BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2722
         (854 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC069474_1540910 Arabidopsis thaliana chromosome 3 BAC T2E22 ...   168   1e-40   
gb:AY137590_1582113 Oryza sativa (indica cultivar-group) multipl...   145   1e-33   
gb:AY224422_1590624 Oryza sativa (japonica cultivar-group) isola...   140   4e-32   
gb:AY496109_1178449 Capsicum annuum induced stolon tip protein m...   131   1e-29   
gb:AY282740_1594712 Oryza sativa (japonica cultivar-group) putat...   125   1e-27   
pir|T11846|T11846 pathogenesis-related protein 3 - kidney bean>g...   124   2e-27   Phaseolus vulgaris [French bean]
pir|T49033|T49033 zinc finger-like protein - Arabidopsis thalian...   116   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AY377427_1603798 Oryza sativa (japonica cultivar-group) putat...   115   1e-24   
gb:AY042871_1560936 Arabidopsis thaliana zinc finger-like protei...   112   1e-23   
gb:AP003626_1831674 Oryza sativa (japonica cultivar-group) genom...   111   2e-23   
gb:AY345599_1600993 Oryza sativa (indica cultivar-group) zinc-fi...   110   4e-23   
gb:AY515607_1610753 Zea mays putative zinc finger protein ZmZf m...   107   3e-22   
pir|D84674|D84674 hypothetical protein At2g27580 [imported] - Ar...   107   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:BT001984_1635587 Arabidopsis thaliana expressed protein (At1g...   106   5e-22   
pir|G96549|G96549 hypothetical protein F11M15.7 [imported] - Ara...   106   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP004184_1838674 Oryza sativa (japonica cultivar-group) genom...   106   6e-22   
pir|T51098|T51098 hypothetical protein p85RF [imported] - Prunus...   104   2e-21   Prunus armeniaca
gb:AY484589_1608329 Musa acuminata clone MuH9, genomic sequence.      104   2e-21   
pir|C84779|C84779 hypothetical protein At2g36320 [imported] - Ar...   103   4e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T06611|T06611 hypothetical protein F16J13.110 - Arabidopsis ...   102   7e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T04577|T04577 hypothetical protein T12H17.210 - Arabidopsis ...   101   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP004790_1845134 Oryza sativa (japonica cultivar-group) genom...   101   2e-20   
gb:AY526867_1611651 Oryza sativa (japonica cultivar-group) putat...   101   2e-20   
gb:AC116955_1206500 Dictyostelium discoideum chromosome 2 map 54...   100   3e-20   
gb:AP003239_1826022 Oryza sativa (japonica cultivar-group) genom...   100   5e-20   
gb:BT010824_1640770 Arabidopsis thaliana At1g12440 mRNA, complet...   100   5e-20   
gb:AE005172_890254 Arabidopsis thaliana chromosome 1, top arm co...   100   5e-20   
gb:AP005159_1848427 Oryza sativa (japonica cultivar-group) genom...    99   8e-20   
gb:AP003288_1827362 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AC090871_1734497 Oryza sativa chromosome 3 BAC OSJNBb0060J21 ...    96   9e-19   
gb:BC061391_2553165 Xenopus tropicalis hypothetical protein MGC7...    96   1e-18   
gb:BC059673_2552645 Danio rerio zinc finger, A20 domain containi...    96   1e-18   
gb:BC042359_2548166 Xenopus laevis protein associated with PRK1,...    95   2e-18   
gb:AJ720370_2502557 Gallus gallus mRNA for hypothetical protein,...    94   3e-18   
gb:AY223086_1176551 Schistosoma japonicum clone ZZD1323 mRNA seq...    94   3e-18   
sp|O76080|Z216_HUMAN|Z216_HUMAN Zinc finger protein 216.>gb:AF062072_187994...    93   6e-18   Homo sapiens [man]
sp|O88878|Z216_MOUSE|Z216_MOUSE Zinc finger protein 216.>gb:AK076397_117137...    93   7e-18   Mus musculus [mouse]
gb:AB001773_1192659 Ciona savignyi pem-6 (posterior end mark 6) ...    92   2e-17   
gb:AE014297_1138630 Drosophila melanogaster chromosome 3R, compl...    90   5e-17   
gb:BC076427_2559264 Danio rerio cDNA clone MGC:101121 IMAGE:7156...    90   6e-17   
gb:BC056712_2551905 Danio rerio wu:fb11b11, mRNA (cDNA clone IMA...    90   6e-17   
gb:AY398314_2531844 Danio rerio clone RK065A2D12 protein associa...    90   6e-17   
gb:AP005840_1858859 Oryza sativa (japonica cultivar-group) genom...    90   6e-17   
gb:DME421016_1379255 Drosophila melanogaster partial mRNA for hy...    90   6e-17   
gb:AP005840_1858858 Oryza sativa (japonica cultivar-group) genom...    89   8e-17   
gb:BC050491_2550375 Danio rerio zinc finger, A20 domain containi...    87   4e-16   
gb:BC081266_2562158 Xenopus laevis MGC86388 protein, mRNA (cDNA ...    87   5e-16   
gb:BC076851_2559592 Xenopus laevis zinc finger, A20 domain conta...    87   5e-16   
gb:AF261138_1893500 Homo sapiens HT032 mRNA, complete cds.>gb:BC...    87   5e-16   
gb:CR860033_1184129 Pongo pygmaeus mRNA; cDNA DKFZp459F1624 (fro...    86   7e-16   
gb:AK002775_1151435 Mus musculus adult male kidney cDNA, RIKEN f...    86   7e-16   
gb:AF188206_1249210 Strongyloides stercoralis IgG-immunoreactive...    85   2e-15   
pir|T10218|T10218 hypothetical protein T30C3.50 - Arabidopsis th...    84   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:MMU251508_2119831 Mus musculus mRNA for AWP1 protein (Awp1 ge...    83   8e-15   
gb:HSM801572_1186266 Homo sapiens mRNA; cDNA DKFZp564F2116 (from...    82   1e-14   
pir|T21254|T21254 hypothetical protein F22D6.2 - Caenorhabditis ...    82   1e-14   Caenorhabditis elegans [roundworm]
gb:CR533476_1993681 Homo sapiens full open reading frame cDNA cl...    80   5e-14   
gb:PFMAL8P1_1192154 Plasmodium falciparum 3D7 chromosome 8, *** ...    80   5e-14   
gb:AY429441_1605844 Gossypium barbadense fiber protein Fb37 mRNA...    77   3e-13   
gb:AE014298_1124925 Drosophila melanogaster chromosome X, comple...    70   7e-11   
gb:XELUBILFPA_2582263 Xenopus laevis ubiquitin-like fusion prote...    68   2e-10   
gb:BC080990_2561901 Xenopus laevis ubiquitin-like fusion protein...    68   2e-10   
gb:BC046649_2549642 Xenopus laevis similar to testis-specific ge...    68   2e-10   
pir|JN0673|JN0673 ubiquitin-like fusion protein An1a - African c...    68   2e-10   Xenopus laevis [clawed frog]
pir|JN0674|JN0674 ubiquitin-like fusion protein An1b - African c...    67   4e-10   Xenopus laevis [clawed frog]
gb:BC048968_1984183 Homo sapiens AN1, ubiquitin-like, homolog (X...    66   7e-10   
gb:BC045587_1983585 Homo sapiens AN1, ubiquitin-like, homolog (X...    66   7e-10   
gb:AL445201_1927381 Human DNA sequence from clone RP11-358L16 on...    66   7e-10   
gb:AL445201_1927380 Human DNA sequence from clone RP11-358L16 on...    66   7e-10   
gb:AF311324_1896255 Homo sapiens ubiquitin-like fusion protein m...    66   7e-10   
gb:S77733_1444479 EST00848 homolog {clone A2} [cattle, endotheli...    61   2e-08   
pir|I47035|I47035 ubiquitin homolog - bovine (fragment)                61   2e-08   Bos taurus [bovine]
gb:AP003288_1827356 Oryza sativa (japonica cultivar-group) genom...    60   4e-08   
gb:CNS07EGB_1373097 chromosome IV of strain GB-M1 of Encephalito...    54   3e-06   
pir|T18125|T18125 hypothetical protein A623L - Chlorella virus P...    51   2e-05   Paramecium bursaria Chlorella virus 1
gb:BC081022_2561931 Xenopus laevis MGC81636 protein, mRNA (cDNA ...    47   6e-04   
gb:BC034396_2097657 Mus musculus testis expressed gene 27, mRNA ...    46   0.001   
gb:AL133377_1918436 Human DNA sequence from clone RP1-295F6 on c...    45   0.001   
gb:AX882790_1479087 Sequence 17695 from Patent EP1074617.>gb:AK0...    45   0.001   
gb:BC085956_2109508 Rattus norvegicus testis expressed gene 27 (...    45   0.002   
gb:BC027161_2095791 Mus musculus testis expressed gene 27, mRNA ...    45   0.002   
gb:BC024483_2094540 Mus musculus testis expressed gene 27, mRNA ...    45   0.002   
pir|S43586|S43586 F26F3.4 protein (clone F26F3) - Caenorhabditis...    44   0.005   Caenorhabditis elegans [roundworm]
pir|B69398|B69398 hypothetical protein AF1187 - Archaeoglobus fu...    39   0.16    Archaeoglobus fulgidus
gb:BC011495_2091459 Mus musculus RIKEN cDNA 1110060O18 gene, mRN...    38   0.22    
gb:AK004332_1152317 Mus musculus 18-day embryo whole body cDNA, ...    38   0.22    
pir|C69376|C69376 conserved hypothetical protein AF1011 - Archae...    38   0.22    Archaeoglobus fulgidus
gb:CEY39A1A_1369758 Caenorhabditis elegans YAC Y39A1A, complete ...    37   0.48    
pir|T26727|T26727 hypothetical protein Y39A1A.4 - Caenorhabditis...    37   0.48    Caenorhabditis elegans [roundworm]
gb:AF061739_1879912 Homo sapiens unknown mRNA.                         36   1.1     
gb:AX885979_1481432 Sequence 1842 from Patent EP1033401.               36   1.1     
gb:BC018415_1976504 Homo sapiens hypothetical protein BC018415, ...    35   1.4     
gb:AL135924_1918772 Human DNA sequence from clone RP11-63P12 on ...    35   1.4     
gb:AK091345_1913458 Homo sapiens cDNA FLJ34026 fis, clone FCBBF2...    35   1.4     
gb:BC066741_2554578 Danio rerio zgc:77486, mRNA (cDNA clone MGC:...    35   2.4     
gb:AE014134_1127355 Drosophila melanogaster chromosome 2L, compl...    34   4.1     
gb:BC055589_2551453 Danio rerio zgc:66295, mRNA (cDNA clone MGC:...    33   5.3     
gb:AF204951_2214169 Ectocarpus siliculosus virus, complete genome.     33   6.9     
gb:AY596297_632141 Haloarcula marismortui ATCC 43049 chromosome ...    33   9.0     
pir|E69431|E69431 hypothetical protein AF1454 - Archaeoglobus fu...    33   9.0     Archaeoglobus fulgidus


>gb:AC069474_1540910 Arabidopsis thaliana chromosome 3 BAC T2E22
           genomic sequence, complete sequence.>gb:AY084755_1569839
           Arabidopsis thaliana clone 11684 mRNA, complete
           sequence.>gb:BT009714_1640175 Arabidopsis thaliana
           At3g12630 gene, complete cds.>gb:AP002044_1821616
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MMF12.
          Length = 160

 Score =  168 bits (426), Expect = 1e-40
 Identities = 91/170 (53%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = -1

Query: 791 MAQKTGKEETEFKVVPE----TITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAI 624
           MAQ+T KEETEFKV+      T TLC NNCGVT NPATNNMCQKCF              
Sbjct: 1   MAQRTEKEETEFKVLETLTTTTTTLCTNNCGVTANPATNNMCQKCFNASLVSAAAGVVE- 59

Query: 623 HHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNR 444
                ++  RS   R SP +    ++ RE   V + ++ +                 VNR
Sbjct: 60  SGSILKRSARSVNLRSSPAKVV--IRPREIDAVKKRDQQI-----------------VNR 100

Query: 443 CSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CSGCR+KVGLTGFRCRCGELFC EHRYSDRHDCSYDYK AGR+AIARENP
Sbjct: 101 CSGCRKKVGLTGFRCRCGELFCSEHRYSDRHDCSYDYKTAGREAIARENP 150



>gb:AY137590_1582113 Oryza sativa (indica cultivar-group) multiple
           stress-associated zinc-finger protein (OSISAP1) gene,
           complete cds.>gb:AF140722_1771564 Oryza sativa (indica
           cultivar-group) multiple stress-responsive zinc-finger
           protein mRNA, complete cds.
          Length = 164

 Score =  145 bits (365), Expect = 1e-33
 Identities = 72/166 (43%), Positives = 88/166 (53%)
 Frame = -1

Query: 791 MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKF 612
           MAQ+  K++   ++    ITLC N+CG  GNPAT N+CQ CF                  
Sbjct: 1   MAQRDKKDQEPTELRAPEITLCANSCGFPGNPATQNLCQNCFLAATASTSSPSSLSSPVL 60

Query: 611 GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGC 432
            ++ PR     + P+   P         +A     V                 VNRCS C
Sbjct: 61  DKQPPRPAAPLVEPQAPLPPPVEEMASALATAPAPVAKTSA------------VNRCSRC 108

Query: 431 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           R++VGLTGFRCRCG LFCGEHRYSDRH CSYDYK+A RDAIAR+NP
Sbjct: 109 RKRVGLTGFRCRCGHLFCGEHRYSDRHGCSYDYKSAARDAIARDNP 154



>gb:AY224422_1590624 Oryza sativa (japonica cultivar-group) isolate
           20116 pathogenesis-related protein-like protein mRNA,
           complete cds.>gb:AY601878_1617438 Oryza sativa (japonica
           cultivar-group) putative zinc finger transcription
           factor (ZFP60) mRNA, complete cds.>gb:AP003883_1834789
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 8, BAC clone:OJ1134_H03.>gb:AP005245_1849430
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 8, BAC clone:OSJNBa0025J22.
          Length = 170

 Score =  140 bits (352), Expect = 4e-32
 Identities = 76/168 (45%), Positives = 90/168 (53%), Gaps = 2/168 (1%)
 Frame = -1

Query: 791 MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKF 612
           MAQ+  K E   ++    +TLC N+CG  GNPATNN+CQ CF            A     
Sbjct: 1   MAQREKKVEEPTELRAPEMTLCANSCGFPGNPATNNLCQNCFLAASASSSSSSAA----- 55

Query: 611 GEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKR--EVNRCS 438
               P +    + P    P  +  +    A     V          S  A R   VNRC 
Sbjct: 56  --ASPSTTSLPVFPVVEKP-RQAVQSSAAAAVALVVERPTAGPVESSSKASRSSSVNRCH 112

Query: 437 GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
            CRR+VGLTGFRCRCGEL+CG HRYSDRHDCS+DYK+A RDAIARENP
Sbjct: 113 SCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENP 160



>gb:AY496109_1178449 Capsicum annuum induced stolon tip protein
           mRNA, complete cds.
          Length = 88

 Score =  131 bits (330), Expect = 1e-29
 Identities = 57/59 (96%), Positives = 58/59 (98%)
 Frame = -1

Query: 470 PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK AGR+AIARENP
Sbjct: 20  PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGREAIARENP 78



>gb:AY282740_1594712 Oryza sativa (japonica cultivar-group) putative
           zinc finger transcription factor ZFP33 mRNA, complete
           cds.>gb:AP005840_1858856 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0050F10.
          Length = 161

 Score =  125 bits (313), Expect = 1e-27
 Identities = 67/167 (40%), Positives = 86/167 (51%), Gaps = 1/167 (0%)
 Frame = -1

Query: 791 MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHK 615
           MAQ++ K E+E  V  PE   LCVNNCG  G+  TNNMC KC+             +  K
Sbjct: 1   MAQESWKNESEETVHTPEAPILCVNNCGFFGSSMTNNMCSKCYRDFVKVTTMAAPVVEKK 60

Query: 614 FGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSG 435
                    F   S  +T  +  + ++   A  E               P K   NRC  
Sbjct: 61  --------AFTPASSSKTPLEPAKPDEVPAAAVEDKQAA--------QEPPKPPSNRCLS 104

Query: 434 CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CR+KVGLTGF+CRCG  FC  HRY++ HDC++DYK AGRD IA++NP
Sbjct: 105 CRKKVGLTGFQCRCGGTFCSTHRYTEAHDCTFDYKKAGRDQIAKQNP 151



>pir|T11846|T11846 pathogenesis-related protein 3 - kidney
           bean>gb:PHVPVPR3A_1700248 P.vulgaris PVPR3 protein mRNA,
           complete cds.
          Length = 137

 Score =  124 bits (311), Expect = 2e-27
 Identities = 80/167 (47%), Positives = 91/167 (54%), Gaps = 1/167 (0%)
 Frame = -1

Query: 791 MAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKF 612
           MAQK  K +T+FKV PE IT C      T   AT+      F                 F
Sbjct: 1   MAQKAQKNDTDFKV-PEPITPCAT---ATAAAATSISEPSRF-----------------F 39

Query: 611 GEKQPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSG 435
               P +  R  SP+R+ P +     DRTVA                S P KR VNRCSG
Sbjct: 40  DAATPATSSR--SPKRSLPLEDAANADRTVA----------------SEP-KRAVNRCSG 80

Query: 434 CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CRR+VGLTGFRCRCG+LFC EHRY+DRHDCSYDYK  GR+AIARENP
Sbjct: 81  CRRRVGLTGFRCRCGDLFCAEHRYTDRHDCSYDYKTVGREAIARENP 127



>pir|T49033|T49033 zinc finger-like protein - Arabidopsis
           thaliana>gb:ATF3C22_1550591 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3C22.
          Length = 170

 Score =  116 bits (290), Expect = 6e-25
 Identities = 58/155 (37%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXX----XXXXXXXXXAIHHKFGEKQPRSGFRR 579
           PE+  LCVNNCG  G+ AT N+C  C+                 +        P S    
Sbjct: 10  PESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQSSSIKSTVESSLSVSPPSSSSSE 69

Query: 578 LSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRC 399
           +S     P LK    +     +K V       +N+    ++  NRC+ CR++VGLTGF+C
Sbjct: 70  ISSPIIPPLLKNPSVKLEVPEKKAVISLPTTEQNQ----QQRPNRCTTCRKRVGLTGFKC 125

Query: 398 RCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           RCG +FCG HRY + H CSYD+K+AGR+ IA+ NP
Sbjct: 126 RCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANP 160



>gb:AY377427_1603798 Oryza sativa (japonica cultivar-group) putative
           zinc finger transcription factor ZFP38 (ZFP38) mRNA,
           complete cds.>gb:AC090871_1734500 Oryza sativa
           chromosome 3 BAC OSJNBb0060J21 genomic sequence,
           complete sequence.
          Length = 160

 Score =  115 bits (287), Expect = 1e-24
 Identities = 66/168 (39%), Positives = 88/168 (52%), Gaps = 2/168 (1%)
 Frame = -1

Query: 791 MAQKTGKEETEFKVV--PETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHH 618
           MAQ++ K+E E   V  PE   LCVNNCG  G+  T NMC KC+                
Sbjct: 1   MAQESWKKEAEETGVHTPEAPILCVNNCGFFGSRMTENMCSKCYRDTVKAKTVATVV--- 57

Query: 617 KFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCS 438
              EK+P +    LS      ++      +VA G++ +           PP+    NRC 
Sbjct: 58  ---EKKPLAS---LSSTPLVTEVTDGGSGSVADGKQVMEEDTP-----KPPS----NRCL 102

Query: 437 GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
            CR+KVGLTGF+CRCG  FC  HRY+D H C++DYK  GR+ IA++NP
Sbjct: 103 SCRKKVGLTGFKCRCGGTFCSMHRYADSHKCTFDYKQVGREQIAKQNP 150



>gb:AY042871_1560936 Arabidopsis thaliana zinc finger-like protein
           (F3C22_200) mRNA, complete cds.>gb:AY072524_1567341
           Arabidopsis thaliana zinc finger-like protein
           (At3g52800; F3C22_200) mRNA, complete cds.
          Length = 169

 Score =  112 bits (279), Expect = 1e-23
 Identities = 58/155 (37%), Positives = 80/155 (51%), Gaps = 4/155 (2%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXX----XXXXXXXXXAIHHKFGEKQPRSGFRR 579
           PE+  LCVNNCG  G+ AT N+C  C+                 +        P S    
Sbjct: 10  PESNRLCVNNCGFLGS-ATMNLCSNCYGDLCLKQQQQSSSIKSTVESSLSVSPPSSSSSE 68

Query: 578 LSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRC 399
           +S     P LK    +     +K V       +N+    ++  NRC+ CR++VGLTGF+C
Sbjct: 69  ISSPIIPPLLKNPSVKLEVPEKKAVISLPTTEQNQ----QQRPNRCTTCRKRVGLTGFKC 124

Query: 398 RCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           RCG +FCG HRY + H CSYD+K+AGR+ IA+ NP
Sbjct: 125 RCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANP 159



>gb:AP003626_1831674 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0429G06.>gb:AP003711_1832291 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0417G12.
          Length = 171

 Score =  111 bits (278), Expect = 2e-23
 Identities = 64/166 (38%), Positives = 82/166 (49%), Gaps = 15/166 (9%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPE 567
           PE   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct: 11  PEGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID 55

Query: 566 RT--------SPDLKRREDRTVARGE-KTVXXXXXXXENRS------PPAKREVNRCSGC 432
                      P +    +  VA+ E KT+          S      P  +   NRCS C
Sbjct: 56  SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC 115

Query: 431 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           R++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct: 116 RKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP 161



>gb:AY345599_1600993 Oryza sativa (indica cultivar-group)
           zinc-finger protein mRNA, complete cds.
          Length = 171

 Score =  110 bits (274), Expect = 4e-23
 Identities = 63/166 (37%), Positives = 82/166 (49%), Gaps = 15/166 (9%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPE 567
           P+   LC+NNCG  G+ AT NMC KC               H +   KQ ++     S +
Sbjct: 11  PKGPILCINNCGFFGSAATMNMCSKC---------------HKEMIMKQEQAKLAASSID 55

Query: 566 RT--------SPDLKRREDRTVARGE-KTVXXXXXXXENRS------PPAKREVNRCSGC 432
                      P +    +  VA+ E KT+          S      P  +   NRCS C
Sbjct: 56  SIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVNPKGREGPNRCSTC 115

Query: 431 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           R++VGLTGF CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct: 116 RKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKANP 161



>gb:AY515607_1610753 Zea mays putative zinc finger protein ZmZf
           mRNA, complete cds.
          Length = 233

 Score =  107 bits (267), Expect = 3e-22
 Identities = 58/158 (36%), Positives = 74/158 (46%), Gaps = 7/158 (4%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXX-------XXXXXXXAIHHKFGEKQPRSG 588
           PE   LC+NNCG  G+ AT NMC KC                     +       +P   
Sbjct: 70  PEGPILCINNCGFFGSAATMNMCSKCHKEMITKQDQAKLAASSIDSIVDGSDAVMEPGGA 129

Query: 587 FRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTG 408
                      +L+++  +  A     V          S   K   NRCS CR++VGLTG
Sbjct: 130 GSNTVVAVAQVELQKKNVQQPA----DVAEPNEGVAAISKGGKVGPNRCSACRKRVGLTG 185

Query: 407 FRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           F CRCG L+C  HRYSD+HDC +DY+ A RDAIA+ NP
Sbjct: 186 FNCRCGNLYCALHRYSDKHDCKFDYRTAARDAIAKANP 223



>pir|D84674|D84674 hypothetical protein At2g27580 [imported] -
           Arabidopsis thaliana>gb:AC005824_1533054 Arabidopsis
           thaliana chromosome 2 clone F15K20 map B68, complete
           sequence.>gb:AC006232_1533764 Arabidopsis thaliana
           chromosome 2 clone F10A12 map B68, complete
           sequence.>gb:AY072454_1567271 Arabidopsis thaliana
           putative zinc finger protein (At2g27580) mRNA, complete
           cds.>gb:AY085258_1570330 Arabidopsis thaliana clone
           14203 mRNA, complete sequence.>gb:BT000341_1634619
           Arabidopsis thaliana putative zinc finger protein
           (At2g27580) mRNA, complete cds.
          Length = 163

 Score =  107 bits (266), Expect = 4e-22
 Identities = 55/146 (37%), Positives = 74/146 (50%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPD 552
           LC NNCG  G+ AT N+C KCF            A H               S     P 
Sbjct: 12  LCANNCGFFGSTATQNLCSKCFRDLQHQEQNSSTAKHALTQSLAAVGAAASSSVSPPPPP 71

Query: 551 LKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE 372
               ++   A+ EK         +   PP  ++  RC  CRR+VG+TGFRCRCG +FCG 
Sbjct: 72  PADSKEIVEAKSEKRAAAEPEEADG--PP--QDPKRCLTCRRRVGITGFRCRCGFVFCGT 127

Query: 371 HRYSDRHDCSYDYKAAGRDAIARENP 294
           HRY+++H+CS+D+K  G+D IA+ NP
Sbjct: 128 HRYAEQHECSFDFKRMGKDKIAKANP 153



>gb:BT001984_1635587 Arabidopsis thaliana expressed protein
           (At1g51200) mRNA, complete cds.
          Length = 173

 Score =  106 bits (265), Expect = 5e-22
 Identities = 56/160 (35%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRS 591
           ++T  +  PE   LC NNCG  G+ AT NMC KC                   G     +
Sbjct: 4   DKTGCQSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGTKFASAVSGTSSSSN 63

Query: 590 GFRR-LSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGL 414
             +   +      + K  E  TV+    +V               +  +RC+ C ++VGL
Sbjct: 64  IIKETFTAALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPKGPSRCTTCNKRVGL 123

Query: 413 TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           TGF+CRCG LFCG HRY+D HDCS++Y AA ++AIA+ NP
Sbjct: 124 TGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANP 163



>pir|G96549|G96549 hypothetical protein F11M15.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893035 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006085_1533452 Arabidopsis thaliana
           chromosome I BAC F11M15 genomic sequence, complete
           sequence.>gb:AY056445_1563753 Arabidopsis thaliana
           At1g51200/F11M15_6 mRNA, complete
           cds.>gb:BT015115_1642085 Arabidopsis thaliana At1g51200
           gene, complete cds.
          Length = 173

 Score =  106 bits (265), Expect = 5e-22
 Identities = 56/160 (35%), Positives = 78/160 (48%), Gaps = 1/160 (0%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRS 591
           ++T  +  PE   LC NNCG  G+ AT NMC KC                   G     +
Sbjct: 4   DKTGCQSPPEGPKLCTNNCGFFGSAATMNMCSKCHKDMLFQQEQGAKFASAVSGTSSSSN 63

Query: 590 GFRR-LSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGL 414
             +   +      + K  E  TV+    +V               +  +RC+ C ++VGL
Sbjct: 64  IIKETFTAALVDIETKSVEPMTVSVQPSSVQVVAEVVAPEEAAKPKGPSRCTTCNKRVGL 123

Query: 413 TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           TGF+CRCG LFCG HRY+D HDCS++Y AA ++AIA+ NP
Sbjct: 124 TGFKCRCGSLFCGTHRYADVHDCSFNYHAAAQEAIAKANP 163



>gb:AP004184_1838674 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1225_F07.
          Length = 173

 Score =  106 bits (264), Expect = 6e-22
 Identities = 58/161 (36%), Positives = 78/161 (48%), Gaps = 10/161 (6%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXX-------XXXXXXXXXXAIHHKFGEKQ---P 597
           PE   LC+NNCG  G+ AT NMC KC                     ++   G K+    
Sbjct: 11  PEGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVA 70

Query: 596 RSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVG 417
            SG   ++  +        +   VA   + V           P  K   NRC+ CR++VG
Sbjct: 71  ASGSTAVAVAQVEAKTLVVQPTDVAGTSEEVAVV--------PKVKEGPNRCATCRKRVG 122

Query: 416 LTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           LTGF CRCG ++C  HRYSD+H+C +DY+ A RDAIA+ NP
Sbjct: 123 LTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANP 163



>pir|T51098|T51098 hypothetical protein p85RF [imported] - Prunus
           armeniaca>gb:AF139499_1771434 Prunus armeniaca p85RF
           mRNA, complete cds.
          Length = 173

 Score =  104 bits (260), Expect = 2e-21
 Identities = 61/163 (37%), Positives = 74/163 (45%), Gaps = 4/163 (2%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGE----K 603
           EET  +  PE   LCVNNCG  G+ AT NMC KC             A    FG      
Sbjct: 4   EETGCQPHPEGPILCVNNCGFFGSVATRNMCSKCHKDMMLKEEQAKLAAS-SFGNIVNGT 62

Query: 602 QPRSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRK 423
              +G   +            E +T++                + P   +  RC  C ++
Sbjct: 63  SNSNGNEPVVAAGVDVQAHLVEPKTISLQPSFSFGSGSGGSGEAKPEGPK--RCGTCNKR 120

Query: 422 VGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           VGLTGF CRCG LFC  HRYSD+HDC YDY  A RD IA+ NP
Sbjct: 121 VGLTGFNCRCGHLFCAVHRYSDKHDCPYDYHTAARDVIAKANP 163



>gb:AY484589_1608329 Musa acuminata clone MuH9, genomic sequence.
          Length = 157

 Score =  104 bits (259), Expect = 2e-21
 Identities = 44/60 (73%), Positives = 50/60 (83%)
 Frame = -1

Query: 473 SPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           SP   R  NRCS CR+KVGLTGFRCRCG+LFCG HRYSD H+CS+DYKAAGR+ IA+ NP
Sbjct: 88  SPAPVRFSNRCSACRKKVGLTGFRCRCGDLFCGRHRYSDAHECSFDYKAAGREEIAKANP 147



>pir|C84779|C84779 hypothetical protein At2g36320 [imported] -
           Arabidopsis thaliana>gb:AC006921_1534752 Arabidopsis
           thaliana chromosome 2 clone F2H17 map g6825, complete
           sequence.>gb:AY086347_1571397 Arabidopsis thaliana clone
           24255 mRNA, complete sequence.
          Length = 161

 Score =  103 bits (257), Expect = 4e-21
 Identities = 55/156 (35%), Positives = 76/156 (48%), Gaps = 5/156 (3%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPE 567
           PE   LCVNNCG  G+ AT N+C  C+                   ++Q ++  +     
Sbjct: 10  PEGHRLCVNNCGFFGSSATMNLCSNCYGDLCL--------------KQQQQASMKSTVES 55

Query: 566 RTSPDLKRREDRTVARGE-----KTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFR 402
             SP +    +   A  E     KT            P   +  NRC+ CR++VGLTGF 
Sbjct: 56  SLSPVIAPVLENYAAELEIPTTKKTEEKKPIQIPTEQPSPPQRPNRCTVCRKRVGLTGFM 115

Query: 401 CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CRCG  FCG HRY + H C++D+K+AGR+ IA+ NP
Sbjct: 116 CRCGTTFCGSHRYPEVHGCTFDFKSAGREEIAKANP 151



>pir|T06611|T06611 hypothetical protein F16J13.110 - Arabidopsis
           thaliana>gb:ATCHRIV33_1544969 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           33.>gb:ATF16J13_1548804 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16J13 (ESSA
           project).>gb:AY081720_1568980 Arabidopsis thaliana
           AT4g12040/F16J13_110 mRNA, complete
           cds.>gb:AY088226_1573247 Arabidopsis thaliana clone 45
           mRNA, complete sequence.>gb:AF325093_1786547 Arabidopsis
           thaliana putative protein (F16J13.110) mRNA, complete
           cds.>gb:AF361575_1791321 Arabidopsis thaliana
           AT4g12040/F16J13_110 mRNA, complete cds.
          Length = 175

 Score =  102 bits (255), Expect = 7e-21
 Identities = 58/166 (34%), Positives = 83/166 (50%), Gaps = 5/166 (3%)
 Frame = -1

Query: 776 GKEETEFKVVPETIT-LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXA-IHHKFGEK 603
           G EE      P T   LC N CG  G+P+  N+C KC+            A    K   K
Sbjct: 2   GSEENNSTSFPPTEPKLCDNGCGFFGSPSNMNLCSKCYRSLRAEEDQTAVAKAAVKNSLK 61

Query: 602 QPRSGFRRLSPERTSP-DLKRREDRTVARGEKTVXXXXXXXENRSPPAK--REVNRCSGC 432
            P      ++P +  P ++K     TV    +         ++ + P++  R  NRC  C
Sbjct: 62  LPSCSI--IAPGQKHPLEIKPAHLETVVVTAEPSSVPVAAEQDEAEPSRPVRPNNRCFSC 119

Query: 431 RRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
            +KVG+ GF+C+CG  FCG HRY ++H+CS+D+K  GRDAIA+ NP
Sbjct: 120 NKKVGVMGFKCKCGSTFCGSHRYPEKHECSFDFKEVGRDAIAKANP 165



>pir|T04577|T04577 hypothetical protein T12H17.210 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546119 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF7H19_1550926
           Arabidopsis thaliana DNA chromosome 4, BAC clone F7H19
           (ESSA project).>gb:ATT12H17_1554367 Arabidopsis thaliana
           DNA chromosome 4, BAC clone T12H17 (ESSAII
           project).>gb:BT001995_1635598 Arabidopsis thaliana
           predicted protein (At4g22820) mRNA, complete
           cds.>gb:BT006563_1639450 Arabidopsis thaliana At4g22820
           gene, complete cds.
          Length = 176

 Score =  101 bits (252), Expect = 2e-20
 Identities = 53/149 (35%), Positives = 71/149 (47%), Gaps = 3/149 (2%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFX---XXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERT 561
           LCV  CG  G+P+  ++C KC+               A+   F    PRS F    P   
Sbjct: 21  LCVKGCGFFGSPSNMDLCSKCYRGICAEEAQTAVAKAAVEKSFKPSPPRSLFIA-EPPAV 79

Query: 560 SPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELF 381
             + K  +   V    +            S PA+   NRC  C +KVG+ GF+C+CG  F
Sbjct: 80  VVEPKPEKAAVVVVSAEPSSSAVPEANEPSRPAR--TNRCLCCNKKVGIMGFKCKCGSTF 137

Query: 380 CGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CGEHRY + HDCS+D+K  GR  IA+ NP
Sbjct: 138 CGEHRYPETHDCSFDFKEVGRGEIAKANP 166



>gb:AP004790_1845134 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0476H10.
          Length = 154

 Score =  101 bits (251), Expect = 2e-20
 Identities = 54/146 (36%), Positives = 68/146 (46%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPD 552
           LC NNCG  G+PAT ++C KC+             +                SP  +S  
Sbjct: 14  LCANNCGFFGSPATLDLCSKCYRDRQGRESTAPVVVA---AAASACPATHPSSPSSSSCP 70

Query: 551 LKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGE 372
                      G                 A  + +RC+ CR++VGLTGF CRCG  FCG 
Sbjct: 71  AFLPSSTAAEAGVVVA-------------AVAKASRCASCRKRVGLTGFACRCGGTFCGA 117

Query: 371 HRYSDRHDCSYDYKAAGRDAIARENP 294
           HRY +RH C +D+KAAGRDAIAR NP
Sbjct: 118 HRYPERHACGFDFKAAGRDAIARANP 143



>gb:AY526867_1611651 Oryza sativa (japonica cultivar-group) putative
           zinc finger transcription factor (ZFP48) mRNA, complete
           cds.>gb:AC090871_1734499 Oryza sativa chromosome 3 BAC
           OSJNBb0060J21 genomic sequence, complete sequence.
          Length = 169

 Score =  101 bits (251), Expect = 2e-20
 Identities = 53/148 (35%), Positives = 70/148 (47%), Gaps = 2/148 (1%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPD 552
           +CV  CG  G+ ATNNMC +C+                   E    +    L     +  
Sbjct: 23  MCVTGCGFFGSEATNNMCSRCYREHSADNDAVE--------EAAAANSDLELVGVAETTT 74

Query: 551 LKRREDRTVARGEKTVXXXXXXXENRSPPAKREV--NRCSGCRRKVGLTGFRCRCGELFC 378
            K R    V                  P AK     NRC+ CR+KVGLTGF+CRCG  FC
Sbjct: 75  KKARMSAVVP----VAVASSSSAAAEQPAAKAATAPNRCAACRKKVGLTGFKCRCGGNFC 130

Query: 377 GEHRYSDRHDCSYDYKAAGRDAIARENP 294
           G HR++D H C +DYK+AG++ IA++NP
Sbjct: 131 GGHRHADAHGCGFDYKSAGKEQIAKQNP 158



>gb:AC116955_1206500 Dictyostelium discoideum chromosome 2 map
           5455881-5481449 strain AX4, complete sequence.
          Length = 173

 Score =  100 bits (250), Expect = 3e-20
 Identities = 52/159 (32%), Positives = 76/159 (47%), Gaps = 10/159 (6%)
 Frame = -1

Query: 740 TITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERT 561
           T T C   CG  GNP T NMC KCF                   +    S     S   T
Sbjct: 14  TPTPCSKGCGFFGNPLTENMCSKCFRTKKETTSN---------NDNNSISNINTTSTTST 64

Query: 560 SPDLKRREDRTVARGEKT--VXXXXXXXENRSPPAKR--------EVNRCSGCRRKVGLT 411
           + +   ++D  + + + T  V       E   PP +         +  +C  C +KVGL 
Sbjct: 65  TTNSITKKDIEINKQQATNAVVETAKLVEVEEPPTEEKDTKKVQTDTTKCFSCNKKVGLL 124

Query: 410 GFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           GF+CRC  ++C  HRYS++HDCS+DYK+AG++ +A++NP
Sbjct: 125 GFKCRCSFVYCSTHRYSNKHDCSFDYKSAGKEQLAKDNP 163



>gb:AP003239_1826022 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0403C05.
          Length = 344

 Score =  100 bits (248), Expect = 5e-20
 Identities = 54/151 (35%), Positives = 69/151 (45%), Gaps = 5/151 (3%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPD 552
           LC + CG  GNPAT +MC  C+                      P S     S    +  
Sbjct: 193 LCASGCGFYGNPATLDMCSVCYRQHCLLNGATMAT--------GPSSSVAAASAATVATG 244

Query: 551 LKRREDRTVARGEKTVXXXXXXXENRSPPA-----KREVNRCSGCRRKVGLTGFRCRCGE 387
               +  +V   E  V       +N   PA     K   NRC+ C++KVGL GF CRCG 
Sbjct: 245 AVTSDSCSVPSAE--VNGAAFSSKNNPEPATVVEKKAPANRCASCKKKVGLLGFACRCGA 302

Query: 386 LFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
            +CG HRY ++H C +D+K A RDAIAR NP
Sbjct: 303 TYCGTHRYPEKHACGFDFKGASRDAIARANP 333



>gb:BT010824_1640770 Arabidopsis thaliana At1g12440 mRNA, complete
           cds.>gb:BT011299_1641049 Arabidopsis thaliana At1g12440
           gene, complete cds.
          Length = 168

 Score =  100 bits (248), Expect = 5e-20
 Identities = 51/154 (33%), Positives = 72/154 (46%), Gaps = 3/154 (1%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXXX---XXXXXXAIHHKFGEKQPRSGFRRL 576
           P    LCV  CG  G+P+  N+C KC+               A+       +P++  ++ 
Sbjct: 13  PSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQ- 71

Query: 575 SPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCR 396
           S E T   L      +  RG  +             P K    RC  C +KVG+TGF+CR
Sbjct: 72  SQEITQGVLGSGSSSSSTRGGDSAAAPLD-------PPKSTATRCLSCNKKVGVTGFKCR 124

Query: 395 CGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CG  FCG HRY + H+C +D+K   R+AIA+ NP
Sbjct: 125 CGSTFCGTHRYPESHECQFDFKGVAREAIAKANP 158



>gb:AE005172_890254 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025416_1539466 Genomic sequence
           for Arabidopsis thaliana BAC F5O11 from chromosome I,
           complete sequence.
          Length = 254

 Score =  100 bits (248), Expect = 5e-20
 Identities = 51/154 (33%), Positives = 72/154 (46%), Gaps = 3/154 (1%)
 Frame = -1

Query: 746 PETITLCVNNCGVTGNPATNNMCQKCFXXXXXX---XXXXXXAIHHKFGEKQPRSGFRRL 576
           P    LCV  CG  G+P+  N+C KC+               A+       +P++  ++ 
Sbjct: 99  PSEPKLCVKGCGFFGSPSNMNLCSKCYRDIRATEEQTASAKAAVEKSLNPNKPKTQPQQ- 157

Query: 575 SPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCR 396
           S E T   L      +  RG  +             P K    RC  C +KVG+TGF+CR
Sbjct: 158 SQEITQGVLGSGSSSSSTRGGDSAAAPLD-------PPKSTATRCLSCNKKVGVTGFKCR 210

Query: 395 CGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CG  FCG HRY + H+C +D+K   R+AIA+ NP
Sbjct: 211 CGSTFCGTHRYPESHECQFDFKGVAREAIAKANP 244



>gb:AP005159_1848427 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0016C11.
          Length = 224

 Score = 99.4 bits (246), Expect = 8e-20
 Identities = 53/157 (33%), Positives = 76/157 (48%), Gaps = 7/157 (4%)
 Frame = -1

Query: 743 ETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRR----- 579
           E + LC + CG  G+  TNNMC KC+            +         P +         
Sbjct: 76  EQLALCSSGCGFFGSKETNNMCSKCYRDHLKATSPLFSS------SSSPATASTTDITVP 129

Query: 578 LSPERTSP--DLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGF 405
           ++P  T+P   LK +E+   A              + S  A  + NRC  CR+KVGL GF
Sbjct: 130 IAPATTAPTPSLKGKEEEATA------------AASSSAAAAAKPNRCVACRKKVGLLGF 177

Query: 404 RCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
            CRCG  FC  HR++D+H C++D+K + R+ IA+ENP
Sbjct: 178 ECRCGGTFCSTHRHADKHACTFDFKKSDREKIAKENP 214



 Score = 32.7 bits (73), Expect = 9.0
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = -1

Query: 734 TLCVNNCGVTGNPATNNMCQKCF 666
           ++C N CG  G+ AT  +C KC+
Sbjct: 19  SMCANGCGFFGSEATKKLCSKCY 41



>gb:AP003288_1827362 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0683B11.>gb:AP003453_1829703 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0480C01.
          Length = 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 55/145 (37%), Positives = 63/145 (43%)
 Frame = -1

Query: 728 CVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPDL 549
           C N CG  G+  T  +C KC+            A        Q        +PE    D 
Sbjct: 16  CANGCGFFGSADTRGLCSKCYRQTVMSQASAPSAAAQSAEHDQVVLP----APEGVPVDE 71

Query: 548 KRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEH 369
                     G KT                   +RC+ C R VGL GF CRCG +FCG H
Sbjct: 72  GAMPPPPPRHGAKTK------------------SRCAACGRSVGLMGFECRCGAVFCGAH 113

Query: 368 RYSDRHDCSYDYKAAGRDAIARENP 294
           RYSDRHDC YDY+ AGRDAIAR NP
Sbjct: 114 RYSDRHDCGYDYRGAGRDAIARANP 138



>gb:AC090871_1734497 Oryza sativa chromosome 3 BAC OSJNBb0060J21
           genomic sequence, complete sequence.
          Length = 237

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 42/88 (47%), Positives = 54/88 (61%)
 Frame = -1

Query: 557 PDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFC 378
           PD K R    VA              + +   + E NRC+ CRRKVGLTGF+CRCG  FC
Sbjct: 139 PDDKTRWRVAVASSAAAAADASYSSSSPATGEQPEANRCATCRRKVGLTGFKCRCGGTFC 198

Query: 377 GEHRYSDRHDCSYDYKAAGRDAIARENP 294
           G HRY+D H C +DYK++GR+ IA++NP
Sbjct: 199 GGHRYADEHGCGFDYKSSGRELIAKQNP 226



>gb:BC061391_2553165 Xenopus tropicalis hypothetical protein
           MGC75964, mRNA (cDNA clone MGC:75964 IMAGE:5384157),
           complete cds.
          Length = 201

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 63/192 (32%), Positives = 75/192 (39%), Gaps = 33/192 (17%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFX--------------------XXXX 651
           +ET     P    LC   CG  GNP TN +C  C+                         
Sbjct: 3   QETNHSQAP---LLCSTGCGFYGNPRTNGLCSVCYKEHLQRQNSGGRNSPPVVSVGSGVE 59

Query: 650 XXXXXXXAIHHKFGEKQP-------RSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXX 492
                        G   P        S    L    +S   +  E RT    E       
Sbjct: 60  VSTPQNAESSQAGGVADPVVPQTTQASSLPLLETGSSSSQAENAESRTTDTKEIPAATSD 119

Query: 491 XXXEN-----RSPP-AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 330
               +     RSP  AK + NRC  CR+K+GLTGF CRCG +FCG HRYSD H CSYDYK
Sbjct: 120 SAQNSSEEQERSPEKAKLKKNRCFMCRKKIGLTGFECRCGNVFCGTHRYSDVHSCSYDYK 179

Query: 329 AAGRDAIARENP 294
           A   + I +ENP
Sbjct: 180 ADAAEKIRKENP 191



>gb:BC059673_2552645 Danio rerio zinc finger, A20 domain containing
           2, mRNA (cDNA clone MGC:73363 IMAGE:4144947), complete
           cds.
          Length = 213

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 63/204 (30%), Positives = 85/204 (41%), Gaps = 45/204 (22%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF----------------------XXX 657
           +ET    VP    LC   CG  GNP TN MC  C+                         
Sbjct: 3   QETNQSPVP---ILCTTGCGFYGNPRTNGMCSVCYKEHLNRQQSSDRSPMSPLAGSPSAE 59

Query: 656 XXXXXXXXXAIHHKFGEKQPRSGFRRLS-PERTSPDLKRREDRTVARGEKTVXXXXXX-- 486
                    +I+       P +   R S P  + P  ++  + +++R EK +        
Sbjct: 60  ASAIQRLEASINKAETLPAPSTETMRESIPSSSLPVTQKMTEMSISREEKALSPKAETVE 119

Query: 485 ------XENRSP--------------PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHR 366
                   + SP               +K + NRC  CR++VGLTGF CRCG LFCG HR
Sbjct: 120 PVITQPTSSYSPIPVAQANDDAKSPDSSKPKKNRCFTCRKRVGLTGFDCRCGNLFCGIHR 179

Query: 365 YSDRHDCSYDYKAAGRDAIARENP 294
           YSD+H+C+YDYKA     I +ENP
Sbjct: 180 YSDKHNCTYDYKAEAAAKIRKENP 203



>gb:BC042359_2548166 Xenopus laevis protein associated with PRK1,
           mRNA (cDNA clone MGC:53634 IMAGE:4724946), complete cds.
          Length = 204

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 60/200 (30%), Positives = 78/200 (39%), Gaps = 41/200 (20%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPR- 594
           +ET     P    LC   CG  GNP TN +C  C+              ++  G   P  
Sbjct: 5   QETNHSQAP---LLCSTGCGFYGNPRTNGLCSVCYKEHLQRQ-------NNSGGRNSPPV 54

Query: 593 ----SGFRRLSPERT-----------------------------------SPDLKRREDR 531
               SG    +P+                                     + D +  + +
Sbjct: 55  VSVGSGVEASTPQNAESSQAGDVADPVVPQTTQASSLPLLETGSSSSQAENADSRTTDTK 114

Query: 530 TVARGEKTVXXXXXXXENRSPP-AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDR 354
            +                RSP  AK + NRC  CR+K+GLTGF CRCG +FCG HRYSD 
Sbjct: 115 EIQAATSDSSQNSSEELERSPEKAKLKKNRCFMCRKKIGLTGFECRCGNVFCGTHRYSDV 174

Query: 353 HDCSYDYKAAGRDAIARENP 294
           H CSYDYKA   + I +ENP
Sbjct: 175 HSCSYDYKADAAEKIRKENP 194



>gb:AJ720370_2502557 Gallus gallus mRNA for hypothetical protein,
           clone 16e14.
          Length = 212

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 59/190 (31%), Positives = 76/190 (40%), Gaps = 44/190 (23%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCF--------------------------XXXXXXXXXXXX 630
           LC   CG  GNP TN MC  C+                                      
Sbjct: 13  LCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRISPMGPASGSNSPTSDSTSVQRADTT 72

Query: 629 AIHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEK----------------TVXX 498
           ++++  G     S   R  P    P  ++  + +++R EK                +V  
Sbjct: 73  SLNNCDGVAGSTSEKSRSVPVAALPVTQQMTEMSISREEKVTPKTETEPVVTQPTPSVSQ 132

Query: 497 XXXXXENRSPPA--KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAA 324
                     P   K + NRC  CR+KVGLTGF CRCG LFCG HRYSD+H+C YDYKA 
Sbjct: 133 PSTSRNEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAE 192

Query: 323 GRDAIARENP 294
               I +ENP
Sbjct: 193 AAAKIRKENP 202



>gb:AY223086_1176551 Schistosoma japonicum clone ZZD1323 mRNA
           sequence.
          Length = 185

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 58/177 (32%), Positives = 79/177 (44%), Gaps = 18/177 (10%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXX--XXXXXXAIHHKFGEKQP 597
           E +E +  PE   +C   CG  G+    +MC KC+               +H    +   
Sbjct: 4   ETSELENKPENKNMCKRGCGFYGSVRFKDMCSKCYQEHVKCDPTLEQAALVHSTSLDMPD 63

Query: 596 RSGFRRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENR---------SPPAKRE--- 453
               + L     SP+     D T ++ + T          R         +P A      
Sbjct: 64  SRKSQLLDCCEHSPN-----DCTTSQSDSTASSKLSGALKRKADPSDSTDTPKADLSTSR 118

Query: 452 ----VNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
               VNRCS CR++VGLTGF CRC  LFC  HRYSD+H+C+YDY+A GR  +AR NP
Sbjct: 119 PVLGVNRCSWCRKRVGLTGFTCRCDGLFCSLHRYSDQHECAYDYQANGRLELARANP 175



>sp|O76080|Z216_HUMAN Zinc finger protein 216.>gb:AF062072_1879940
           Homo sapiens zinc finger protein 216 (ZNF216) gene,
           complete cds.>gb:AF062346_1880185 Homo sapiens zinc
           finger protein 216 splice variant 1 (ZNF216) mRNA,
           complete cds.>gb:AF062347_1880186 Homo sapiens zinc
           finger protein 216 splice variant 2 (ZNF216) mRNA,
           complete cds.>gb:AL135924_1918773 Human DNA sequence
           from clone RP11-63P12 on chromosome 9q21.11-21.33
           Contains the ZNF216 gene for zinc finger protein 216, a
           novel gene (FLJ37891), an (NM23B) expressed in
           non-metastatic cells 2 (NME2) pseudogene, a novel gene,
           the 3' end of the GDA gene for guanine deaminase and a
           CpG island, complete sequence.>gb:BC011018_1972896 Homo
           sapiens zinc finger, A20 domain containing 2, mRNA (cDNA
           clone MGC:13526 IMAGE:4331933), complete
           cds.>gb:BC027707_1978943 Homo sapiens zinc finger, A20
           domain containing 2, mRNA (cDNA clone MGC:10350
           IMAGE:3945047), complete cds.>gb:BC073131_1989032 Homo
           sapiens zinc finger, A20 domain containing 2, mRNA (cDNA
           clone MGC:87987 IMAGE:6137219), complete cds.
          Length = 213

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 58/191 (30%), Positives = 76/191 (39%), Gaps = 45/191 (23%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCF-------------------------XXXXXXXXXXXXA 627
           LC   CG  GNP TN MC  C+                                     +
Sbjct: 13  LCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADTS 72

Query: 626 IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEK------------------TVX 501
           +++  G     S   R  P    P  ++  + +++R +K                  +V 
Sbjct: 73  LNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVS 132

Query: 500 XXXXXXENRSPPA--KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKA 327
                      P   K + NRC  CR+KVGLTGF CRCG LFCG HRYSD+H+C YDYKA
Sbjct: 133 QPSTSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKA 192

Query: 326 AGRDAIARENP 294
                I +ENP
Sbjct: 193 EAAAKIRKENP 203



>sp|O88878|Z216_MOUSE Zinc finger protein 216.>gb:AK076397_1171370
           Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732491G13
           product:zinc finger protein 216, full insert
           sequence.>gb:AF062071_2052906 Mus musculus zinc finger
           protein ZNF216 mRNA, complete cds.
          Length = 213

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 58/191 (30%), Positives = 75/191 (39%), Gaps = 45/191 (23%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCF-------------------------XXXXXXXXXXXXA 627
           LC   CG  GNP TN MC  C+                                      
Sbjct: 13  LCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADAG 72

Query: 626 IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEK------------------TVX 501
           +++  G     S   R  P    P  ++  + +++R +K                  +V 
Sbjct: 73  LNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVS 132

Query: 500 XXXXXXENRSPPA--KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKA 327
                      P   K + NRC  CR+KVGLTGF CRCG LFCG HRYSD+H+C YDYKA
Sbjct: 133 QPSSSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKA 192

Query: 326 AGRDAIARENP 294
                I +ENP
Sbjct: 193 EAAAKIRKENP 203



>gb:AB001773_1192659 Ciona savignyi pem-6 (posterior end mark 6)
           mRNA, complete cds.
          Length = 202

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 55/187 (29%), Positives = 73/187 (39%), Gaps = 44/187 (23%)
 Frame = -1

Query: 722 NNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPDLKR 543
           N CG  GN     MC  C+               +  G K P       SPE   P L  
Sbjct: 16  NGCGFYGNSKFEGMCSMCYKDTVQKK--------NNSGRKSPAVSISSKSPE--PPSLNE 65

Query: 542 REDRTVAR---------GEKTVXXXXXXXENRSP-------------------------- 468
           ++D +VA          G  T           +P                          
Sbjct: 66  KQDGSVANAMASLATNDGPNTTISATASPTGSTPISIPSATNPTTSLTSPSPKNSSFDEA 125

Query: 467 ---------PAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
                    P+K + NRC+ CR+++GLTGF CRCG++FC  HRYSD+H C +DYKA  + 
Sbjct: 126 STSFDSQSSPSKPKKNRCASCRKRLGLTGFYCRCGQIFCSLHRYSDQHSCDFDYKADAQA 185

Query: 314 AIARENP 294
            I +ENP
Sbjct: 186 KIRKENP 192



>gb:AE014297_1138630 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138631 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003682_1220623
           Drosophila melanogaster chromosome 3R, section 20 of 118
           of the complete sequence.>gb:AE003682_1220624 Drosophila
           melanogaster chromosome 3R, section 20 of 118 of the
           complete sequence.>gb:BT001732_1356505 Drosophila
           melanogaster RE70963 full insert cDNA.
          Length = 199

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 53/179 (29%), Positives = 73/179 (40%), Gaps = 33/179 (18%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXX-XXAIHHKFGEKQPRSGF---------- 585
           +C + CG  GNPAT+ +C  C+             +        QP   F          
Sbjct: 11  MCRSGCGFYGNPATDGLCSVCYKDSLRKKQQPPVSSTPVSVPSPQPSPTFSPAIAITNTA 70

Query: 584 ---------------RRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPP----- 465
                           +++ E  +      E  T A G  T                   
Sbjct: 71  QPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDD 130

Query: 464 --AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
             AK++ NRC  CR+KVGLTGF+CRCG L+C  HRYSD+H+C++DY+  G   I R NP
Sbjct: 131 KDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYREHGAQEIRRNNP 189



>gb:BC076427_2559264 Danio rerio cDNA clone MGC:101121
           IMAGE:7156667, complete cds.
          Length = 206

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 42/79 (53%), Positives = 50/79 (63%)
 Frame = -1

Query: 530 TVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRH 351
           TV+    +V         +S P K   NRC  CR+KVGLTGF CRCG+LFCG HRYSD H
Sbjct: 121 TVSASASSVSEQTSDEPEQSKPKK---NRCFTCRKKVGLTGFDCRCGQLFCGIHRYSDVH 177

Query: 350 DCSYDYKAAGRDAIARENP 294
            CS+DYKA   + I +ENP
Sbjct: 178 SCSFDYKADAAEKIRKENP 196



>gb:BC056712_2551905 Danio rerio wu:fb11b11, mRNA (cDNA clone
           IMAGE:6791371), partial cds.
          Length = 274

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 42/79 (53%), Positives = 50/79 (63%)
 Frame = -1

Query: 530 TVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRH 351
           TV+    +V         +S P K   NRC  CR+KVGLTGF CRCG+LFCG HRYSD H
Sbjct: 189 TVSASASSVSEQTSDEPEQSKPKK---NRCFTCRKKVGLTGFDCRCGQLFCGIHRYSDVH 245

Query: 350 DCSYDYKAAGRDAIARENP 294
            CS+DYKA   + I +ENP
Sbjct: 246 SCSFDYKADAAEKIRKENP 264



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 743 ETITLCVNNCGVTGNPATNNMCQKCF 666
           +T  LC N CG  GNP  N MC  C+
Sbjct: 49  QTQVLCSNGCGFYGNPRNNGMCSVCY 74



>gb:AY398314_2531844 Danio rerio clone RK065A2D12 protein associated
           with PRK1 (AWP1) mRNA, complete cds.
          Length = 232

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 42/79 (53%), Positives = 50/79 (63%)
 Frame = -1

Query: 530 TVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRH 351
           TV+    +V         +S P K   NRC  CR+KVGLTGF CRCG+LFCG HRYSD H
Sbjct: 147 TVSASASSVSEQTSDEPEQSKPKK---NRCFTCRKKVGLTGFDCRCGQLFCGIHRYSDVH 203

Query: 350 DCSYDYKAAGRDAIARENP 294
            CS+DYKA   + I +ENP
Sbjct: 204 SCSFDYKADAAEKIRKENP 222



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = -1

Query: 743 ETITLCVNNCGVTGNPATNNMCQKCF 666
           +T  LC N CG  GNP  N MC  C+
Sbjct: 7   QTQVLCSNGCGFYGNPRNNGMCSVCY 32



>gb:AP005840_1858859 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0050F10.
          Length = 152

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 52/148 (35%), Positives = 69/148 (46%), Gaps = 2/148 (1%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPERTSPD 552
           +C   CG  G+ AT+ +C KC+                K  + QPR      + +     
Sbjct: 17  MCAAGCGFFGSAATDGLCSKCY----------------KQQQPQPRHLIGTAAGDSDKTS 60

Query: 551 LKRREDRTVARGEKTVXXXXXXXENRSPPAK--REVNRCSGCRRKVGLTGFRCRCGELFC 378
           LK   D +    +             +PPA   +  NRC  CR+KVGL GF CRCG +FC
Sbjct: 61  LKVVADLSTLVIKDNSGVGGEGTTVMAPPATVTKAKNRCKACRKKVGLLGFPCRCGGMFC 120

Query: 377 GEHRYSDRHDCSYDYKAAGRDAIARENP 294
           G H       C++DYKAAGR+AIAR NP
Sbjct: 121 GAHA------CAFDYKAAGREAIARHNP 142



>gb:DME421016_1379255 Drosophila melanogaster partial mRNA for
           hypothetical protein.
          Length = 206

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 53/179 (29%), Positives = 72/179 (40%), Gaps = 33/179 (18%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXXXXXX-XXAIHHKFGEKQPRSGF---------- 585
           +C + CG  GNPAT+ +C  C+             +        QP   F          
Sbjct: 11  MCRSGCGFYGNPATDGLCSVCYKDSLSKKQQPPVSSTPVSVPSPQPSPTFSPAIAITNTA 70

Query: 584 ---------------RRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPP----- 465
                           +++ E  +      E  T A G  T                   
Sbjct: 71  QPTVTSLQQPHNDVKEKITEEAAAAAKVNSEAITSATGPNTSTQAAASANEEDDKDKEDD 130

Query: 464 --AKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
             AK++ NRC  CR+KVGLTGF+CRCG L+C  HRYSD+H+C++DY   G   I R NP
Sbjct: 131 KDAKKKKNRCGECRKKVGLTGFQCRCGGLYCAVHRYSDKHNCTFDYSEHGAQEIRRNNP 189



>gb:AP005840_1858858 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0050F10.
          Length = 154

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 38/62 (61%), Positives = 47/62 (75%), Gaps = 2/62 (3%)
 Frame = -1

Query: 473 SPPAK--REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARE 300
           +PPA   +  NRC  CR+KVGL GF CRCG +FCG HR++  H CS+DYKAAGR+ IAR+
Sbjct: 83  APPATATKAKNRCEACRKKVGLLGFPCRCGGMFCGAHRHAGAHACSFDYKAAGREVIARQ 142

Query: 299 NP 294
           NP
Sbjct: 143 NP 144



>gb:BC050491_2550375 Danio rerio zinc finger, A20 domain containing
           2, like, mRNA (cDNA clone MGC:56057 IMAGE:3820477),
           complete cds.
          Length = 212

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 37/56 (66%), Positives = 42/56 (75%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K + NRC  CR+KVGLTGF CRCG LFCG HRYSD+H+C YDYKA     I +ENP
Sbjct: 147 KPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENP 202



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNQSPVP---MLCATGCGFYGNPRTNGMCSVCY 34



>gb:BC081266_2562158 Xenopus laevis MGC86388 protein, mRNA (cDNA
           clone MGC:86388 IMAGE:7011207), complete cds.
          Length = 211

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 36/56 (64%), Positives = 42/56 (75%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K + NRC  CR+K+GLTGF CRCG LFCG HRYSD+H+C YDYKA     I +ENP
Sbjct: 146 KPKKNRCFMCRKKIGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENP 201



 Score = 33.5 bits (75), Expect = 5.3
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCF 666
           LC   CG  GNP TN MC  C+
Sbjct: 13  LCNTGCGFYGNPRTNGMCSVCY 34



>gb:BC076851_2559592 Xenopus laevis zinc finger, A20 domain
           containing 2, mRNA (cDNA clone MGC:84480 IMAGE:3403542),
           complete cds.
          Length = 211

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 36/56 (64%), Positives = 42/56 (75%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K + NRC  CR+K+GLTGF CRCG LFCG HRYSD+H+C YDYKA     I +ENP
Sbjct: 146 KPKKNRCFMCRKKIGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENP 201



 Score = 33.5 bits (75), Expect = 5.3
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCF 666
           LC   CG  GNP TN MC  C+
Sbjct: 13  LCNTGCGFYGNPRTNGMCSVCY 34



>gb:AF261138_1893500 Homo sapiens HT032 mRNA, complete
           cds.>gb:BC005283_1969740 Homo sapiens zinc finger, A20
           domain containing 3, mRNA (cDNA clone MGC:12336
           IMAGE:4042180), complete cds.>gb:HSA251095_2001623 Homo
           sapiens mRNA for PRK1-associated protein AWP1 (AWP1
           gene).
          Length = 208

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 59/199 (29%), Positives = 74/199 (37%), Gaps = 40/199 (20%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIH---------- 621
           +ET    VP    LC   CG  GNP TN MC  C+             I           
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLS 59

Query: 620 ----------------------HKFGEKQPRSGFRRLSPERTSPDLKRRE-DRTVARGEK 510
                                     +  P S    LS    S  L     D+ V   E 
Sbjct: 60  ESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETED 119

Query: 509 TVXXXXXXXENRSPPAKREVNR-------CSGCRRKVGLTGFRCRCGELFCGEHRYSDRH 351
                    +  S    + + +       C  CR+KVGLTGF CRCG ++CG HRYSD H
Sbjct: 120 VQASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVH 179

Query: 350 DCSYDYKAAGRDAIARENP 294
           +CSY+YKA   + I +ENP
Sbjct: 180 NCSYNYKADAAEKIRKENP 198



>gb:CR860033_1184129 Pongo pygmaeus mRNA; cDNA DKFZp459F1624 (from
           clone DKFZp459F1624).
          Length = 208

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 35/56 (62%), Positives = 44/56 (78%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K++ NRC  CR+KVGLTGF CRCG ++CG HRYSD H+CSY+YKA   + I +ENP
Sbjct: 143 KQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENP 198



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:AK002775_1151435 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610037K16
           product:associated with Prkcl1, full insert
           sequence.>gb:BC010683_2091054 Mus musculus zinc finger,
           A20 domain containing 3, mRNA (cDNA clone MGC:6494
           IMAGE:2647905), complete cds.>gb:BC076394_2106759 Rattus
           norvegicus protein associated with PRK1, mRNA (cDNA
           clone MGC:94805 IMAGE:7107784), complete cds.
          Length = 223

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 35/56 (62%), Positives = 44/56 (78%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K++ NRC  CR+KVGLTGF CRCG ++CG HRYSD H+CSY+YKA   + I +ENP
Sbjct: 158 KQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENP 213



 Score = 34.3 bits (77), Expect = 3.1
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET     P    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQAP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:AF188206_1249210 Strongyloides stercoralis IgG-immunoreactive
           zinc finger protein mRNA, complete cds.
          Length = 211

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 33/56 (58%), Positives = 41/56 (73%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+ VNRC  C++KVGLTGF CRCG L+C  HRY   HDCS+DY+   R+ IA+ NP
Sbjct: 146 KKTVNRCGMCKKKVGLTGFTCRCGGLYCSTHRYDSAHDCSFDYRTTEREQIAKNNP 201



>pir|T10218|T10218 hypothetical protein T30C3.50 - Arabidopsis
           thaliana>gb:ATCHRIV63_1546420 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 63.>gb:ATT30C3_1555787
           Arabidopsis thaliana DNA chromosome 4, BAC clone T30C3
           (ESSA project).
          Length = 130

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 48/154 (31%), Positives = 67/154 (43%), Gaps = 1/154 (0%)
 Frame = -1

Query: 752 VVPETITL-CVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRL 576
           +V ET  L C   CG+ G    NN+C  C+              H      +P +   + 
Sbjct: 1   MVNETEALPCEGGCGLYGTRVNNNLCSLCYKKSVLQ--------HSPALRFEPETEQSQC 52

Query: 575 SPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFRCR 396
            P   SP ++                          P K+   RC  C+RKVG+ GF+CR
Sbjct: 53  CPPTNSPAVEEE------------------------PVKKR--RCGICKRKVGMLGFKCR 86

Query: 395 CGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CG +FCG HRY + H C +DYK +GR A+A + P
Sbjct: 87  CGHMFCGSHRYPEEHSCPFDYKQSGRLALATQLP 120



>gb:MMU251508_2119831 Mus musculus mRNA for AWP1 protein (Awp1
           gene).
          Length = 223

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 34/56 (60%), Positives = 43/56 (76%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K++ NRC  CR+KVGLTGF CRCG ++CG HR SD H+CSY+YKA   + I +ENP
Sbjct: 158 KQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRSSDVHNCSYNYKADAAEKIRKENP 213



 Score = 34.3 bits (77), Expect = 3.1
 Identities = 15/35 (42%), Positives = 17/35 (48%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET     P    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQAP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:HSM801572_1186266 Homo sapiens mRNA; cDNA DKFZp564F2116 (from
           clone DKFZp564F2116).
          Length = 208

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 34/56 (60%), Positives = 43/56 (76%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K++ NRC  CR+KVGLTGF CRCG ++CG HRYSD  +CSY+YKA   + I +ENP
Sbjct: 143 KQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVLNCSYNYKADAAEKIRKENP 198



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCY 34



>pir|T21254|T21254 hypothetical protein F22D6.2 - Caenorhabditis
           elegans>gb:CEF22D6_1362825 Caenorhabditis elegans cosmid
           F22D6, complete sequence.
          Length = 189

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/174 (27%), Positives = 66/174 (37%), Gaps = 24/174 (13%)
 Frame = -1

Query: 743 ETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXAIHHKFGEKQPRSGFRRLSPER 564
           +T   C   CG  G  AT   C +CF                        +    L  E 
Sbjct: 9   QTAPSCRAGCGFFGASATEGYCSQCFKNTLKRQQDTVRLTSPVVSPSSMAATSSALKSEP 68

Query: 563 TSPDLKRR------------------------EDRTVARGEKTVXXXXXXXENRSPPAKR 456
           +S D+  +                         D +V   E T            P   +
Sbjct: 69  SSVDMCMKAAVSVSDETAKMDCEDIINVCDQINDDSVTVAESTAPTTITVDV---PVPVK 125

Query: 455 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           + NRC  C+++VGLTGF CRCG L+CG+HRY   H+C +DYK   R+ I + NP
Sbjct: 126 KANRCHMCKKRVGLTGFSCRCGGLYCGDHRYDQAHNCQFDYKTMERETIRKNNP 179



>gb:CR533476_1993681 Homo sapiens full open reading frame cDNA clone
           RZPDo834A0817D for gene AWP1, protein associated with
           PRK1; complete cds, incl. stopcodon.
          Length = 208

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 33/56 (58%), Positives = 43/56 (76%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K++ NRC  CR+KVGLTGF CRCG ++CG HRYSD  +CSY+YKA   + I +E+P
Sbjct: 143 KQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVLNCSYNYKADAAEKIRKEDP 198



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:PFMAL8P1_1192154 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 191

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 44/178 (24%), Positives = 71/178 (39%), Gaps = 22/178 (12%)
 Frame = -1

Query: 764 TEFKVVPETITLCVNNCGVTGNPATNNMCQKCFXXXXXXXXXXXXA-------------- 627
           +E      T  LC NNCG  GNPA NN+C KC+                           
Sbjct: 3   SEKNATTPTPILCENNCGFYGNPANNNLCSKCYREFQEKKKKEISEGEKMNDKNMNDTLN 62

Query: 626 -IHHKFGEKQPRSGFRRLSPERTSPDLKRREDRTVARGEKT-------VXXXXXXXENRS 471
             ++K  E    +       E       + E+ ++   E+        V       ++ S
Sbjct: 63  NYNNKISEIIEPTFVNEKQTENEKNSYIKEENSSIINNEQNKESEMQPVTLDNTEEKDNS 122

Query: 470 PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN 297
                + ++C  C +++GL G +CRC   FC  HRY+D H+C++DYK   +  + + N
Sbjct: 123 SQPVEDKSKCFFCSKRIGLVGIKCRCNHYFCSLHRYADAHNCTFDYKNYHKQQLIKNN 180



>gb:AY429441_1605844 Gossypium barbadense fiber protein Fb37 mRNA,
           complete cds.
          Length = 137

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 43/134 (32%), Positives = 56/134 (41%), Gaps = 11/134 (8%)
 Frame = -1

Query: 731 LCVNNCGVTGNPATNNMCQKCFXXXXXX---XXXXXXAIHHKF--------GEKQPRSGF 585
           LC NNCG  G+P T N+C +C+               A +H               RS F
Sbjct: 12  LCANNCGFFGSPTTQNLCSECYRGLQLKEQQSSSAKQAFNHTLVPSSSSLPSSSSARSSF 71

Query: 584 RRLSPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGF 405
               P +  P    +E + V   E  V                  NRC  C+++VGLTGF
Sbjct: 72  SASLPAKEEPSAGTKETKVVEEEEVQVTP----------------NRCLSCKKRVGLTGF 115

Query: 404 RCRCGELFCGEHRY 363
           +CRCG +FCG HRY
Sbjct: 116 KCRCGMVFCGIHRY 129



>gb:AE014298_1124925 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003446_1210107 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete sequence.
          Length = 162

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 1/52 (1%)
 Frame = -1

Query: 446 RCSGCRRKVGLTG-FRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           RC  C +K+G+TG F CRCG  +C  HRYSDRH+C++DY+  G   I R+NP
Sbjct: 101 RCDKCGKKLGITGGFPCRCGGTYCAVHRYSDRHECNFDYRQMGAIQIRRDNP 152



>gb:XELUBILFPA_2582263 Xenopus laevis ubiquitin-like fusion protein
           mRNA, complete cds.
          Length = 693

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+    C  C +K GL T F CRCG  FC  HRY++ HDC+YDYK  GR  +   NP
Sbjct: 627 KKTAKHCFVCGKKTGLATSFECRCGNNFCAAHRYAETHDCTYDYKTMGRRLLTEANP 683



>gb:BC080990_2561901 Xenopus laevis ubiquitin-like fusion protein,
           mRNA (cDNA clone MGC:79980 IMAGE:3399400), complete cds.
          Length = 701

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 29/57 (50%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+    C  C +K GL T F CRCG  FC  HRYS+ HDC+YDYK  GR  +   NP
Sbjct: 635 KKTTKHCFVCGKKTGLATSFECRCGNNFCAAHRYSETHDCTYDYKTVGRRLLQVANP 691



>gb:BC046649_2549642 Xenopus laevis similar to testis-specific gene
           including a ubiquitin-likely domain, mRNA (cDNA clone
           MGC:52567 IMAGE:5542398), complete cds.
          Length = 693

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+    C  C +K GL T F CRCG  FC  HRY++ HDC+YDYK  GR  +   NP
Sbjct: 627 KKTAKHCFVCGKKTGLATSFECRCGNNFCAAHRYAETHDCTYDYKTMGRRLLTEANP 683



>pir|JN0673|JN0673 ubiquitin-like fusion protein An1a - African
           clawed frog
          Length = 693

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+    C  C +K GL T F CRCG  FC  HRY++ HDC+YDYK  GR  +   NP
Sbjct: 627 KKTAKHCFVCGKKTGLATSFECRCGNNFCAAHRYAETHDCTYDYKTMGRRLLTEANP 683



>pir|JN0674|JN0674 ubiquitin-like fusion protein An1b - African
           clawed frog>gb:XELUBILFPB_2582264 Xenopus laevis
           ubiquitin-like fusion protein mRNA, complete cds.
          Length = 701

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 28/57 (49%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+    C  C +K GL T F CRCG  FC  HRY++ HDC+YDYK  GR  +   NP
Sbjct: 635 KKTTKHCFVCGKKTGLATSFECRCGNNFCAAHRYAETHDCTYDYKTVGRRLLQVANP 691



>gb:BC048968_1984183 Homo sapiens AN1, ubiquitin-like, homolog
           (Xenopus laevis), mRNA (cDNA clone MGC:57202
           IMAGE:5272133), complete cds.
          Length = 653

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+  N C  C +K GL + + CRCG  FC  HRY++ H C+YDYK+AGR  +   NP
Sbjct: 587 KKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANP 643



>gb:BC045587_1983585 Homo sapiens AN1, ubiquitin-like, homolog
           (Xenopus laevis), mRNA (cDNA clone IMAGE:5269483),
           partial cds.
          Length = 811

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+  N C  C +K GL + + CRCG  FC  HRY++ H C+YDYK+AGR  +   NP
Sbjct: 745 KKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANP 801



>gb:AL445201_1927381 Human DNA sequence from clone RP11-358L16 on
           chromosome 10 Contains a AFR GTPase-activating protein
           (MRIP2) pseudogene, a novel gene, gene LOC93550, the 3'
           end of a KIAA0592 pseudogene and three CpG islands,
           complete sequence.
          Length = 609

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+  N C  C +K GL + + CRCG  FC  HRY++ H C+YDYK+AGR  +   NP
Sbjct: 543 KKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANP 599



>gb:AL445201_1927380 Human DNA sequence from clone RP11-358L16 on
           chromosome 10 Contains a AFR GTPase-activating protein
           (MRIP2) pseudogene, a novel gene, gene LOC93550, the 3'
           end of a KIAA0592 pseudogene and three CpG islands,
           complete sequence.
          Length = 727

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+  N C  C +K GL + + CRCG  FC  HRY++ H C+YDYK+AGR  +   NP
Sbjct: 661 KKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANP 717



>gb:AF311324_1896255 Homo sapiens ubiquitin-like fusion protein
           mRNA, complete cds.
          Length = 727

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 461 KREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           K+  N C  C +K GL + + CRCG  FC  HRY++ H C+YDYK+AGR  +   NP
Sbjct: 661 KKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANP 717



>gb:S77733_1444479 EST00848 homolog {clone A2} [cattle, endothelial
           cells, mRNA Partial, 158 nt].
          Length = 46

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = -1

Query: 401 CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CRCG LFCG HRYSD+H+C YDYKA     I +ENP
Sbjct: 1   CRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENP 36



>pir|I47035|I47035 ubiquitin homolog - bovine (fragment)
          Length = 46

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 24/36 (66%), Positives = 27/36 (75%)
 Frame = -1

Query: 401 CRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           CRCG LFCG HRYSD+H+C YDYKA     I +ENP
Sbjct: 1   CRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENP 36



>gb:AP003288_1827356 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0683B11.>gb:AP003453_1829697 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0480C01.
          Length = 236

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 1/60 (1%)
 Frame = -1

Query: 470 PPAKREVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKA-AGRDAIARENP 294
           PP  +  +RC+ C R+VGL GF CRCG +FCG H    +       +  AGRDAIAR NP
Sbjct: 167 PPRAKTKSRCAACGRRVGLMGFECRCGAVFCGAHPLLGQARLWLRLQGRAGRDAIARANP 226



>gb:CNS07EGB_1373097 chromosome IV of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 156

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 20/51 (39%), Positives = 33/51 (64%), Gaps = 1/51 (1%)
 Frame = -1

Query: 443 CSGCRRKVGLTG-FRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIARENP 294
           C  C +++ LT  + CRCG ++C  HR+ D+H C++DYKA     ++ +NP
Sbjct: 96  CGKCGKRLKLTNNYSCRCGNVYCIRHRFYDQHSCTFDYKAIAIPKLSAQNP 146



>pir|T18125|T18125 hypothetical protein A623L - Chlorella virus
           PBCV-1>gb:PBU42580_2446080 Paramecium bursaria Chlorella
           virus 1, complete genome.
          Length = 67

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 18/37 (48%), Positives = 25/37 (67%)
 Frame = -1

Query: 455 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDC 345
           +++RC  CR+K GL GF C+CG  FC +HR  + H C
Sbjct: 8   QMSRCEICRKKTGLLGFVCKCGHTFCEKHRLMESHSC 44



>gb:BC081022_2561931 Xenopus laevis MGC81636 protein, mRNA (cDNA
           clone MGC:81636 IMAGE:6864131), complete cds.
          Length = 226

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 4/91 (4%)
 Frame = -1

Query: 575 SPERTSPDL-KRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFR- 402
           +P + S D   + ED T       +       +N S   ++   RC  C+ K+ L     
Sbjct: 111 TPSKRSCDSDSQSEDDTSPMKRPRLLDSGDRPDNSSRSKQKSRRRCFRCQIKLELVQQEL 170

Query: 401 --CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
             CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 171 GSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 201



>gb:BC034396_2097657 Mus musculus testis expressed gene 27, mRNA
           (cDNA clone MGC:36268 IMAGE:3707476), complete
           cds.>gb:BC083124_2108529 Mus musculus testis expressed
           gene 27, mRNA (cDNA clone MGC:103362 IMAGE:6334368),
           complete cds.
          Length = 205

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 42/163 (25%), Positives = 57/163 (34%), Gaps = 29/163 (17%)
 Frame = -1

Query: 716 CGVTGNPATNNMCQKCFXXXXX------XXXXXXXAIHHKFGEKQPRSGFRR------LS 573
           CG  G+  T N+C KCF                  +    F E+              LS
Sbjct: 20  CGFWGSSKTMNLCSKCFADFQKKQPDDDSTPSTSNSQSDLFSEETTSDNNNTSVTTPTLS 79

Query: 572 PER---------TSPDLKR-----REDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSG 435
           P +         TSP  +       E   V R              RS    R   RC  
Sbjct: 80  PSQQSLPTELNVTSPSTEEYSQSENEASPVKRPRLVENPERPEESGRSKQKSRR--RCFQ 137

Query: 434 CRRKVGLTGFR---CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
           C+ K+ L       CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 138 CQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 180



>gb:AL133377_1918436 Human DNA sequence from clone RP1-295F6 on
           chromosome 6 Contains the 3' end of the TEX27 gene for
           testis expressed sequence 27 (FLJ13222) and a novel
           gene, complete sequence.>gb:AL589655_1929085 Human DNA
           sequence from clone RP11-420A21 on chromosome 6 Contains
           a pseudogene similar to an integrin Alpha-E precursor
           fragment and part of the TEX27 gene for testis expressed
           sequence 27 (FLJ13222), complete
           sequence.>gb:HSJ441A12_2016131 Human DNA sequence from
           clone RP3-441A12 on chromosome 6 Contains a novel gene,
           the 5' end of the TEX27 gene for testis expressed
           sequence 27 (FLJ13222) and a CpG island, complete
           sequence.
          Length = 228

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -1

Query: 575 SPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFR-- 402
           S    SP  + R      R E+T         +RS    R   RC  C+ K+ L      
Sbjct: 125 SENEASPVKRPRLLENTERSEET---------SRSKQKSRR--RCFQCQTKLELVQQELG 173

Query: 401 -CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
            CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 174 SCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 203



>gb:AX882790_1479087 Sequence 17695 from Patent
           EP1074617.>gb:AK023284_1909575 Homo sapiens cDNA
           FLJ13222 fis, clone NT2RP4002083.>gb:BC031481_1980150
           Homo sapiens testis expressed sequence 27, mRNA (cDNA
           clone MGC:21038 IMAGE:4448968), complete cds.
          Length = 227

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/90 (32%), Positives = 41/90 (45%), Gaps = 3/90 (3%)
 Frame = -1

Query: 575 SPERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTGFR-- 402
           S    SP  + R      R E+T         +RS    R   RC  C+ K+ L      
Sbjct: 124 SENEASPVKRPRLLENTERSEET---------SRSKQKSRR--RCFQCQTKLELVQQELG 172

Query: 401 -CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
            CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 173 SCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 202



>gb:BC085956_2109508 Rattus norvegicus testis expressed gene 27
           (predicted), mRNA (cDNA clone MGC:95308 IMAGE:7134959),
           complete cds.
          Length = 227

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)
 Frame = -1

Query: 446 RCSGCRRKVGLTGFR---CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
           RC  C+ K+ L       CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 156 RCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 202



>gb:BC027161_2095791 Mus musculus testis expressed gene 27, mRNA
           (cDNA clone IMAGE:4950648), partial cds.
          Length = 188

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)
 Frame = -1

Query: 446 RCSGCRRKVGLTGFR---CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
           RC  C+ K+ L       CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 117 RCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 163



>gb:BC024483_2094540 Mus musculus testis expressed gene 27, mRNA
           (cDNA clone IMAGE:4977565), partial cds.
          Length = 142

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 3/47 (6%)
 Frame = -1

Query: 446 RCSGCRRKVGLTGFR---CRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
           RC  C+ K+ L       CRCG +FC  HR  ++HDC++D+   GR+
Sbjct: 71  RCFQCQTKLELVQQELGSCRCGYVFCMLHRLPEQHDCTFDHMGRGRE 117



>pir|S43586|S43586 F26F3.4 protein (clone F26F3) - Caenorhabditis
           elegans>gb:CEF56F3_1364599 Caenorhabditis elegans cosmid
           F56F3, complete sequence.
          Length = 341

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)
 Frame = -1

Query: 446 RCSGCRRKVGLTG--FRCRCGELFCGEHRYSDRHDCSYDYKAAGRDAIAREN 297
           +C+ C +K+        C+C  +FC  HR+   H C  DYK  GR+ + + N
Sbjct: 275 KCNTCFKKLSAAQQTMHCKCLRIFCDRHRHPKNHTCVIDYKQDGRNKLKKNN 326



>pir|B69398|B69398 hypothetical protein AF1187 - Archaeoglobus
           fulgidus>gb:AE001022_30719 Archaeoglobus fulgidus DSM
           4304 section 85 of 172 of the complete
           genome.>gb:AE000782_975073 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 449

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -1

Query: 446 RCSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDC 345
           +C  C +KV L  FRC  CG LFC +HR   +H+C
Sbjct: 3   KCDFCGKKVDLP-FRCNYCGSLFCEDHRLPPKHNC 36



>gb:BC011495_2091459 Mus musculus RIKEN cDNA 1110060O18 gene, mRNA
           (cDNA clone MGC:19093 IMAGE:4196340), complete cds.
          Length = 257

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
 Frame = -1

Query: 476 RSPPAKRE----VNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS---YDYKAA 324
           RS PA+++     N+C  SGCR++  +     RCG  FC +HR+   H+CS   +    A
Sbjct: 85  RSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRA 144

Query: 323 GRDAIAR 303
           G  AI+R
Sbjct: 145 GLAAISR 151



>gb:AK004332_1152317 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110060O18
           product:weakly similar to ARSENITE INDUCIBLE RNA
           ASSOCIATED PROTEIN [Mus musculus], full insert sequence.
          Length = 257

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
 Frame = -1

Query: 476 RSPPAKRE----VNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS---YDYKAA 324
           RS PA+++     N+C  SGCR++  +     RCG  FC +HR+   H+CS   +    A
Sbjct: 85  RSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRA 144

Query: 323 GRDAIAR 303
           G  AI+R
Sbjct: 145 GLAAISR 151



>pir|C69376|C69376 conserved hypothetical protein AF1011 -
           Archaeoglobus fulgidus>gb:AE001034_30898 Archaeoglobus
           fulgidus DSM 4304 section 73 of 172 of the complete
           genome.>gb:AE000782_974900 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 330

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = -1

Query: 452 VNRCSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDC 345
           V RC  C  +V +  F+C+ CG  FC EHR  + HDC
Sbjct: 63  VARCDVCGEEVTIP-FKCKYCGGTFCAEHRLPENHDC 98



>gb:CEY39A1A_1369758 Caenorhabditis elegans YAC Y39A1A, complete
           sequence.
          Length = 545

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = -1

Query: 791 MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCF 666
           M+ K G+E+ + K+ +     LCVN CG  G P   N C KC+
Sbjct: 29  MSDKHGEEDKKAKMHLKANDLLCVNGCGFYGTPQWENRCSKCW 71



>pir|T26727|T26727 hypothetical protein Y39A1A.4 - Caenorhabditis
           elegans
          Length = 161

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = -1

Query: 791 MAQKTGKEETEFKV-VPETITLCVNNCGVTGNPATNNMCQKCF 666
           M+ K G+E+ + K+ +     LCVN CG  G P   N C KC+
Sbjct: 29  MSDKHGEEDKKAKMHLKANDLLCVNGCGFYGTPQWENRCSKCW 71



>gb:AF061739_1879912 Homo sapiens unknown mRNA.
          Length = 186

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:AX885979_1481432 Sequence 1842 from Patent EP1033401.
          Length = 87

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNHSQVP---MLCSTGCGFYGNPRTNGMCSVCY 34



>gb:BC018415_1976504 Homo sapiens hypothetical protein BC018415,
           mRNA (cDNA clone MGC:17236 IMAGE:3864137), complete cds.
          Length = 257

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 9/67 (13%)
 Frame = -1

Query: 476 RSPPAKRE----VNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS---YDYKAA 324
           RS PA+++     N+C  +GCR++  +     RC   FC +HR+   HDCS   +    A
Sbjct: 85  RSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRA 144

Query: 323 GRDAIAR 303
           G  AI+R
Sbjct: 145 GLAAISR 151



>gb:AL135924_1918772 Human DNA sequence from clone RP11-63P12 on
           chromosome 9q21.11-21.33 Contains the ZNF216 gene for
           zinc finger protein 216, a novel gene (FLJ37891), an
           (NM23B) expressed in non-metastatic cells 2 (NME2)
           pseudogene, a novel gene, the 3' end of the GDA gene for
           guanine deaminase and a CpG island, complete sequence.
          Length = 211

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 18/44 (40%), Positives = 20/44 (45%)
 Frame = -1

Query: 797 LRMAQKTGKEETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           L   QK   +ET     P    LC   CG  GNP TN MC  C+
Sbjct: 46  LHSTQKNMAQETNQTPGP---MLCSTGCGFYGNPRTNGMCSVCY 86



>gb:AK091345_1913458 Homo sapiens cDNA FLJ34026 fis, clone
           FCBBF2003543, moderately similar to Mus musculus
           arsenite inducible RNA associated protein (Airap) mRNA.
          Length = 176

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 9/67 (13%)
 Frame = -1

Query: 476 RSPPAKRE----VNRC--SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCS---YDYKAA 324
           RS PA+++     N+C  +GCR++  +     RC   FC +HR+   HDCS   +    A
Sbjct: 85  RSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRA 144

Query: 323 GRDAIAR 303
           G  AI+R
Sbjct: 145 GLAAISR 151



>gb:BC066741_2554578 Danio rerio zgc:77486, mRNA (cDNA clone
           MGC:77486 IMAGE:6524432), complete cds.
          Length = 238

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 16/35 (45%), Positives = 18/35 (51%)
 Frame = -1

Query: 770 EETEFKVVPETITLCVNNCGVTGNPATNNMCQKCF 666
           +ET    VP    LC   CG  GNP TN MC  C+
Sbjct: 3   QETNQTQVP---MLCTMGCGFYGNPRTNGMCSVCY 34



 Score = 33.1 bits (74), Expect = 6.9
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = -1

Query: 569 ERTSPDLKRREDRTVARGEKTVXXXXXXXENRSPPAKREVNRCSGCRRKVGLTG 408
           +R   + +  E  + + G            +++P   ++ NRC  CR+KVGLTG
Sbjct: 114 DRAEVEEEEEEGSSKSTGPVGEAAQASSDGDQTPDKNKKKNRCFTCRKKVGLTG 167



>gb:AE014134_1127355 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003579_1216209 Drosophila melanogaster
           chromosome 2L, section 12 of 83 of the complete
           sequence.
          Length = 206

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
 Frame = -1

Query: 476 RSPPAKREVNRCS--GCRRK--VGLTGFRCRCGELFCGEHRYSDRHDC 345
           +S   K   NRC+  GC+RK  + +T  +CR    FC  HR++  HDC
Sbjct: 85  KSESKKIYTNRCNAKGCKRKELIPVTCSQCRLN--FCLRHRHTSDHDC 130



>gb:BC055589_2551453 Danio rerio zgc:66295, mRNA (cDNA clone
           MGC:66295 IMAGE:5413036), complete
           cds.>gb:BC065896_2554186 Danio rerio zgc:66295, mRNA
           (cDNA clone MGC:77923 IMAGE:7000569), complete cds.
          Length = 282

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%)
 Frame = -1

Query: 476 RSPPAKRE----VNRCS--GCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGRD 315
           +S PA+R+     N+CS  GC++K  +     +C   +C +HR+   HDC  D K   + 
Sbjct: 85  KSDPAQRKRKIFTNKCSKGGCKQKEMIRVTCDQCHLNYCLKHRHPLDHDCKTDNKPVSKS 144

Query: 314 AIA 306
             A
Sbjct: 145 GHA 147



>gb:AF204951_2214169 Ectocarpus siliculosus virus, complete genome.
          Length = 81

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
 Frame = -1

Query: 464 AKREVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDC 345
           +K+   RC  C+ ++ +  G  C C  L C +HRY   H C
Sbjct: 21  SKKTARRCHVCKARLKIHEGKLCSCSMLLCMKHRYKADHFC 61



>gb:AY596297_632141 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 314

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = -1

Query: 452 VNRCSGCRRKVGLTGFRC-RCGELFCGEHRYSDRHDC 345
           ++ C  C ++  +  ++C  CG  +C EHR  + HDC
Sbjct: 1   MSECDACGKQENMP-YQCGHCGGTYCAEHRLPEAHDC 36



>pir|E69431|E69431 hypothetical protein AF1454 - Archaeoglobus
           fulgidus>gb:AE001002_30445 Archaeoglobus fulgidus DSM
           4304 section 105 of 172 of the complete
           genome.>gb:AE000782_975337 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 286

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 5/46 (10%)
 Frame = -1

Query: 467 PAKREVNR----CSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDC 345
           P K+ + +    C  C ++  L  ++C  CG  FCGEH    +HDC
Sbjct: 212 PYKKSITKLFANCHKCGKREYLP-YQCNYCGNYFCGEHILPPKHDC 256


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 589,463,721
Number of Sequences: 1806583
Number of extensions: 9970435
Number of successful extensions: 29015
Number of sequences better than 10.0: 100
Number of HSP's better than 10.0 without gapping: 27746
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28989
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57913030826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)