylase, leaf.
          Length = 958

 Score =  293 bits (749), Expect = 3e-78
 Identities = 147/194 (75%), Positives = 164/194 (84%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I KD KNL   +EMYN WPFFRVTIDL+EMVF KG+P
Sbjct: 765  FAWTQTRFHLPVWLGFGAAFKHVISKDNKNLHTLREMYNGWPFFRVTIDLIEMVFTKGNP 824

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLK-QQLKLRDSY 447
            GIA+LYDKLLVS +L  FG +LR NY +TK LLL +AGHKDLLEGDPYLK Q+L+LRD Y
Sbjct: 825  GIASLYDKLLVSSELLPFGAQLRENYGETKRLLLLVAGHKDLLEGDPYLKDQRLRLRDPY 884

Query: 446  ITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLI 270
            ITTLNVCQAYTLKRIR+P YHVT RPH+ K+  +S K A ELVKLNPTS+Y PGLEDTLI
Sbjct: 885  ITTLNVCQAYTLKRIREPGYHVTARPHLLKETDESIKSAAELVKLNPTSEYGPGLEDTLI 944

Query: 269  LTMKGIAAGMQNTG 228
            +TMKGIAAG+QNTG
Sbjct: 945  ITMKGIAAGLQNTG 958



>gb:KPAJ1295_1683744 Kalanchoe petitiana partial mRNA for
           phosphoenolpyruvate carboxylase.>gb:KPAJ2947_1683750
           Kalanchoe petitiana partial mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 371

 Score =  292 bits (748), Expect = 4e-78
 Identities = 145/194 (74%), Positives = 166/194 (85%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKETMEGSISSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>pir|S68413|S68413 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 1 -
           Kalanchoe blossfeldiana (fragment)
          Length = 371

 Score =  292 bits (748), Expect = 4e-78
 Identities = 145/194 (74%), Positives = 166/194 (85%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 179 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGDP 238

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLL S++LW  GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LK+R +YI
Sbjct: 239 GIAALYDKLL-SEELWPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKVRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>gb:AEX312620_1760466 Araucaria excelsa partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 362

 Score =  292 bits (747), Expect = 6e-78
 Identities = 141/186 (75%), Positives = 165/186 (88%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG  AAF   + KD KNL+  ++MYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFVAAFNHILAKDKKNLQHIRQMYNEWPFFRVTLDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLWSFGE+LR+N+ +T+ LLL++AGH+DLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GIAALYDKLLVSEDLWSFGEKLRANFLETRDLLLKVAGHRDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++HV LRPH+SK+   +  A EL+KLN TS+Y PGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHVQLRPHLSKE-SSTNSAAELLKLNTTSEYPPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:HVU65227_1682833 Hydrilla verticillata phosphoenolpyruvate
           carboxylase isoform 2 mRNA, partial cds.
          Length = 364

 Score =  292 bits (747), Expect = 6e-78
 Identities = 146/187 (78%), Positives = 161/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQT+FHLPV LG G+AFK  I KD KNL+M QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTKFHLPVWLGFGSAFKHVIGKDPKNLQMLQEMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAA+YDKLLVSKDL  FGE LR  Y +TK LLL++AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 VIAAIYDKLLVSKDLQPFGECLREKYTETKDLLLKVAGHKDLLEGDPYLKQRLQLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           T LN CQAYTLKRIRDP Y+V  RPH+SKD V++ K A ELVKLNP S+YAPGLEDTLIL
Sbjct: 298 TALNACQAYTLKRIRDPGYNVQARPHLSKDMVNNGKSAAELVKLNPGSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKG+ A
Sbjct: 358 TMKGVRA 364



>gb:PAPPC1_1698836 Pereskia aculeata mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 369

 Score =  291 bits (746), Expect = 8e-78
 Identities = 147/193 (76%), Positives = 168/193 (87%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK AI+KDI+NL M +EMYN WPFFRVT+DLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKNAIEKDIRNLHMLREMYNMWPFFRVTLDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS++L SFGERLR  YE+T  LLL++AG + LLEGDPYL Q+L+LRD YI
Sbjct: 238 EIAALYDKLLVSEELQSFGERLRKEYEETSRLLLEVAGAR-LLEGDPYLTQRLRLRDPYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP++ VT RPH+SKD ++S + A ELVKLNPTS++ PGLEDTL+L
Sbjct: 297 TTLNVSQAYTLKRIRDPNFKVTERPHLSKDIMESNNPAAELVKLNPTSEFPPGLEDTLVL 356

Query: 266 TMKGIAAGMQNTG 228
           TMKGI AGMQNTG
Sbjct: 357 TMKGIRAGMQNTG 369



>gb:ABA312674_1529727 Aloe vera partial mRNA for phosphoenolpyruvate
           carboxylase (pepc gene), isoform 2.
          Length = 364

 Score =  291 bits (746), Expect = 8e-78
 Identities = 145/187 (77%), Positives = 164/187 (87%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LGVGAAFK  ++KD KN +  +EMYN WPFFRVTIDL+EMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGVGAAFKHVMEKDKKNFQTLREMYNVWPFFRVTIDLLEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS+DL  FGERLR+NY +TKSLLLQ+AGHKDLLEGDPYLKQ+L+LR++YI
Sbjct: 238 DIAALYDKLLVSEDLQPFGERLRNNYVETKSLLLQVAGHKDLLEGDPYLKQRLRLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP Y+V LRP +SKD  +  K A E + LNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPTYNVNLRPRLSKDVTERRKPAAEFLTLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:ACO312630_1745386 Ananas comosus partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 363

 Score =  291 bits (745), Expect = 1e-77
 Identities = 140/186 (75%), Positives = 165/186 (88%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  ++KD +NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILRKDRRNLRILKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+LR+NYE+TK LLL+ AGH DLLEGDPYLKQ+++LR++YI
Sbjct: 238 GIAALYDKLLVSDELKPFGEQLRANYEETKQLLLKAAGHTDLLEGDPYLKQRIRLREAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++ V +RP +SK+ +DS    ELVKLNP S+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFKVDVRPPLSKEILDSNKQAELVKLNPASEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:ABA312673_1529726 Aloe vera partial mRNA for phosphoenolpyruvate
           carboxylase (pepc gene), isoform 1.
          Length = 339

 Score =  291 bits (745), Expect = 1e-77
 Identities = 145/187 (77%), Positives = 164/187 (87%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LGVGAAFK  ++KD KN +  +EMYN WPFFRVTIDL+EMVFAKG+P
Sbjct: 153 FAWTQTRFHLPVWLGVGAAFKHIMEKDKKNFQTLREMYNVWPFFRVTIDLLEMVFAKGNP 212

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS+DL  FGERLR+NY +TKSLLLQ+AGHKDLLEGDPYLKQ+L+LR++YI
Sbjct: 213 DIAALYDKLLVSEDLQPFGERLRNNYVETKSLLLQVAGHKDLLEGDPYLKQRLRLRNAYI 272

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP Y+V LRP +SKD  +  K A E + LNPTS+YAPGLEDTLIL
Sbjct: 273 TTLNVCQAYTLKRIRDPTYNVNLRPRLSKDVTERRKPAAEFLTLNPTSEYAPGLEDTLIL 332

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 333 TMKGIAA 339



>gb:CSP310348_1674035 Cupressus sp. HHG-2001 partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 362

 Score =  291 bits (744), Expect = 1e-77
 Identities = 144/186 (77%), Positives = 162/186 (87%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I  D   L   ++MYNE PFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIXXDXXXLHTLRQMYNELPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GI ++YDKLLVS+DLWSFGE+LR+ Y +TK LLL++AGHKDLLEGDPYLKQ+L+LRDSYI
Sbjct: 238 GITSVYDKLLVSEDLWSFGEKLRAIYLETKDLLLKVAGHKDLLEGDPYLKQRLRLRDSYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP++H   RPH+SK+   +K ADELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPNFHCQQRPHLSKE-SSTKPADELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:ACO312628_1745384 Ananas comosus partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 363

 Score =  290 bits (743), Expect = 2e-77
 Identities = 139/186 (74%), Positives = 165/186 (88%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  ++KD +NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILRKDRRNLRILKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+LR+NYE+TK LLL++AGH DLLEGDPYLKQ+++LR++YI
Sbjct: 238 GIAALYDKLLVSDELKPFGEQLRANYEETKQLLLKVAGHTDLLEGDPYLKQRIRLREAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYT KRIRDP++ V +RP +SK+ +DS    ELVKLNP S+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTKKRIRDPNFKVDVRPPLSKEILDSNKQAELVKLNPASEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:DFAJ2939_1675829 Dendrobium farmeri partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  290 bits (743), Expect = 2e-77
 Identities = 145/187 (77%), Positives = 162/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL M +EMYNEWPFFRVTIDL+EM F KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNMLREMYNEWPFFRVTIDLIEMGFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH+  +P++S + ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRIRDPSYHLPAKPNLSNEIMNSNKSAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:DTAJ2936_1676189 Dendrobium thyrsifolium partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  290 bits (742), Expect = 2e-77
 Identities = 145/187 (77%), Positives = 162/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNLLREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH+  +P+ S + ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRIRDPSYHLNAKPNQSNEIMNSNKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:SSP318338_1722549 Saccharum spontaneum mRNA for putative C4
            phosphoenolpyruvate carboxylase (pepc gene), (C4
            PPCSs-1).
          Length = 961

 Score =  290 bits (741), Expect = 3e-77
 Identities = 142/192 (73%), Positives = 161/192 (83%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KDIKN +  +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 770  FSWTQTRFHLPVWLGVGAAFKWAIDKDIKNFQKLKEMYNEWPFFRVTLDLLEMVFAKGDP 829

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD LLV+ DL  FG++LR  Y +T+ LLLQIAGHKD+LEGDPYLKQ L+LR+ YI
Sbjct: 830  GIAGLYDLLLVADDLKPFGKQLRDKYMETEKLLLQIAGHKDILEGDPYLKQGLRLRNPYI 889

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP + VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 890  TTLNVLQAYTLKRIRDPSFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>gb:MCR312644_1685821 Mesembryanthemum crystallinum partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 5.
          Length = 366

 Score =  290 bits (741), Expect = 3e-77
 Identities = 145/189 (76%), Positives = 165/189 (87%), Gaps = 3/189 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I+KDI+N  + +EMYN+WPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHVIKKDIRNHSVLREMYNDWPFFRVTIDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL SFGERLR+NYEDTK  LL++AGHKDLLEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSDDLQSFGERLRANYEDTKRRLLEVAGHKDLLEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVC-QAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTL 273
           TTLNVC QAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTL
Sbjct: 298 TTLNVCQQAYTLKRIRDPSYRVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTL 357

Query: 272 ILTMKGIAA 246
           ILTMKGIAA
Sbjct: 358 ILTMKGIAA 366



>gb:AY135709_1581780 Saccharum hybrid cultivar putative C4
            phosphoenolpyruvate carboxylase mRNA, complete cds.
          Length = 961

 Score =  290 bits (741), Expect = 3e-77
 Identities = 142/192 (73%), Positives = 161/192 (83%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KDIKN +  +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 770  FSWTQTRFHLPVWLGVGAAFKWAIDKDIKNFQKLKEMYNEWPFFRVTLDLLEMVFAKGDP 829

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD LLV+ DL  FG++LR  Y +T+ LLLQIAGHKD+LEGDPYLKQ L+LR+ YI
Sbjct: 830  GIAGLYDLLLVADDLKPFGKQLRDKYVETEKLLLQIAGHKDILEGDPYLKQGLRLRNPYI 889

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP + VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 890  TTLNVLQAYTLKRIRDPSFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>sp|P51062|CAPP_PEA Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:PEASPARKLE_1699749 Pea mRNA for
            phosphoenolpyruvate carboxylase, complete cds.
          Length = 967

 Score =  290 bits (741), Expect = 3e-77
 Identities = 146/194 (75%), Positives = 168/194 (86%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F WTQTRFHLPV LG G+AFK  I+KD+KNL M Q+MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 774  FPWTQTRFHLPVWLGFGSAFKQVIEKDVKNLHMLQDMYNQWPFFRVTIDLVEMVFAKGDP 833

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAAL D+LLVS++LW FGE+LR+ YE+TK LLLQ+A HK++LEGDPYLKQ+L+LRDSYI
Sbjct: 834  GIAALNDRLLVSQNLWPFGEQLRNKYEETKKLLLQVATHKEVLEGDPYLKQRLRLRDSYI 893

Query: 443  TTLNVCQAYTLKRIRDPDYHVTL-RPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLI 270
            TTLNV QAYTLKRIRDP   V   R  +S++  + +K ADELV LNPTS+YAPGLEDTLI
Sbjct: 894  TTLNVFQAYTLKRIRDPKSSVNASRLPLSRESPEATKPADELVTLNPTSEYAPGLEDTLI 953

Query: 269  LTMKGIAAGMQNTG 228
            LTMKGIAAGMQNTG
Sbjct: 954  LTMKGIAAGMQNTG 967



>gb:DDAJ2944_1675796 Dendrobium delicatum partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  289 bits (740), Expect = 4e-77
 Identities = 144/187 (77%), Positives = 162/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTR HLPV LG GAAFK  I+KD KNL + +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRLHLPVWLGFGAAFKHVIEKDKKNLNILREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLVPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP  H+T +P +S + ++S K A ELV+LNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVCQAYTLKRIRDPSSHLTAKPSLSNEIMNSHKPAAELVQLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:ACO312631_1745387 Ananas comosus partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 363

 Score =  289 bits (739), Expect = 5e-77
 Identities = 138/186 (74%), Positives = 165/186 (88%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  ++KD +NL++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHILRKDRRNLRILKEMYNEWPFFRVTLDLLEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+LR+NYE+TK LLL++AGH DLLEGDPYLKQ+++LR++YI
Sbjct: 238 GIAALYDKLLVSDELKPFGEQLRANYEETKQLLLKVAGHTDLLEGDPYLKQRIRLREAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYT +RIRDP++ V +RP +SK+ +DS    ELVKLNP S+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTQRRIRDPNFKVDVRPPLSKETLDSNKQAELVKLNPASEYAPGLEDTLILT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>pir|S68414|S68414 phosphoenolpyruvate carboxylase (EC 4.1.1.31) 2 -
           Kalanchoe blossfeldiana (fragment)
          Length = 371

 Score =  289 bits (739), Expect = 5e-77
 Identities = 143/194 (73%), Positives = 165/194 (85%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFR TIDLVEMVFAKG+P
Sbjct: 179 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRATIDLVEMVFAKGNP 238

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA LYDKLLVS++LW  GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LK+R +YI
Sbjct: 239 GIA-LYDKLLVSEELWPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKVRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>gb:AF530570_1809082 X Mokara cv. 'Yellow' phosphoenolpyruvate
            carboxylase (PEPC) mRNA, complete cds.
          Length = 954

 Score =  288 bits (738), Expect = 6e-77
 Identities = 148/193 (76%), Positives = 167/193 (86%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  I+KD KNL + +EM+N+WPFFRVTIDL+EMVF+KG+ 
Sbjct: 765  FAWTQTRFHLPVWLGFGAAFKHVIKKDPKNLLILREMHNDWPFFRVTIDLIEMVFSKGNS 824

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+A HK LLEGDPYLKQ+L+LR  YI
Sbjct: 825  GIAALYDKLLVSPDLLPFGEQLRANYEETKDLLLQVADHKTLLEGDPYLKQRLRLRVPYI 884

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
            TTLNV QAYTLKRIR+PDY V   PHIS D ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 885  TTLNVYQAYTLKRIREPDYAV---PHISNDKLNSNKTAAELVKLNPTSEYAPGLEDTLIL 941

Query: 266  TMKGIAAGMQNTG 228
            TMKGIAAG+QNTG
Sbjct: 942  TMKGIAAGLQNTG 954



>gb:SOF293346_1715673 Saccharum officinarum mRNA for putative C4
            phosphoenolpyruvate carboxylase (PEPC gene).
          Length = 961

 Score =  288 bits (738), Expect = 6e-77
 Identities = 142/192 (73%), Positives = 161/192 (83%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KDIKN +  +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 770  FSWTQTRFHLPVWLGVGAAFKWAIDKDIKNFQKLKEMYNEWPFFRVTLDLLEMVFAKGDP 829

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD LLV+ DL  FG++LR  Y +T+ LLLQIAGHKD+LEGDPYLKQ L+LR+ YI
Sbjct: 830  GIAGLYDLLLVADDLKPFGKQLRDKYVETEKLLLQIAGHKDILEGDPYLKQGLRLRNPYI 889

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP + VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 890  TTLNVLQAYTLKRIRDPCFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 949

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 950  MKGIAAGMQNTG 961



>gb:LBI312672_1683974 Leptotes bicolor partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 5.
          Length = 362

 Score =  288 bits (737), Expect = 8e-77
 Identities = 141/186 (75%), Positives = 160/186 (86%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD+KNL M +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDLKNLNMLREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA LYDKLLVS +L  FGE+LR+ YE+ K LLL++AGHK+LLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIATLYDKLLVSPELLPFGEQLRAKYEEAKRLLLKVAGHKELLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP YH T +PH+  + ++ + A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPSYHPTAKPHLPTEIMNYE-AAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:DMAJ2941_1675960 Dendrobium moschatum partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  288 bits (737), Expect = 8e-77
 Identities = 143/186 (76%), Positives = 162/186 (87%), Gaps = 1/186 (0%)
 Frame = -2

Query: 800 AWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDPG 621
           AWTQTR HLPV LG GAAFK  I+KD KNL + +EMYNEWPFFRVTIDL+EMVF KG PG
Sbjct: 179 AWTQTRLHLPVWLGFGAAFKHVIEKDKKNLNILREMYNEWPFFRVTIDLIEMVFTKGSPG 238

Query: 620 IAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYIT 441
           IAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YIT
Sbjct: 239 IAALYDKLLVSSDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYIT 298

Query: 440 TLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLILT 264
           TLNV QAYTLKRIRDP YH+T +P++S + ++ +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 299 TLNVWQAYTLKRIRDPSYHLTAKPNLSNEIMNYNKPAAELVKLNPTSEYAPGLEDTLILT 358

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 359 MKGIAA 364



>gb:LBI312671_1683973 Leptotes bicolor partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 362

 Score =  287 bits (735), Expect = 1e-76
 Identities = 141/186 (75%), Positives = 160/186 (86%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD+KNL M +EMYNEWPFFRVTI L+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDLKNLNMLREMYNEWPFFRVTIGLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA LYDKLLVS +L  FGE+LR+ YE+TK LLL++AGHK+LLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIATLYDKLLVSPELLPFGEQLRAKYEETKRLLLKVAGHKELLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP YH T +PH+  + ++ + A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKRIRDPSYHPTAKPHLPTEIMNYE-AAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:VPAJ2931_1727313 Vanilla phalaenopsis partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 363

 Score =  286 bits (733), Expect = 2e-76
 Identities = 139/186 (74%), Positives = 158/186 (84%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDI+NL + +EMYN WPFFRVTIDL+EMVF KG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVITKDIRNLHILREMYNGWPFFRVTIDLIEMVFTKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYD+LLVS DL SFG  L++NYE+TK LLLQ+AGHKDLLEGDP+LKQ+L+LRD YI
Sbjct: 238 GIASLYDELLVSNDLLSFGMELKANYEETKRLLLQVAGHKDLLEGDPHLKQRLRLRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIR+P YH     H+S +    K A ELVKLNPTS+YAPGLEDTLI+T
Sbjct: 298 TTLNVCQAYTLKRIREPSYHAMAPHHVSNETESRKSAAELVKLNPTSEYAPGLEDTLIIT 357

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 358 MKGIAA 363



>gb:ZMPEP_1731956 Z.mays gene for phosphoenolpyruvate carboxylase (EC
            4.1.1.31).
          Length = 970

 Score =  286 bits (732), Expect = 3e-76
 Identities = 138/192 (71%), Positives = 164/192 (85%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KD++N ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 779  FSWTQTRFHLPVWLGVGAAFKFAIDKDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 838

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L LR+ YI
Sbjct: 839  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLVLRNPYI 898

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP++ VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 899  TTLNVFQAYTLKRIRDPNFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 958

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 959  MKGIAAGMQNTG 970



>gb:ZMA536629_1731578 Zea mays mRNA for phosphoenolpyruvate
            carboxylase (ppc1 gene), clone pM500.
          Length = 970

 Score =  286 bits (732), Expect = 3e-76
 Identities = 138/192 (71%), Positives = 164/192 (85%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KD++N ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 779  FSWTQTRFHLPVWLGVGAAFKFAIDKDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 838

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L LR+ YI
Sbjct: 839  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLVLRNPYI 898

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP++ VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 899  TTLNVFQAYTLKRIRDPNFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 958

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 959  MKGIAAGMQNTG 970



>pir|S04546|QYZM phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            maize>gb:ZMPEPC1G_1731958 Maize PEPC1 gene for
            phosphoenolpyruvate carboxylase (EC 4.1.1.31).
          Length = 970

 Score =  286 bits (732), Expect = 3e-76
 Identities = 138/192 (71%), Positives = 164/192 (85%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KD++N ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 779  FSWTQTRFHLPVWLGVGAAFKFAIDKDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 838

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L LR+ YI
Sbjct: 839  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLVLRNPYI 898

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP++ VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 899  TTLNVFQAYTLKRIRDPNFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 958

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 959  MKGIAAGMQNTG 970



>sp|P04711|CAP1_MAIZE Phosphoenolpyruvate carboxylase 1 (EC 4.1.1.31)
            (PEPCase 1).>gb:ZMPEPC1_1731957 Maize mRNA for
            phosphoenolpyruvate carboxylase (EC 4.1.1.31).
          Length = 970

 Score =  286 bits (732), Expect = 3e-76
 Identities = 138/192 (71%), Positives = 164/192 (85%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KD++N ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 779  FSWTQTRFHLPVWLGVGAAFKFAIDKDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 838

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L LR+ YI
Sbjct: 839  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLVLRNPYI 898

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP++ VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 899  TTLNVFQAYTLKRIRDPNFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 958

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 959  MKGIAAGMQNTG 970



>sp|Q43299|CAPP_AMAHP Phosphoenolpyruvate carboxylase (EC 4.1.1.31)
            (PEPCase).>gb:AHC4PHPEC_1811112 A.hypochondriacus mRNA
            for C4 photosynthetic phosphoenolpyruvate
            carboxylase.>gb:AMHCPPC_1819229 Amaranthus
            hypochondriacus C4 photosynthetic phosphoenolpyruvate
            carboxylase mRNA, complete cds.
          Length = 964

 Score =  286 bits (731), Expect = 4e-76
 Identities = 140/192 (72%), Positives = 160/192 (83%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAFK  I+KDIKNL M ++MYN+W FFRVTIDL+EMVFAKGDP
Sbjct: 773  FSWTQTRFHLPVWLGCGAAFKHVIEKDIKNLAMLKDMYNQWSFFRVTIDLLEMVFAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLV  +L  FGE LR +Y + +  LL+IAGHKD L+ DPYLKQ L+LRD Y 
Sbjct: 833  GIAALYDKLLVKDELKPFGENLRKSYLEAQKFLLEIAGHKDPLDADPYLKQILRLRDPYT 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV Q YTLKRIRDP +HVT+RPH+SK+   +  A +LVKLNPTS+Y PGLEDTLILT
Sbjct: 893  TTLNVFQVYTLKRIRDPSFHVTVRPHLSKEMDANSLAADLVKLNPTSEYPPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>gb:ZMPEPCR_1731963 Maize mRNA for phosphoenolpyruvate carboxylase
            (PEPCase EC 4.1.1.31).
          Length = 935

 Score =  284 bits (727), Expect = 1e-75
 Identities = 137/192 (71%), Positives = 163/192 (84%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KD++N ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 744  FSWTQTRFHLPVWLGVGAAFKFAIDKDVRNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 803

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L LR+ YI
Sbjct: 804  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLVLRNPYI 863

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP++ VT +P +SK++ D      LVKLNP S+Y PGLEDTLILT
Sbjct: 864  TTLNVFQAYTLKRIRDPNFKVTPQPPLSKEFADENKPAGLVKLNPASEYPPGLEDTLILT 923

Query: 263  MKGIAAGMQNTG 228
            MKGI AGMQNTG
Sbjct: 924  MKGIRAGMQNTG 935



>gb:VPPPC1_1727329 Vanilla planifolia mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 363

 Score =  284 bits (727), Expect = 1e-75
 Identities = 143/187 (76%), Positives = 162/187 (86%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK    KDIKNL++ QEMYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVSPKDIKNLRILQEMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LY KLLVS +LWSFGERLR+NY++TK LLLQ+AGHK  L+ +   + ++ LRDSYI
Sbjct: 238 GIASLYGKLLVSSELWSFGERLRANYQETKDLLLQVAGHKVFLK-ESLSEAEVGLRDSYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNVCQAYTLKRIRDP++HV +RPHISK+  D SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 297 TTLNVCQAYTLKRIRDPNFHVKVRPHISKEISDASKPAAELVKLNPTSEYAPGLEDTLIL 356

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 357 TMKGIAA 363



>gb:DTAJ2935_1676188 Dendrobium thyrsifolium partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  282 bits (722), Expect = 5e-75
 Identities = 141/187 (75%), Positives = 160/187 (85%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + +EMYNEWPFF+VTIDL+EM F KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNLLREMYNEWPFFKVTIDLIEMGFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKL+ S DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLVGSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH+  +P+ S + ++S K A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRIRDPSYHLNAKPNQSNEIMNSNKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:VAAJ2927_1726952 Vanilla aphylla partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 362

 Score =  282 bits (721), Expect = 6e-75
 Identities = 140/186 (75%), Positives = 157/186 (84%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I KDI+NL + +EMYN WPFFRVTIDL+EMVF KG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVITKDIRNLHILREMYNGWPFFRVTIDLIEMVFTKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYD+LLVS DL SFG  LR+NYE+TK LLLQ+AGHKDLLEGDP+LK +L+LRD YI
Sbjct: 238 GIASLYDELLVSNDLLSFGMELRANYEETKRLLLQVAGHKDLLEGDPHLK-RLRLRDPYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIR+P YH     H+S +    K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 297 TTLNVCQAYTLKRIREPSYHAMAPHHVSNETESRKSAAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:AF268091_1782031 Chloris gayana phosphoenolpyruvate carboxylase
            (ppc) mRNA, complete cds.
          Length = 955

 Score =  281 bits (720), Expect = 8e-75
 Identities = 137/192 (71%), Positives = 164/192 (85%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVG+AFK AI KDIKN ++ ++MY EWPFFRVT+DL+EMVFAKGDP
Sbjct: 771  FSWTQTRFHLPVWLGVGSAFKSAIDKDIKNFQLLKDMYREWPFFRVTLDLLEMVFAKGDP 830

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLV+ +L  FGE+LRS Y +T+ LLLQIAGHK++LE DPYLKQ+L+LRD YI
Sbjct: 831  GIAALYDKLLVTDELKPFGEQLRSKYAETEQLLLQIAGHKEILEADPYLKQRLRLRDPYI 890

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLK+IRDP++ V  +P ++K+        +LVKLNP S+YAPGLEDTLI+T
Sbjct: 891  TTLNVFQAYTLKQIRDPNFKVKTQPPLNKE-------QDLVKLNPASEYAPGLEDTLIIT 943

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 944  MKGIAAGMQNTG 955



>gb:KPAJ2921_1683747 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  281 bits (720), Expect = 8e-75
 Identities = 140/188 (74%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LLQI GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLQITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:ETI312660_1677068 Euphorbia tirucalli partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 4.
          Length = 365

 Score =  281 bits (719), Expect = 1e-74
 Identities = 141/188 (75%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEELRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+  +S    A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEISESSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:DCAJ2938_1675642 Dendrobium crumentatum partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 363

 Score =  281 bits (719), Expect = 1e-74
 Identities = 144/187 (77%), Positives = 160/187 (85%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + QEMYNEWPFFRVTIDL+EMVF KG  
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDKKNLNILQEMYNEWPFFRVTIDLIEMVFTKGST 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSADLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS-KHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV Q YTLKRIRDP+YH+T +P+ S +  +S K A ELVKLNPTS+Y PGLEDTLIL
Sbjct: 298 TTLNV-QVYTLKRIRDPNYHLTAKPNGSNEIRNSNKPAAELVKLNPTSEYPPGLEDTLIL 356

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 357 TMKGIAA 363



>gb:MEPPCGENE_1686014 M.exilis mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 363

 Score =  280 bits (717), Expect = 2e-74
 Identities = 142/187 (75%), Positives = 159/187 (85%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD KNL++ +EMYNEWPFFRVTIDL+EMVF KG P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDQKNLQILREMYNEWPFFRVTIDLIEMVFTKGSP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+LR+NYE+TK LLL +AGHK+LLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSPELLPFGEQLRANYEETKRLLLMVAGHKELLEGDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKRIRDP YH   +PH+  + V S + A ELV LNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVFQAYTLKRIRDPSYH-PAQPHLPTEIVHSNNQAAELVNLNPTSEYAPGLEDTLIL 356

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 357 TMKGIAA 363



>gb:KPAJ2919_1683745 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  280 bits (716), Expect = 2e-74
 Identities = 139/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:DLAJ2934_1675941 Dendrobium loddigesii partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  280 bits (716), Expect = 2e-74
 Identities = 141/187 (75%), Positives = 158/187 (84%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I+KD  NL + +EMYNEWPFFRVTIDL+EMVF KG  
Sbjct: 178 FAWTQTRFHLPVWLGFGVAFKHVIEKDKNNLNILREMYNEWPFFRVTIDLIEMVFTKGST 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDP LKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPSLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKR+RDP YH T +P++S   ++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRMRDPSYHPTAKPNLSNKIMNSSKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:AF495586_1805546 Setaria italica putative C4 phosphoenolpyruvate
            carboxylase (ppc) mRNA, complete cds.
          Length = 964

 Score =  280 bits (715), Expect = 3e-74
 Identities = 134/192 (69%), Positives = 162/192 (84%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LG GAAF+ A++KDIKN +M +EMYNEWPFFRVT+DL+EMV AKGDP
Sbjct: 773  FSWTQTRFHLPVWLGFGAAFEHAMKKDIKNFRMLKEMYNEWPFFRVTLDLLEMVLAKGDP 832

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             IA LYD+LLV+ +L  FGE+LR+NY +T+ L+LQ+AGHK++LE DP LKQQL+LRD YI
Sbjct: 833  TIAGLYDQLLVADELKPFGEQLRNNYVETEKLILQVAGHKEILESDPGLKQQLRLRDPYI 892

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            T LNV QAYTLKRIRDP++ VT +P +SK++ D      +VKLNP S+Y PGLEDTLILT
Sbjct: 893  TILNVWQAYTLKRIRDPNFKVTPQPPLSKEFADENQPRGIVKLNPASEYGPGLEDTLILT 952

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 953  MKGIAAGMQNTG 964



>gb:KSAJ2924_1683785 Kalanchoe streptantha partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  280 bits (715), Expect = 3e-74
 Identities = 138/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  + KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVMDKDSKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEELRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KPI312649_1683757 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           D.>gb:KPI344055_1683764 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           4.
          Length = 365

 Score =  280 bits (715), Expect = 3e-74
 Identities = 140/188 (74%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEELRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+  +     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEISEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KPAJ2926_1683749 Kalanchoe petitiana partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  280 bits (715), Expect = 3e-74
 Identities = 140/188 (74%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHLINKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP + V LRP I+K+ +      A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSHQVPLRPPIAKEVMGGSISSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KKAJ2915_1683485 Kalanchoe kewensis partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  280 bits (715), Expect = 3e-74
 Identities = 139/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKETMEGSISSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KBRNAPPC1_1683426 K.blossfeldiana mRNA for phosphoenolpyruvate
           carboxylase (Kb1).
          Length = 365

 Score =  280 bits (715), Expect = 3e-74
 Identities = 139/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 179 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGDP 238

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLL S++LW  GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LK+R +YI
Sbjct: 239 GIAALYDKLL-SEELWPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKVRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KGAJ2945_1683472 Kalanchoe grandiflora partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  279 bits (714), Expect = 4e-74
 Identities = 138/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHIIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTGYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD--SKHADELVKLNPTSDYAPGLEDTLI 270
           T LNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TALNVCQAYTLKRIRDPSYRVPVRPPIAKEIMEGSDSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KGAJ2918_1683471 Kalanchoe grandiflora partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  279 bits (714), Expect = 4e-74
 Identities = 138/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHIIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTGYNDTKSYLLKITGHNEILEGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD--SKHADELVKLNPTSDYAPGLEDTLI 270
           T LNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TALNVCQAYTLKRIRDPSYRVPVRPPIAKEIMEGSDSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KFE312682_1683459 Kalanchoe fedtschenkoi partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 5.
          Length = 365

 Score =  279 bits (714), Expect = 4e-74
 Identities = 139/188 (73%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++L GDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILGGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEILEGSVTSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KTAJ2917_1683813 Kalanchoe tomentosa partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  278 bits (712), Expect = 7e-74
 Identities = 137/188 (72%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV++DL   GE+LR+ Y DTK+ LL+I GH ++LEGDP+LKQ+L+LR++YI
Sbjct: 238 GIAALYDKLLVTEDLLPLGEQLRAAYNDTKTYLLKITGHNEILEGDPFLKQRLRLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ +D      +++VKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEILDGAVFSTNQVVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KTAJ2916_1683812 Kalanchoe tomentosa partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  278 bits (712), Expect = 7e-74
 Identities = 137/188 (72%), Positives = 160/188 (85%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLV++DL   GE+LR+ Y DTK+ LL+I GH ++LEGDP+LKQ+L+LR++YI
Sbjct: 238 GIAALYDKLLVTEDLLPLGEQLRAAYNDTKTYLLKITGHNEILEGDPFLKQRLRLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ +D      +++VKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEILDGAVFSTNQVVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KFE312678_1683455 Kalanchoe fedtschenkoi partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 241

 Score =  278 bits (712), Expect = 7e-74
 Identities = 139/188 (73%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 54  FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 113

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++L GDP+LKQ+LKLR +YI
Sbjct: 114 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILGGDPFLKQRLKLRTAYI 173

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 174 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEILEGSVTSANQLVKLNPTSEYAPGLEDTLI 233

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 234 LTMKGIAA 241



>gb:KDA312634_1683436 Kalanchoe daigremontiana partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           3.>gb:KFE312679_1683456 Kalanchoe fedtschenkoi partial
           mRNA for phosphoenolpyruvate carboxylase (pepc gene),
           isoform 2.
          Length = 365

 Score =  278 bits (712), Expect = 7e-74
 Identities = 139/188 (73%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++L GDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILGGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEILEGSVTSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KBRNAPPC2_1683427 K.blossfeldiana mRNA for phosphoenolpyruvate
           carboxylase (Kb2).
          Length = 365

 Score =  278 bits (711), Expect = 9e-74
 Identities = 138/188 (73%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEWPFFR TIDLVEMVFAKGDP
Sbjct: 179 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWPFFRATIDLVEMVFAKGDP 238

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLL S++LW  GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LK+R +YI
Sbjct: 239 GIAALYDKLL-SEELWPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKVRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:TUPPC_1726101 T.usneoides mRNA for phosphoenolpyruvate
            decarboxylase.
          Length = 676

 Score =  278 bits (710), Expect = 1e-73
 Identities = 137/186 (73%), Positives = 155/186 (83%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  +QKDI+NL + +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 491  FAWTQTRFHLPVWLGFGAAFKHILQKDIRNLHLLKEMYNEWPFFRVTLDLLEMVFAKGDP 550

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+ GHKDLLEGDPYL+Q       YI
Sbjct: 551  GIAALYDKLLVSDDLKPFGEQLRANYEETKQLLLQVTGHKDLLEGDPYLRQTYACVSPYI 610

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNVCQAYT KRIRDP++ V +R  +SK+  DS    E +KLN TS+YAPGLEDTLILT
Sbjct: 611  TTLNVCQAYTPKRIRDPNFQVDMRAPLSKEISDSNKPAEQLKLNLTSEYAPGLEDTLILT 670

Query: 263  MKGIAA 246
            MKGIAA
Sbjct: 671  MKGIAA 676



>gb:KPAJ2920_1683746 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  277 bits (709), Expect = 1e-73
 Identities = 138/188 (73%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG   AF+  I KD KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFXEAFRHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLRITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:DLAJ2933_1675940 Dendrobium loddigesii partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 364

 Score =  277 bits (709), Expect = 1e-73
 Identities = 140/187 (74%), Positives = 157/187 (83%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I+KD  NL + +EMYNEWPFFRVTIDL+EM F KG  
Sbjct: 178 FAWTQTRFHLPVWLGFGVAFKHVIEKDKNNLNILREMYNEWPFFRVTIDLIEMGFTKGST 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS DL  FGE+LR+NYE+TK LLLQ+AGHKDLLEGDP LKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSTDLLPFGEQLRANYEETKRLLLQVAGHKDLLEGDPSLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTLKR+RDP YH T +P++S   ++ SK A ELVKLNPTS+YAPGLEDTLIL
Sbjct: 298 TTLNVWQAYTLKRMRDPSYHPTAKPNLSNKIMNSSKPAAELVKLNPTSEYAPGLEDTLIL 357

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 358 TMKGIAA 364



>gb:KKAJ2914_1683484 Kalanchoe kewensis partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 365

 Score =  276 bits (707), Expect = 3e-73
 Identities = 138/188 (73%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AF+  I KD KNL M Q+MYNEW FFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFRHVIDKDNKNLLMLQQMYNEWAFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQVPVRPPIAKETMEGSISSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:KFE312680_1683457 Kalanchoe fedtschenkoi partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 365

 Score =  275 bits (704), Expect = 6e-73
 Identities = 137/188 (72%), Positives = 159/188 (84%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I +D KNL M Q+MYNEWPFFRVTIDLVEMVFAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDQDNKNLLMLQQMYNEWPFFRVTIDLVEMVFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++L GDP+LKQ+LKLR++YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLKITGHNEILGGDPFLKQRLKLRNAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSK--HADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y   +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYQKPVRPPIAKEILEGSVTSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>sp|P15804|CAP3_SORBI Phosphoenolpyruvate carboxylase 3 (EC 4.1.1.31)
            (PEPCase 3) (CP46).>pir|S22507|S22507 phosphoenolpyruvate
            carboxylase (EC 4.1.1.31) CP46 -
            sorghum>gb:SVPEPC_1723256 Sorghum vulgare mRNA for
            phosphoenolpyruvate involved in C4 photosynthesis (EC
            4.1.1.31).>gb:SVPEPCAA_1723258 S.vulgare PEPC gene.
          Length = 960

 Score =  275 bits (704), Expect = 6e-73
 Identities = 138/192 (71%), Positives = 159/192 (82%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KDIKN +  +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 770  FSWTQTRFHLPVWLGVGAAFKWAIDKDIKNFQKLKEMYNEWPFFRVTLDLLEMVFAKGDP 829

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDPYLKQ L+LR+ YI
Sbjct: 830  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPYLKQGLRLRNPYI 889

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP + VT +P +SK++ D      LVKLN      PGLEDTLILT
Sbjct: 890  TTLNVFQAYTLKRIRDPSFKVTPQPPLSKEFADENKPAGLVKLN-GERVPPGLEDTLILT 948

Query: 263  MKGIAAGMQNTG 228
            MKGIAAGMQNTG
Sbjct: 949  MKGIAAGMQNTG 960



>gb:VAPPCGENE_1726969 V.aphylla mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 362

 Score =  271 bits (694), Expect = 8e-72
 Identities = 137/186 (73%), Positives = 153/186 (82%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWT TRFHLPV LG GAAFK  I KDI+NL + +EMYN WPFFRVTIDL+EMVF KG+P
Sbjct: 178 FAWTHTRFHLPVWLGFGAAFKHVITKDIRNLHILREMYNGWPFFRVTIDLIEMVFTKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIA+LYD+LLVS DL SFG  LR+NYE+TK LLLQ+AGHKDLLEGDP+LKQ+L+ RD YI
Sbjct: 238 GIASLYDELLVSNDLLSFGMELRANYEETKRLLLQVAGHKDLLEGDPHLKQRLRPRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLK IRD       R H+S +    K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 298 TTLNVCQAYTLKAIRD-QVTTQWRTHVSNETESRKSAAELVKLNPTSEYAPGLEDTLILT 356

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 357 MKGIAA 362



>gb:AP003052_1824492 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0016I09.
          Length = 1014

 Score =  271 bits (693), Expect = 1e-71
 Identities = 139/195 (71%), Positives = 160/195 (82%), Gaps = 3/195 (1%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKN--LKMFQEMYNEWPFFRVTIDLVEMVFAKG 630
            FAWTQTRFHLPV LG GAAF+ A+Q+      L   +EMY+EWPFFRVTIDL+EMVFAKG
Sbjct: 820  FAWTQTRFHLPVWLGFGAAFRHAMQQSDAGGGLATLREMYDEWPFFRVTIDLLEMVFAKG 879

Query: 629  DPGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDS 450
            DPGIAALYD+LLV  DL  FGE+LR+NY +T+ LLLQ+AGHKDLLE DPYL+Q+L LRDS
Sbjct: 880  DPGIAALYDELLVPDDLRPFGEQLRANYVETQRLLLQVAGHKDLLESDPYLRQRLMLRDS 939

Query: 449  YITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKH-ADELVKLNPTSDYAPGLEDTL 273
            YIT LNVCQAYTLKRIRD  +    RP +SK+ + S   A++LVKLNP S+Y PGLEDTL
Sbjct: 940  YITALNVCQAYTLKRIRDGGFRPETRPPLSKELLGSSAVAEKLVKLNPNSEYDPGLEDTL 999

Query: 272  ILTMKGIAAGMQNTG 228
            ILTMKGIAAGMQNTG
Sbjct: 1000 ILTMKGIAAGMQNTG 1014



>gb:SAP312667_1704748 Solenangis aphylla partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 5.
          Length = 240

 Score =  271 bits (692), Expect = 1e-71
 Identities = 139/188 (73%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDI-KNLKMFQEMYNEWPFFRVTIDLVEMVFAKGD 627
           FAWTQTRFHL V LG GAAFK  I K+  K     Q MYN+WPF RVTIDLVEMVFAKGD
Sbjct: 53  FAWTQTRFHLTVWLGCGAAFKHVIDKECRKPFTCIQHMYNQWPFLRVTIDLVEMVFAKGD 112

Query: 626 PGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSY 447
           PGIAALYDKLLV ++L  FGE+LR NYE T  LL+QIAGHKDLLEGDPYLKQ+L+LR +Y
Sbjct: 113 PGIAALYDKLLVPQELSPFGEQLRLNYEGTNELLVQIAGHKDLLEGDPYLKQRLRLRHAY 172

Query: 446 ITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD-SKHADELVKLNPTSDYAPGLEDTLI 270
           ITTLNVCQA  LK+ RDP  HVT+RPH+SK+Y++ SK A ELVKLNPT +YA GLEDTLI
Sbjct: 173 ITTLNVCQACPLKKTRDPASHVTVRPHLSKEYIESSKPAAELVKLNPTREYAAGLEDTLI 232

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 233 LTMKGIAA 240



>pir|S08216|QYMG phosphoenolpyruvate carboxylase (EC 4.1.1.31) -
            sorghum
          Length = 952

 Score =  271 bits (692), Expect = 1e-71
 Identities = 135/192 (70%), Positives = 158/192 (82%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            F+WTQTRFHLPV LGVGAAFK AI KDIKN ++ +EMYNEWPFFRVT+DL+EMVFAKGDP
Sbjct: 762  FSWTQTRFHLPVWLGVGAAFKWAIDKDIKNFQVLKEMYNEWPFFRVTLDLLEMVFAKGDP 821

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            GIA LYD+LLV+++L  FG++LR  Y +T+ LLLQIAGHKD+LEGDP+LKQ L+LR+ YI
Sbjct: 822  GIAGLYDELLVAEELKPFGKQLRDKYVETQQLLLQIAGHKDILEGDPFLKQGLRLRNPYI 881

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QAYTLKRIRDP + VT +P +SK++ D      LVKLN      PGLEDTLILT
Sbjct: 882  TTLNVFQAYTLKRIRDPSFKVTPQPPLSKEFADENKPAGLVKLN-GERVPPGLEDTLILT 940

Query: 263  MKGIAAGMQNTG 228
            MKGI AGM NTG
Sbjct: 941  MKGIRAGMHNTG 952



>gb:KPI312646_1683754 Kalanchoe pinnata partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform
           A.>gb:KPI344052_1683761 Kalanchoe pinnata partial mRNA
           for phosphoenolpyruvate carboxylase (ppc gene), isogene
           1.
          Length = 365

 Score =  270 bits (690), Expect = 2e-71
 Identities = 136/188 (72%), Positives = 155/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  I KD KNL M Q+MYNEWPFFRVTIDLVEM+FAKG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGEAFKHVIDKDNKNLLMLQQMYNEWPFFRVTIDLVEMMFAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE LR+ Y DTKS LL+I GH ++LEG+P+LKQ+ KLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEELRTAYNDTKSYLLKITGHNEILEGNPFLKQRHKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNVCQAYTLKRIRDP Y   +RP I+K+  +     A +LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVCQAYTLKRIRDPSYRGPVRPPIAKEISEGSVSSAKKLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:SAPPCGENE_1704750 S.aphylla mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 357

 Score =  269 bits (687), Expect = 5e-71
 Identities = 139/186 (74%), Positives = 155/186 (83%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD KNL+M +EM+NEWPFFRVTIDL+EMVF KG+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDPKNLQMLREMHNEWPFFRVTIDLLEMVFTKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS  L  FGE+L +NYE+T++LLLQ+AGHK LLE DPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSPALLPFGEQLIANYEETQNLLLQVAGHKVLLESDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNV QAYTLKR+RDP Y     PH+S      K ADELVKLNPTS+Y PGLEDTLILT
Sbjct: 298 TTLNVFQAYTLKRMRDPSY---AEPHLSN---AQKPADELVKLNPTSEYGPGLEDTLILT 351

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 352 MKGIAA 357



>gb:SAP312664_1704745 Solenangis aphylla partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 357

 Score =  268 bits (684), Expect = 1e-70
 Identities = 137/186 (73%), Positives = 156/186 (83%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  IQKD KNL+M +EM+NEWPFFRVTIDL+EMVF +G+P
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIQKDPKNLQMLREMHNEWPFFRVTIDLLEMVFTRGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+L +NYE+T++LLLQ+AGHK LLE DPYLKQ+L+LR  YI
Sbjct: 238 GIAALYDKLLVSPELLPFGEQLIANYEETQNLLLQVAGHKVLLESDPYLKQRLRLRYPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNV QAYTLKR+RDP Y     PH+S  +   K ADELVKLNP S+Y PGLEDTLILT
Sbjct: 298 TTLNVFQAYTLKRMRDPSY---AEPHLSNAH---KPADELVKLNPISEYGPGLEDTLILT 351

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 352 MKGIAA 357



>gb:CRE312617_1673269 Cycas revoluta partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 365

 Score =  266 bits (680), Expect = 3e-70
 Identities = 134/188 (71%), Positives = 156/188 (82%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTR HLPV LG G + +  I KD KNL M Q+MYNEWPFFRVTIDLVEMV AKG+P
Sbjct: 178 FAWTQTRVHLPVWLGFGESVRHVIDKDHKNLLMLQQMYNEWPFFRVTIDLVEMVVAKGNP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS++L   GE+LR+ Y DTKS LL+I GH ++LEGDP+LKQ+LKLR +YI
Sbjct: 238 GIAALYDKLLVSEELLPLGEQLRTAYNDTKSYLLRITGHNEILEGDPFLKQRLKLRTAYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDS--KHADELVKLNPTSDYAPGLEDTLI 270
           TTLNV QAYTLKRIRDP Y V +RP I+K+ ++     A++LVKLNPTS+YAPGLEDTLI
Sbjct: 298 TTLNVRQAYTLKRIRDPSYQVPVRPPIAKEIMEGSVSSANQLVKLNPTSEYAPGLEDTLI 357

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 358 LTMKGIAA 365



>gb:AEPPCGENE_1760455 A.eburneum mRNA for phosphoenolpyruvate
           carboxylase (aerial root).
          Length = 356

 Score =  264 bits (674), Expect = 2e-69
 Identities = 137/186 (73%), Positives = 156/186 (83%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+K   NL++ QEMYNEWPFFRVTIDL+EMVF KG  
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKTKNNLQILQEMYNEWPFFRVTIDLIEMVFTKGST 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALY+KLLVS++L  FGE+L +NYE+ K LLL++AGHK LLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYNKLLVSEELQPFGEQLIANYEN-KRLLLEVAGHKVLLEGDPYLKQRLRLRYPYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP+Y    +PH+S     +K A ELVKLNPTS+YAPGLEDTLILT
Sbjct: 297 TTLNVCQAYTLKRIRDPNY---AKPHLSN---SNKPAAELVKLNPTSEYAPGLEDTLILT 350

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 351 MKGIAA 356



>gb:NAPPC1_1688123 Neoregelia ampullacea mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 367

 Score =  263 bits (671), Expect = 4e-69
 Identities = 138/194 (71%), Positives = 155/194 (79%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFK--CAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKG 630
           FAWTQTRF LPV LG GAAF   C  QKD++ LK   EMYNEWPFFRVT+DL+EMVF  G
Sbjct: 178 FAWTQTRFLLPVWLGFGAAFNIYCKGQKDLRTLK---EMYNEWPFFRVTLDLLEMVFXXG 234

Query: 629 DPGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDS 450
           DPGIAALYDKLLVS DL  FGE+LR+NYE+TK LL Q      LLEG P LKQ+++LR+ 
Sbjct: 235 DPGIAALYDKLLVSDDLKPFGEQLRANYEETKQLLSQGCRPHGLLEGRPLLKQRIRLRER 294

Query: 449 YITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLI 270
           YIT LNVCQ Y+LKRIRDP++HV +RP +SK Y DS    ELVKLNP S+YAPGLEDTLI
Sbjct: 295 YITILNVCQVYSLKRIRDPNFHVHVRPPLSKRY-DSNKPAELVKLNPRSEYAPGLEDTLI 353

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 354 LTMKGIAAGMQNTG 367



>gb:VPAJ2948_1727315 Vanilla phalaenopsis partial mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 363

 Score =  256 bits (655), Expect = 3e-67
 Identities = 132/194 (68%), Positives = 154/194 (79%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  +Q+DIKNL++ QEMY EWPFFRVT+DLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGTAFKHVVQEDIKNLRILQEMYEEWPFFRVTVDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS DL   G++LR+ YE T+ LLLQ+AGHK+LLEG+P LKQ+L+LR+ +I
Sbjct: 238 RIAALYDSLLVSPDLQEIGKQLRAKYEQTQKLLLQVAGHKELLEGNPTLKQRLRLREPFI 297

Query: 443 TTLNVCQAYTLKRIR--DPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLI 270
           TTLNV QAYTLK++R  D D    + P         K A ELV LN T++YAPGLEDT+I
Sbjct: 298 TTLNVQQAYTLKKMRQADSDPPAVVDPR--------KPAAELVNLNKTTEYAPGLEDTVI 349

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 350 LTMKGIAAGMQNTG 363



>gb:SNAJ1300_1715549 Scapania nemorea partial mRNA for
           phosphoenolpyruvate carboxylase, clone pSN9.1.
          Length = 369

 Score =  252 bits (644), Expect = 5e-66
 Identities = 123/192 (64%), Positives = 154/192 (80%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK ++ K   NL + +EMYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKQSLAKSSTNLALMREMYNEWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVS +L   G++LR+ Y +T+ LLL+IAGH+D+L G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVSDELKPLGQKLRTMYAETRELLLKIAGHEDVLAGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LN+ QA+TL +IRD ++HVT +P   +    +K + ELV LN T++Y PGLEDTLI+T
Sbjct: 298 TPLNLIQAFTLAKIRDQNFHVTEQPTTPRSGDPAKQSSELVSLNRTTEYPPGLEDTLIIT 357

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 358 MKGIAAGMQNTG 369



>gb:MCAJ1292_1685728 Marchantia calcarata partial mRNA for
           phosphoenolpyruvate carboxylase, clone pMC14.1.
          Length = 368

 Score =  252 bits (644), Expect = 5e-66
 Identities = 126/192 (65%), Positives = 152/192 (79%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK A QK  +N+ + ++MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKAAFQKSNQNVVLLRQMYNEWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVS++L   GE+LR  Y +T+ LLL++AGH D+L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVSEELKPLGEKLRLMYAETRELLLKVAGHDDVLQGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA+TLK+IRD  +HV   P   K     K + ELV LN T++Y PGLEDTLILT
Sbjct: 298 TPLNVQQAFTLKKIRDQSFHVR-DPETPKGENSGKQSSELVGLNTTTEYPPGLEDTLILT 356

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 357 MKGIAAGMQNTG 368



>gb:LCAJ1289_1684004 Lunularia cruciata partial mRNA for
           phosphoenolpyruvate carboxylase, clone pLC13.8.
          Length = 368

 Score =  252 bits (644), Expect = 5e-66
 Identities = 126/192 (65%), Positives = 152/192 (79%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK A QK  +N+ + ++MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKAAFQKSNQNVVLLRQMYNEWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVS +L   GE+LR  Y +T+ LLL++AGH+D+L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVSDELKPLGEKLRVMYAETRELLLKVAGHEDVLQGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA+TLK+IRD  +HV   P   K     K + ELV LN T++Y PGLEDTLILT
Sbjct: 298 TPLNVQQAFTLKKIRDQSFHVR-DPETPKGENSGKQSSELVGLNTTTEYPPGLEDTLILT 356

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 357 MKGIAAGMQNTG 368



>gb:PQAJ1297_1701764 Preissia quadrata partial mRNA for
           phosphoenolpyruvate carboxylase, clone pPQ29.2.
          Length = 367

 Score =  250 bits (638), Expect = 3e-65
 Identities = 123/192 (64%), Positives = 154/192 (80%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK A +K  +N+ + ++MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHAFEKSNQNVVLLRQMYNEWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLV ++L   GE+LR+ Y +T+ LLL++AGH+D+L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVDEELKPLGEKLRTMYAETRDLLLKVAGHEDVLQGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA+TLK+IRD  +HV+  P   K     K + ELV LN T++Y PGLEDTLI+T
Sbjct: 298 TPLNVQQAFTLKKIRDQSFHVS--PGTPKGENSGKQSSELVGLNTTTEYPPGLEDTLIIT 355

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 356 MKGIAAGMQNTG 367



>gb:BRAJ1280_1634150 Bucegia romanica partial mRNA for
           phosphoenolpyruvate carboxylase, clone pBR12.3.
          Length = 367

 Score =  246 bits (627), Expect = 5e-64
 Identities = 123/192 (64%), Positives = 152/192 (79%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK A +K  +N+ + ++MYNE PFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHAFEKSNQNVVLLRQMYNECPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLV +DL   GE+LR+ Y +T+ LLL++AGH+D+L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVDEDLKPLGEKLRTMYAETRDLLLKVAGHEDVLQGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA+TLK+IRD  +HV+  P   K     K + EL  LN T++Y PGLEDTLILT
Sbjct: 298 TPLNVQQAFTLKKIRDQSFHVS--PGTPKGENSGKQSSELAGLNTTTEYPPGLEDTLILT 355

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 356 MKGIAAGMQNTG 367



>gb:AEPPCGEN1_1760454 A.eburneum mRNA for phosphoenolpyruvate
           carboxylase (leaf).
          Length = 355

 Score =  245 bits (626), Expect = 6e-64
 Identities = 131/186 (70%), Positives = 150/186 (80%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK + ++     K ++    EWPFFRVTIDL+EMVF KG  
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKQSSKRTKIIFKYYKRCTIEWPFFRVTIDLIEMVFTKGST 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALY+KLLVS DLW FGE+LR+NYE T+ LLL++AGHK LLEGDPYLKQ+L+LR  YI
Sbjct: 238 GIAALYNKLLVSADLWPFGEQLRANYE-TQRLLLEVAGHKVLLEGDPYLKQRLRLRYPYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLNVCQAYTLKRIRDP+Y    +PH+S     +K A ELVKLNPTS+YAPGLE TLILT
Sbjct: 297 TTLNVCQAYTLKRIRDPNY---AKPHLSN---SNKPAAELVKLNPTSEYAPGLE-TLILT 349

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 350 MKGIAA 355



>gb:GSP310353_1680940 Sticherus bifidus partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 360

 Score =  244 bits (623), Expect = 1e-63
 Identities = 127/187 (67%), Positives = 149/187 (79%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A K A+ KD KNL + QEMYN WPFFR TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGIGSALKYALNKDKKNLHVLQEMYNGWPFFRATIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS+DL  FG+ LR+ YE+T+ LLL +AGH DLL+G+P LKQ+LKLR+ YI
Sbjct: 238 RIAALYDKLLVSEDLQQFGDSLRARYEETRDLLLLVAGHSDLLQGNPTLKQRLKLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           T LNV Q +TL++IR+    V    + SK  V  +K A ELV LNPTS+YAPGLEDTLIL
Sbjct: 298 TVLNVQQVHTLRKIREGGVPV----NSSKSPVSQNKPAAELVSLNPTSEYAPGLEDTLIL 353

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 354 TMKGIAA 360



>gb:CPPPCGENE_1648686 C.pusilla mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 361

 Score =  244 bits (623), Expect = 1e-63
 Identities = 130/188 (69%), Positives = 149/188 (79%), Gaps = 2/188 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  I+KD KNL + +EM+N WPFFRVTIDL+EMVF+KG+ 
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFKHVIEKDPKNLLLLREMHNNWPFFRVTIDLIEMVFSKGNS 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS +L  FGE+LR+NYE+TK LLLQ+AGHK LLEGDPYL Q+L+LR  YI
Sbjct: 238 GIAALYDKLLVSPELLPFGEQLRANYEETKDLLLQVAGHKSLLEGDPYL-QRLRLRVPYI 296

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKD--YVDSKHADELVKLNPTSDYAPGLEDTLI 270
           TTLNV QA+TL    D      L+PH+S       +  A ELVKLNP S+YAPGLEDTLI
Sbjct: 297 TTLNVYQAFTL---TDQRTKHRLQPHVSNQSKLNSNNTAAELVKLNPASEYAPGLEDTLI 353

Query: 269 LTMKGIAA 246
           LTMKGIAA
Sbjct: 354 LTMKGIAA 361



>gb:SSPPPC1_1722587 Sphagnum sp. HG-1998 mRNA for
           phosphoenolpyruvate carboxylase.
          Length = 368

 Score =  244 bits (622), Expect = 2e-63
 Identities = 124/192 (64%), Positives = 145/192 (75%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWT TRFHLPV LG+G A   A+Q D  N+ +   MYN+WPFF VT+DLVEMVFAKGDP
Sbjct: 178 FAWTXTRFHLPVWLGLGGALAHALQSDPSNIVILHRMYNQWPFFHVTLDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAAL D LLVS +L  FG  LR  YE+T+SLLL++AGHKD+LEGDPYLKQ+L+LR+ YI
Sbjct: 238 RIAALNDSLLVSPELKPFGVELRRKYEETRSLLLKVAGHKDVLEGDPYLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QAYTLK++RD +  +      +      K   ELV LNP S+YAPGLEDTLILT
Sbjct: 298 TVLNVQQAYTLKKMRDEECKINCATEWAA-RKPGKRTTELVALNPMSEYAPGLEDTLILT 356

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 357 MKGIAAGMQNTG 368



>gb:GSP310352_1680939 Sticherus bifidus partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 360

 Score =  243 bits (621), Expect = 2e-63
 Identities = 126/187 (67%), Positives = 148/187 (79%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A K A+ K  KNL + Q MYN WPFFR TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGIGSALKYALYKGQKNLHVLQGMYNGWPFFRATIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDKLLVS+DL  FG+ LR+ YE+T+ LLL +AGH DLL+G+P LKQ+LKLR+ YI
Sbjct: 238 RIAALYDKLLVSEDLQQFGDSLRARYEETRDLLLLVAGHSDLLQGNPTLKQRLKLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           T LNV Q +TL++IRD +Y      + SK  V  +K A ELV LNPTS+YAPGLEDTLIL
Sbjct: 298 TVLNVQQVHTLRKIRDEEYQY----NSSKSPVSQNKPAAELVSLNPTSEYAPGLEDTLIL 353

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 354 TMKGIAA 360



>gb:PPE243415_1701305 Prunus persica partial partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene).
          Length = 143

 Score =  241 bits (614), Expect = 2e-62
 Identities = 115/142 (80%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = -2

Query: 686 EWPFFRVTIDLVEMVFAKGDPGIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGH 507
           EWPFFRV+IDL+EMVFAK DPGIA+LYDKLLVS+DLWSFGERLR+NYE+TKSL+LQ+AGH
Sbjct: 2   EWPFFRVSIDLIEMVFAKADPGIASLYDKLLVSEDLWSFGERLRANYEETKSLVLQVAGH 61

Query: 506 KDLLEGDPYLKQQLKLRDSYITTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVD--SKHA 333
           + LLEGDPYL+Q+L LRDSYITTLNVCQAYTLK+IRDP+YHV +RPH+SK+Y++  SK A
Sbjct: 62  RALLEGDPYLRQRLLLRDSYITTLNVCQAYTLKQIRDPNYHVKVRPHLSKEYMETTSKPA 121

Query: 332 DELVKLNPTSDYAPGLEDTLIL 267
            ELVKLNPTS+YAPGLEDTLIL
Sbjct: 122 AELVKLNPTSEYAPGLEDTLIL 143



>gb:GSP310351_1680938 Sticherus bifidus partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 358

 Score =  241 bits (614), Expect = 2e-62
 Identities = 126/186 (67%), Positives = 148/186 (79%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF+  ++KD  NL + QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFQAVLKKDPNNLIVLQEMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLV+ +L  FG  LR+ YE+TK LLL++AGH++LLEG+PYLKQ+L LRD YI
Sbjct: 238 RIAALYDELLVNDELKFFGTVLRAKYEETKELLLKVAGHEELLEGNPYLKQRLALRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLN+ QAYTLK++R+   HV     + K       A ELV LN TS+YAPGLEDT+ILT
Sbjct: 298 TTLNLQQAYTLKKMREG--HVGKSSSLLK---ARSSAAELVSLNTTSEYAPGLEDTMILT 352

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 353 MKGIAA 358



>gb:IHPPC1_1683095 Isoetes histrix mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 371

 Score =  240 bits (612), Expect = 3e-62
 Identities = 122/193 (63%), Positives = 146/193 (75%), Gaps = 1/193 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           F WTQTRFHLPV LG G AFK  I +D KN  + +EMY  WPFFRVTIDLVEMVF KGDP
Sbjct: 179 FRWTQTRFHLPVWLGFGEAFKTVIDEDPKNFCVLREMYENWPFFRVTIDLVEMVFKKGDP 238

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IA LYD LLV++DL   G  LR  Y++T++LLLQ+AGHK+LL G+P LKQ+L+LR+ Y+
Sbjct: 239 RIAELYDHLLVAEDLQDLGNTLRQKYKETENLLLQVAGHKELLAGNPTLKQKLRLREPYL 298

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPH-ISKDYVDSKHADELVKLNPTSDYAPGLEDTLIL 267
           TTLNV QAYTL+++R  D   +  P  +      +  A ELV LNPT++YAPGLEDTLIL
Sbjct: 299 TTLNVQQAYTLRKMRHLDTSFSSSPRTVDGGTPRANKAAELVSLNPTTEYAPGLEDTLIL 358

Query: 266 TMKGIAAGMQNTG 228
           TMKGIAAGMQNTG
Sbjct: 359 TMKGIAAGMQNTG 371



>gb:PLO312677_1700645 Pyrrosia longifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 3.
          Length = 357

 Score =  239 bits (611), Expect = 3e-62
 Identities = 123/187 (65%), Positives = 144/187 (77%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A + A+ KD +NL++ QEMYNEWPFFR TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGIGSALQHALNKDKRNLQLLQEMYNEWPFFRATIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDK LVS DL  FG+ LR  Y DT+ LLL +AGH +LL+G+P LKQ+LKLR+ Y+
Sbjct: 238 RIAALYDKYLVSGDLQQFGDELRKKYGDTRDLLLLVAGHSELLQGNPTLKQRLKLREPYL 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           T LNV Q YTL+++RD  Y       I K     SK A ELV LN TS+YAPGLEDTLIL
Sbjct: 298 TVLNVQQVYTLRKMRDAGY-------IPKSPTSQSKPASELVSLNTTSEYAPGLEDTLIL 350

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 351 TMKGIAA 357



>gb:PLO312676_1700644 Pyrrosia longifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 2.
          Length = 357

 Score =  239 bits (609), Expect = 6e-62
 Identities = 123/187 (65%), Positives = 143/187 (76%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A + A+ KD +NL++ QEMYNEWPFFR TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGIGSALQHALNKDKRNLQLLQEMYNEWPFFRATIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDK LVS DL  FG+ LR  Y DT+ LLL +AGH +LL G+P LKQ+LKLR+ Y+
Sbjct: 238 RIAALYDKYLVSGDLQQFGDELRKKYGDTRDLLLLVAGHSELLRGNPTLKQRLKLREPYL 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           T LNV Q YTL++I+D  Y       I K     SK A ELV LN TS+YAPGLEDTLIL
Sbjct: 298 TVLNVQQVYTLRKIKDAGY-------IPKSPTSQSKPASELVSLNTTSEYAPGLEDTLIL 350

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 351 TMKGIAA 357



>gb:PLO312675_1700643 Pyrrosia longifolia partial mRNA for
           phosphoenolpyruvate carboxylase (pepc gene), isoform 1.
          Length = 357

 Score =  239 bits (609), Expect = 6e-62
 Identities = 123/187 (65%), Positives = 143/187 (76%), Gaps = 1/187 (0%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A + A+ KD +NL + QEMYNEWPFFR TIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGIGSALQHALNKDKRNLPLLQEMYNEWPFFRATIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYDK LVS DL  FG+ LR  Y DT+ LLL +AGH +LL+G+P LKQ+LKLR+ Y+
Sbjct: 238 RIAALYDKYLVSGDLQQFGDELRKKYGDTRDLLLLVAGHSELLQGNPTLKQRLKLREPYL 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV-DSKHADELVKLNPTSDYAPGLEDTLIL 267
           T LNV Q YTL+++RD  Y       I K     SK A ELV LN TS+YAPGLEDTLIL
Sbjct: 298 TVLNVQQVYTLRKMRDAGY-------IPKSPTSQSKPASELVSLNTTSEYAPGLEDTLIL 350

Query: 266 TMKGIAA 246
           TMKGIAA
Sbjct: 351 TMKGIAA 357



>gb:SPAJ1301_1718551 Sphagnum palustre partial mRNA for
           phosphoenolpyruvate carboxylase, clone pSA6.2.
          Length = 368

 Score =  238 bits (606), Expect = 1e-61
 Identities = 122/194 (62%), Positives = 150/194 (77%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G A   A+  D KN+   ++MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGRALSHALDTDPKNITTLRQMYNKWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS +   FGE LR  Y +T++ LL++AGH D+L G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDSLLVSPEFKPFGEELRQKYNETRNNLLRVAGHDDVLAGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPD--YHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLI 270
           T LNV QAYTLK++R+ +   ++T    ++K    +K A ELVKLN T++YAP LEDTLI
Sbjct: 298 TPLNVQQAYTLKKMREENKQLNITQNGELAK---PTKRATELVKLNTTTEYAPRLEDTLI 354

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 355 LTMKGIAAGMQNTG 368



>gb:DSAJ1284_1676085 Dicranum scoparium partial mRNA for
           phosphoenolpyruvate carboxylase, clone pDS23.3.
          Length = 368

 Score =  237 bits (604), Expect = 2e-61
 Identities = 117/192 (60%), Positives = 148/192 (77%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A + A++ D +N+ + + MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGSALREALETDPRNIAILRRMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS +L   GE LR  Y +T+ LLL++AGH+D+L+G+P LKQ+L+LR+ Y+
Sbjct: 238 RIAALYDNLLVSDELKPLGEELRRKYSETRDLLLRVAGHEDILQGNPTLKQRLRLREPYV 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA  LK++RD         +   +    K A ELV+LNPT+++ PGLEDTLILT
Sbjct: 298 TALNVQQALVLKKMRDQSTQFCALQN-GSEVKSPKRAAELVELNPTTEFPPGLEDTLILT 356

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 357 MKGIAAGMQNTG 368



>gb:PCAJ1294_1699107 Polytrichum commune partial mRNA for
           phosphoenolpyruvate carboxylase, clone pPC21.1.
          Length = 369

 Score =  236 bits (603), Expect = 3e-61
 Identities = 120/192 (62%), Positives = 147/192 (76%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+GAA + AI  D +NL M   MY++WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGAALRHAIDTDSQNLAMLCRMYDQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS++L   G+ LR  YE+T++LLL++A H D+L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDNLLVSEELRPLGDELRRKYEETRNLLLRVARHSDILQGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QA+TLK++R+ +                K A ELV LNPT+++ PGLEDTLILT
Sbjct: 298 TALNVQQAFTLKKMREQNSCKLETSQPGSPLKPVKRAMELVTLNPTTEFPPGLEDTLILT 357

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 358 MKGIAAGMQNTG 369



>gb:HCAJ1286_1681636 Hypnum cupressiforme partial mRNA for
           phosphoenolpyruvate carboxylase, clone pHC5.2.
          Length = 371

 Score =  236 bits (603), Expect = 3e-61
 Identities = 116/194 (59%), Positives = 149/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A K  +Q D +N+ + + MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGSALKEVLQTDPRNIAILRRMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS ++  FG+ LR  Y +T+  LL++AGH+D+L+G+P LKQ+L+LR+ Y+
Sbjct: 238 RIAALYDNLLVSDEIKPFGDELRRKYNETREYLLRVAGHEDILQGNPTLKQRLRLREPYL 297

Query: 443 TTLNVCQAYTLKRIRD--PDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLI 270
           T LNV QA  LK++RD    +      H  +     + A+ELV+LNPT+++ PGLEDTLI
Sbjct: 298 TALNVQQALVLKKMRDSSSQFCALQNGHSGEVPKSPRRAEELVELNPTTEFPPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>gb:GSP310354_1680941 Sticherus bifidus partial mRNA for
           phosphoenolpyruvate carboxylase (ppc gene).
          Length = 358

 Score =  236 bits (601), Expect = 5e-61
 Identities = 123/186 (66%), Positives = 147/186 (79%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAF+  ++KD  NL + QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGAAFQAVLKKDPNNLIVLQEMYNEWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLV+ +L  FG  LR+ YE+TK LLL++AGH++LLEG+PYLKQ+L LRD YI
Sbjct: 238 RIAALYDELLVNDELKFFGTVLRAKYEETKELLLKVAGHEELLEGNPYLKQRLALRDPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           TTLN+ QAYTL++ R+   HV     + K        ++LV LN TS+YAPGLEDT+ILT
Sbjct: 298 TTLNLQQAYTLRQGREG--HVGKSSSLLK---ARSSVEKLVSLNTTSEYAPGLEDTMILT 352

Query: 263 MKGIAA 246
           MKGIAA
Sbjct: 353 MKGIAA 358



>gb:BPAJ1279_1633981 Bartramia pomiformis partial mRNA for
           phosphoenolpyruvate carboxylase, clone pBP7.1.
          Length = 371

 Score =  236 bits (601), Expect = 5e-61
 Identities = 117/194 (60%), Positives = 148/194 (76%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A +  +Q D +N+ + + MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGSALREVLQTDPRNIAILRRMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS +L  FGE LR  Y +T+  LL++AGH+D+L+G+P LKQ+L+LR+ Y+
Sbjct: 238 RIAALYDNLLVSNELKPFGEELRRKYNETREFLLKVAGHEDILQGNPTLKQRLRLREPYL 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
           T LNV QA  LK++RD         +   + V    + A ELV+LNPT+++ PGLEDTLI
Sbjct: 298 TALNVQQALVLKKMRDQSSQFCALQNGQSNEVPKSPRRAAELVELNPTTEFPPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371



>gb:LAPPC1_1683916 Lycopodium annotium mRNA for phosphoenolpyruvate
           carboxylase.
          Length = 365

 Score =  235 bits (600), Expect = 7e-61
 Identities = 119/192 (61%), Positives = 148/192 (77%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FA TQTRFHLPV LG GAAFK  + ++ KN    +EMYN+WPFFRVT+DLVEMVF KGDP
Sbjct: 178 FACTQTRFHLPVWLGFGAAFKYVVTENSKNSNTLREMYNQWPFFRVTLDLVEMVFTKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IA LYD+LLVS+ L +FGE LR+ Y +T++ LL++AGH ++L G+P LKQ+L+LR+ YI
Sbjct: 238 RIAELYDRLLVSETLHAFGEHLRAKYAETRNFLLKVAGHTEILAGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QAYTLK++RD   + +    ++     +K A ELV LN TS+Y PGLEDTLILT
Sbjct: 298 TVLNVQQAYTLKKMRDESQYCSFPGSVTL----NKPAAELVTLNTTSEYPPGLEDTLILT 353

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 354 MKGIAAGMQNTG 365



>gb:JLAJ1287_1683360 Jungermannia leiantha partial mRNA for
           phosphoenolpyruvate carboxylase, clone pUL3.1.
          Length = 379

 Score =  234 bits (598), Expect = 1e-60
 Identities = 120/202 (59%), Positives = 148/202 (73%), Gaps = 10/202 (4%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  + K   N+ + +EMYNEW FFRVTIDL+EMVFAKGD 
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHVLAKSNSNVVLLREMYNEWSFFRVTIDLIEMVFAKGDS 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVS +L   GE LR+ Y +T+ LLL+IAGH+D+L G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVSDELKPLGEHLRAMYAETRELLLKIAGHEDVLAGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISK----------DYVDSKHADELVKLNPTSDYA 294
           T LN+ QA TL +IRD ++H+T +P   +               KH+ ELV LN T++Y 
Sbjct: 298 TILNLIQASTLCKIRDQNFHITEQPTTPRAGDSSSQPTTPRAGGKHSAELVTLNRTTEYP 357

Query: 293 PGLEDTLILTMKGIAAGMQNTG 228
           PGLEDTLI+TMKGIA GMQNTG
Sbjct: 358 PGLEDTLIITMKGIATGMQNTG 379



>gb:LPAJ1291_1685233 Leptobryum pyriforme partial mRNA for
           phosphoenolpyruvate carboxylase, clone pLP1.1.
          Length = 366

 Score =  234 bits (596), Expect = 2e-60
 Identities = 120/192 (62%), Positives = 146/192 (76%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQ RFHLPV LG+GAAFK A++   +N+     MY++WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQNRFHLPVWLGLGAAFKTALEAKPENMNTLARMYDQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IA LYD LLV ++L  FGE LR  Y +TK  LL+IA H D+L+G+P LKQ+L LR+ YI
Sbjct: 238 RIAQLYDTLLVKEELRPFGEELRRKYNETKLHLLKIARHTDILQGNPTLKQRLLLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
           T LNV QAYTLK++R+ +     +P   K    +K A ELV LNPT+++APGLEDT+ILT
Sbjct: 298 TALNVQQAYTLKKMREQNSSQPPQPESPK---PTKPASELVTLNPTTEFAPGLEDTVILT 354

Query: 263 MKGIAAGMQNTG 228
           MKGIAAGMQNTG
Sbjct: 355 MKGIAAGMQNTG 366



>gb:PNPPC_1700913 P.nudum mRNA for phosphoenolpyruvate decarboxylase.
          Length = 669

 Score =  233 bits (595), Expect = 2e-60
 Identities = 124/186 (66%), Positives = 145/186 (77%)
 Frame = -2

Query: 803  FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
            FAWTQTRFHLPV LG GAAFK  +++D  NL + QEMY EWPFFRVTIDLVEMVFAKGDP
Sbjct: 490  FAWTQTRFHLPVWLGFGAAFKSVMERDPNNLIVLQEMYKEWPFFRVTIDLVEMVFAKGDP 549

Query: 623  GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
             I ALYDKLLV+ DL  FG+ LR+ YE+TK LLL++AGHK++LEG+P LKQ+L LR+  I
Sbjct: 550  RITALYDKLLVNDDLQYFGDILRAKYEETKKLLLKVAGHKEILEGNPTLKQRLLLREPCI 609

Query: 443  TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYVDSKHADELVKLNPTSDYAPGLEDTLILT 264
            TTLNV QA+TLKR R+ +  +   P  SK       A EL+ LN TS+YAPGLEDTLILT
Sbjct: 610  TTLNVQQAFTLKRXREGNKDL---PVHSK---SRNSAAELITLNTTSEYAPGLEDTLILT 663

Query: 263  MKGIAA 246
            MKGIAA
Sbjct: 664  MKGIAA 669



>gb:SBAJ1299_1704855 Symphyogyna brongniartii partial mRNA for
           phosphoenolpyruvate carboxylase, clone pSB2.1.
          Length = 375

 Score =  233 bits (594), Expect = 3e-60
 Identities = 116/198 (58%), Positives = 149/198 (75%), Gaps = 6/198 (3%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG G AFK  + K+  N+ + ++MYNEWPFFRVTIDL+EMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGFGGAFKHVLAKNNSNVVLLRKMYNEWPFFRVTIDLIEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD+LLVS +L   GE+LR+ Y +T+ LL+ IAGH+D+L G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDELLVSDELKPLGEKLRAMYGETRELLMTIAGHEDVLAGNPTLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV------DSKHADELVKLNPTSDYAPGLE 282
           T LN+ QA+TL++IRD   H+++R    +           K +  LV LN  +++ PGLE
Sbjct: 298 TPLNLIQAFTLQKIRDQSNHISVREAGDRPSTPPKAGESGKQSSHLVTLNKKTEFPPGLE 357

Query: 281 DTLILTMKGIAAGMQNTG 228
           DTLI+TMKGIAAGMQNTG
Sbjct: 358 DTLIITMKGIAAGMQNTG 375



>gb:AB055074_1521414 Oryza sativa (japonica cultivar-group) mRNA for
           phosphoenolpyruvate carboxylase, partial cds,
           clone:OsppcAUC-1.
          Length = 368

 Score =  233 bits (594), Expect = 3e-60
 Identities = 110/137 (80%), Positives = 123/137 (89%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG GAAFK  +QKDI+NL++ QEMYNEWPFFRVTIDLVEMVFAKGDP
Sbjct: 232 FAWTQTRFHLPVWLGFGAAFKHVLQKDIRNLQILQEMYNEWPFFRVTIDLVEMVFAKGDP 291

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
           GIAALYDKLLVS+DLW FG RLR+NYE+TK LLLQ+AGHKDLLEGDPYL+Q+L++RDSYI
Sbjct: 292 GIAALYDKLLVSEDLWPFGARLRANYEETKQLLLQVAGHKDLLEGDPYLRQRLRIRDSYI 351

Query: 443 TTLNVCQAYTLKRIRDP 393
           T LNVCQA T K  + P
Sbjct: 352 TALNVCQACTAKAYQGP 368



>gb:FHAJ1285_1679041 Funaria hygrometrica partial mRNA for
           phosphoenolpyruvate carboxylase, clone pFH8.2.
          Length = 375

 Score =  231 bits (590), Expect = 9e-60
 Identities = 121/198 (61%), Positives = 146/198 (73%), Gaps = 6/198 (3%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A K A+Q D +N+   + MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGSALKQALQTDPRNIATLRRMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS  L   GE LR  Y +T+ LLL+I  H ++L+G+P LKQ+L+LR+ YI
Sbjct: 238 RIAALYDNLLVSDQLKPLGEELRQKYNETRDLLLKITFHDEILQGNPSLKQRLRLREPYI 297

Query: 443 TTLNVCQAYTLKRIRDP--DYHVTLRPHISKDYVD----SKHADELVKLNPTSDYAPGLE 282
           T LNV QA  LK++RD    +        SKD  +     K A ELV+LNPT+++ PGLE
Sbjct: 298 TALNVQQALVLKKMRDQSLQFCALQNSSSSKDQSELPTTPKRAAELVELNPTTEFPPGLE 357

Query: 281 DTLILTMKGIAAGMQNTG 228
           DTLILTMKGIAAGMQNTG
Sbjct: 358 DTLILTMKGIAAGMQNTG 375



>gb:SPAJ1302_1718552 Scleropodium purum partial mRNA for
           phosphoenolpyruvate carboxylase, clone pSP28.3.
          Length = 371

 Score =  231 bits (589), Expect = 1e-59
 Identities = 115/194 (59%), Positives = 147/194 (75%), Gaps = 2/194 (1%)
 Frame = -2

Query: 803 FAWTQTRFHLPVXLGVGAAFKCAIQKDIKNLKMFQEMYNEWPFFRVTIDLVEMVFAKGDP 624
           FAWTQTRFHLPV LG+G+A K  +Q D +N+ + + MYN+WPFFRVTIDLVEMVFAKGDP
Sbjct: 178 FAWTQTRFHLPVWLGLGSALKEVLQTDPRNIAILRRMYNQWPFFRVTIDLVEMVFAKGDP 237

Query: 623 GIAALYDKLLVSKDLWSFGERLRSNYEDTKSLLLQIAGHKDLLEGDPYLKQQLKLRDSYI 444
            IAALYD LLVS ++   G+ LR  Y +T+  LL++AGH+D+L+G+P LKQ+L+LR+ Y+
Sbjct: 238 RIAALYDNLLVSDEVKPLGDELRRKYNETREYLLRVAGHEDILQGNPTLKQRLRLREPYL 297

Query: 443 TTLNVCQAYTLKRIRDPDYHVTLRPHISKDYV--DSKHADELVKLNPTSDYAPGLEDTLI 270
           T LNV QA  LK++RD         + +   V    + A ELV+LNPT+++ PGLEDTLI
Sbjct: 298 TALNVQQALVLKKMRDSSSQFCALQNGNSGEVPKSPRRAAELVELNPTTEFPPGLEDTLI 357

Query: 269 LTMKGIAAGMQNTG 228
           LTMKGIAAGMQNTG
Sbjct: 358 LTMKGIAAGMQNTG 371


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 883,245,173
Number of Sequences: 1806583
Number of extensions: 19138724
Number of successful extensions: 49468
Number of sequences better than 10.0: 428
Number of HSP's better than 10.0 without gapping: 47014
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49066
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53504197652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)