BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2687
         (1039 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY072823_1567407 Gossypium hirsutum fiddlehead-like protein (...   346   7e-97   
gb:AMA310739_1819158 Antirrhinum majus afi gene for putative bet...   344   3e-95   
gb:AY206684_1589529 Tropaeolum majus fiddlehead-like protein mRN...   340   1e-94   
gb:AC126223_1740538 Oryza sativa (japonica cultivar-group) chrom...   330   3e-91   
gb:AF214501S2_1777844 Arabidopsis thaliana fiddlehead protein (f...   317   2e-87   
pir|B84658|B84658 beta-ketoacyl-CoA synthase (FIDDLEHEAD) [impor...   317   2e-87   Arabidopsis thaliana [mouse-ear cress]
gb:AF214503S2_1777845 Arabidopsis thaliana fiddlehead protein (f...   315   5e-87   
gb:AF214495S2_1777841 Arabidopsis thaliana fiddlehead protein (f...   314   1e-86   
gb:AX155071_1462774 Sequence 117 from Patent WO0138484.               291   1e-78   
pir|F86327|F86327 protein F18O14.21 [imported] - Arabidopsis tha...   289   6e-78   Arabidopsis thaliana [mouse-ear cress]
gb:AC120986_1740004 Oryza sativa (japonica cultivar-group) chrom...   288   1e-77   
gb:AY308831_1597852 Marchantia polymorpha FAE1 gene, complete cds.    285   5e-77   
gb:AY183914_1587918 Marchantia polymorpha beta-ketoacyl-CoA-synt...   284   3e-76   
gb:AY308830_1597851 Marchantia polymorpha FAE3 gene, complete cds.    284   6e-76   
pir|T00951|T00951 probable 3-oxoacyl-[acyl-carrier-protein] synt...   280   1e-75   Arabidopsis thaliana [mouse-ear cress]
gb:BT015917_1642535 Arabidopsis thaliana At1g04220 gene, complet...   280   1e-75   
gb:AC098832_1736894 Oryza sativa (japonica cultivar-group) chrom...   280   1e-75   
pir|F84538|F84538 probable beta-ketoacyl-CoA synthase [imported]...   281   5e-75   Arabidopsis thaliana [mouse-ear cress]
gb:AY074518_1567567 Arabidopsis thaliana putative beta-ketoacyl-...   278   6e-75   
gb:AY070727_1566879 Arabidopsis thaliana At1g68530/T26J14_10 mRN...   281   6e-75   
pir|T52308|T52308 very-long-chain fatty acid condensing enzyme C...   281   6e-75   Arabidopsis thaliana [mouse-ear cress]
gb:AY087518_1572548 Arabidopsis thaliana clone 36276 mRNA, compl...   281   6e-75   
gb:AY035030_1559808 Arabidopsis thaliana putative beta-ketoacyl-...   276   2e-74   
gb:AB026651_1517270 Arabidopsis thaliana genomic DNA, chromosome...   276   2e-74   
pir|T05271|T05271 probable 3-oxoacyl-[acyl-carrier-protein] synt...   278   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb:AY642539_1619106 Brassica napus fatty acid elongase 3-ketoacy...   275   5e-74   
pir|A84663|A84663 probable beta-ketoacyl-CoA synthase [imported]...   276   5e-74   Arabidopsis thaliana [mouse-ear cress]
pir|F86141|F86141 protein T25K16.11 [imported] - Arabidopsis tha...   275   7e-74   Arabidopsis thaliana [mouse-ear cress]
gb:SCU37088_1710216 Simmondsia chinensis beta-ketoacyl-CoA synth...   274   7e-74   
gb:AF053345_1764442 Arabidopsis thaliana fatty acid elongase 3-k...   275   7e-74   
gb:AF458093_1801420 Persea americana fatty acid elongase mRNA, p...   275   7e-74   
gb:AF082033_1766575 Hemerocallis hybrid cultivar senescence-asso...   273   1e-73   
gb:AP005008_1847226 Oryza sativa (japonica cultivar-group) genom...   268   7e-73   
gb:AY082610_1569189 Tropaeolum majus putative fatty acid elongas...   275   8e-73   
gb:AY642538_1619105 Brassica napus fatty acid elongase 3-ketoacy...   271   1e-72   
gb:AY088928_1573936 Arabidopsis thaliana clone 99793 mRNA, compl...   272   4e-72   
pir|F86384|F86384 probable protein fatty acid condensing enzyme ...   272   4e-72   Arabidopsis thaliana [mouse-ear cress]
gb:AP003623_1831642 Oryza sativa (japonica cultivar-group) genom...   268   1e-71   
gb:AF247134_1780576 Limnanthes douglasii fatty acid elongase 1-l...   268   1e-71   
gb:BT004205_1637301 Arabidopsis thaliana clone RAFL16-04-C18 (R5...   269   3e-71   
gb:ZMA292770_1731494 Zea mays mRNA for putative fatty acid longa...   266   5e-71   
gb:AF214499S2_1777843 Arabidopsis thaliana fiddlehead protein (f...   254   8e-69   
gb:AF490459_1804782 Brassica napus 3-ketoacyl-CoA synthase gene,...   262   9e-69   
gb:AF490460_1804783 Brassica oleracea 3-ketoacyl-CoA synthase ge...   261   1e-68   
gb:AE016959_1021031 Oryza sativa (japonica cultivar-group) chrom...   256   1e-68   
gb:BJU558198_1633054 Brassica juncea fae1.2 gene for beta-ketoac...   259   6e-68   
gb:AX358197_1466208 Sequence 41 from Patent WO0194565.                259   6e-68   
gb:AE016959_1022579 Oryza sativa (japonica cultivar-group) chrom...   258   1e-67   
pir|T07900|T07900 probable 3-oxoacyl-[acyl-carrier-protein] synt...   258   1e-67   Brassica napus [oilseed rape]
gb:AX358191_1466205 Sequence 35 from Patent WO0194565.                258   2e-67   
gb:AX358183_1466201 Sequence 27 from Patent WO0194565.                258   2e-67   
pir|T05272|T05272 fatty acid elongase 1 - Arabidopsis thaliana>g...   258   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb:AX358187_1466203 Sequence 31 from Patent WO0194565.                256   4e-67   
gb:AF490461_1804784 Brassica rapa 3-ketoacyl-CoA synthase gene, ...   255   9e-67   
gb:BJU558197_1633053 Brassica juncea fae1.1 gene for beta-ketoac...   255   9e-67   
gb:AF274750_1782491 Brassica napus beta-ketoacyl-CoA synthase (F...   254   2e-66   
gb:AX358195_1466207 Sequence 39 from Patent WO0194565.                254   2e-66   
gb:AX358193_1466206 Sequence 37 from Patent WO0194565.                254   2e-66   
gb:AX358177_1466198 Sequence 21 from Patent WO0194565.                254   2e-66   
gb:AX358175_1466197 Sequence 19 from Patent WO0194565.                254   2e-66   
gb:AX358173_1466196 Sequence 17 from Patent WO0194565.                254   2e-66   
gb:AX358171_1466195 Sequence 15 from Patent WO0194565.                254   2e-66   
gb:AX127155_1461718 Sequence 2 from Patent WO0129238.>gb:AX35818...   254   2e-66   
pir|D84906|D84906 probable beta-ketoacyl-CoA synthase [imported]...   252   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009400_1542962 Arabidopsis thaliana chromosome III BAC F1...   252   2e-66   
gb:AX358185_1466202 Sequence 29 from Patent WO0194565.                253   4e-66   
gb:AX351158_1466033 Sequence 1 from Patent WO0190364.>gb:AF36705...   253   6e-66   
gb:AF490462_1804785 Brassica napus 3-ketoacyl-CoA synthase gene,...   252   8e-66   
gb:AX358181_1466200 Sequence 25 from Patent WO0194565.                252   1e-65   
gb:AX358179_1466199 Sequence 23 from Patent WO0194565.                252   1e-65   
gb:AX358169_1466194 Sequence 13 from Patent WO0194565.                252   1e-65   
gb:AX358167_1466193 Sequence 11 from Patent WO0194565.                252   1e-65   
gb:AX358165_1466192 Sequence 9 from Patent WO0194565.                 252   1e-65   
pir|T07934|T07934 probable 3-oxoacyl-[acyl-carrier-protein] synt...   252   1e-65   Brassica napus [oilseed rape]
gb:AX358163_1466191 Sequence 7 from Patent WO0194565.                 250   3e-65   
pir|T04771|T04771 fatty acid elongase homolog F10M10.20 - Arabid...   249   8e-65   Arabidopsis thaliana [mouse-ear cress]
gb:AC105729_1738003 Oryza sativa (japonica cultivar-group) chrom...   248   2e-64   
gb:AY695435_1623508 Lesquerella fendleri 3-ketoacyl-CoA synthase...   244   2e-63   
pir|H84524|H84524 probable fatty acid elongase [imported] - Arab...   243   5e-63   Arabidopsis thaliana [mouse-ear cress]
gb:AF333040_1787301 Dunaliella salina beta-ketoacyl-CoA synthase...   236   8e-63   
gb:AP004888_1846680 Oryza sativa (japonica cultivar-group) genom...   237   1e-61   
gb:AF114171_1769156 Sorghum bicolor BAC clone 25.M18, complete s...   238   1e-61   
gb:AP004740_1844144 Oryza sativa (japonica cultivar-group) genom...   234   4e-61   
gb:BJFAE1_1633024 B.juncea fae1 gene.                                 234   2e-60   
gb:AB023028_1515302 Arabidopsis thaliana genomic DNA, chromosome...   226   4e-59   
gb:AP004630_1842300 Oryza sativa (japonica cultivar-group) genom...   229   7e-59   
pir|C96736|C96736 probable ketoacyl-CoA synthase F23N20.15 [impo...   228   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AP004740_1844163 Oryza sativa (japonica cultivar-group) genom...   226   4e-58   
gb:AF491878_1804884 Brassica rapa cultivar Tobin fatty acid elon...   224   2e-57   
gb:AF491876_1804882 Brassica juncea fatty acid elongase (fae 1.1...   224   2e-57   
gb:AP004630_1842293 Oryza sativa (japonica cultivar-group) genom...   222   8e-57   
gb:AP003350_1828524 Oryza sativa (japonica cultivar-group) genom...   222   1e-56   
gb:BCY14974_1632827 Brassica campestris fae1 gene, low erucic ac...   221   1e-56   
gb:BCY14975_1632828 Brassica campestris fae1 gene, high erucic a...   221   2e-56   
gb:BOY14981_1633938 Brassica oleracea fae1 gene.                      214   2e-54   
gb:AF054498_1764541 Brassica napus fatty acid elongase 1 (FAE1-2...   202   1e-50   
pir|T07846|T07846 probable beta-ketoacyl synthetase 2 - rape (fr...   202   1e-50   Brassica napus [oilseed rape]
gb:AF054497_1764540 Brassica napus fatty acid elongase 1 (FAE1-1...   198   1e-49   
pir|T07845|T07845 beta-ketoacyl synthetase 1 - rape (fragment)        198   1e-49   Brassica napus [oilseed rape]
gb:AF054500_1764543 Brassica oleracea fatty acid elongase 1 (FAE...   197   4e-49   
pir|T14434|T14434 probable beta-ketoacyl synthetase 1 - wild cab...   197   4e-49   Brassica oleracea
gb:AF054499_1764542 Brassica rapa fatty acid elongase 1 (FAE1) g...   196   5e-49   
pir|T14385|T14385 fatty acid elongase 1 - turnip (fragment)           196   5e-49   Brassica rapa
gb:AP005508_1853064 Oryza sativa (japonica cultivar-group) genom...   196   6e-49   
gb:AY392440_1325147 Dictyostelium discoideum probable 3-oxoacyl-...   194   9e-49   
pir|T49095|T49095 beta-ketoacyl-CoA synthase like protein - Arab...   191   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AY084713_1569799 Arabidopsis thaliana clone 115725 mRNA, comp...   191   1e-47   
pir|D86212|D86212 hypothetical protein [imported] - Arabidopsis ...   175   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AC084022_1733281 Oryza sativa chromosome 3 BAC OSJNBa0011H24 ...   176   4e-43   
gb:AP006175_1861395 Oryza sativa (japonica cultivar-group) genom...   174   7e-43   
gb:AP006175_1861394 Oryza sativa (japonica cultivar-group) genom...   174   7e-43   
gb:AY084716_1569802 Arabidopsis thaliana clone 115769 mRNA, comp...   169   3e-42   
gb:AE016959_1023054 Oryza sativa (japonica cultivar-group) chrom...   173   4e-42   
pir|C84687|C84687 probable fatty acid elongase [imported] - Arab...   169   5e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AC084022_1733291 Oryza sativa chromosome 3 BAC OSJNBa0011H24 ...   162   1e-39   
gb:AP004120_1837870 Oryza sativa (japonica cultivar-group) genom...   159   9e-39   
gb:AF214497S2_1777842 Arabidopsis thaliana fiddlehead protein (f...   145   4e-36   
pir|T48449|T48449 fatty acid elongase-like protein - Arabidopsis...   139   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00069_1694266 Oryza sativa genomic DNA, chromosome 4, BAC...   124   2e-27   
gb:AF214505S2_1777846 Arabidopsis thaliana fiddlehead protein (f...    89   2e-19   
gb:AP005051_1847294 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AF214491S2_1777839 Arabidopsis thaliana fiddlehead protein (f...    79   3e-16   
pir|C75587|C75587 probable chalcone synthase - Deinococcus radio...    49   2e-04   Deinococcus radiodurans
gb:AE016959_1022211 Oryza sativa (japonica cultivar-group) chrom...    46   0.001   
gb:AY847705_1630755 Marchantia polymorpha stilbenecarboxylate sy...    43   0.009   
gb:AB040027_1519426 Psilotum nudum PnE mRNA for chalcone synthas...    43   0.009   
gb:AJ748188_530232 Pseudomonas aeruginosa partial rpoB gene for ...    43   0.012   
gb:HLU430353_1681866 Humulus lupulus chs4 gene for CHS-like prot...    42   0.020   
sp|P51081|CHSA_PEA|CHSA_PEA Chalcone synthase 1A (EC 2.3.1.74) (Naringeni...    42   0.020   Pisum sativum [garden pea]
gb:AF508150_1806924 Rheum tataricum stilbene synthase (STS) mRNA...    41   0.034   
sp|Q9ZS40|CHS2_DAUCA|CHS2_DAUCA Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    41   0.045   Daucus carota [carrots]
gb:OSJN00259_1697537 Oryza sativa genomic DNA, chromosome 4, BAC...    40   0.059   
gb:AY563038_1615004 Ginkgo biloba chalcone synthase (CHS) gene, ...    40   0.059   
gb:AB119057_1527907 Marchantia paleacea var. diptera MpCHSLKG1 g...    40   0.059   
gb:AB119056_1527906 Marchantia paleacea var. diptera MpCHSLK1 mR...    40   0.059   
gb:AB061022_1521990 Humulus lupulus chs3 gene for chalcone synth...    40   0.059   
gb:AX775863_1475223 Sequence 133 from Patent WO03048202.               40   0.059   
gb:NSP561198_156222 Actinomadura sp. ATCC 39727 gene cluster for...    40   0.059   
sp|P48392|CHS3_GERHY|CHS3_GERHY Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    40   0.059   Gerbera hybrid cultivar
gb:AY262686_1593702 Glycine max cultivar Williams 82 BAC clone G...    40   0.077   
gb:AY262686_1593701 Glycine max cultivar Williams 82 BAC clone G...    40   0.077   
pir|JQ2249|JQ2249 naringenin-chalcone synthase (EC 2.3.1.74) - s...    40   0.077   Glycine max [soybeans]
sp|P30080|CHS6_SOYBN|CHS6_SOYBN Chalcone synthase 6 (EC 2.3.1.74) (Naringen...    40   0.077   Glycine max [soybeans]
sp|P48406|CHS5_SOYBN|CHS5_SOYBN Chalcone synthase 5 (EC 2.3.1.74) (Naringen...    40   0.077   Glycine max [soybeans]
sp|P19168|CHS3_SOYBN|CHS3_SOYBN Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    40   0.077   Glycine max [soybeans]
sp|P24826|CHS1_SOYBN|CHS1_SOYBN Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    40   0.077   Glycine max [soybeans]
gb:AY221244_1590539 Allium cepa cultivar H6 (doubled haploid lin...    40   0.10    
gb:AB022682_1515252 Psilotum nudum mRNA for chalcone synthase, c...    40   0.10    
sp|P30077|CHS9_MEDSA|CHS9_MEDSA Chalcone synthase 9 (EC 2.3.1.74) (Naringen...    40   0.10    Medicago sativa [alfalfa]
sp|P51077|CHS3_MEDSA|CHS3_MEDSA Chalcone synthase 4-1 (EC 2.3.1.74) (Naring...    40   0.10    Medicago sativa [alfalfa]
sp|Q9FSB8|CHS2_RUTGR|CHS2_RUTGR Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    40   0.10    Ruta graveolens
gb:AF169798_1774227 Lilium hybrid cv. 'Acapulco' chalcone syntha...    39   0.13    
sp|P51089|CHSY_VIGUN|CHSY_VIGUN Chalcone synthase (EC 2.3.1.74) (Naringenin...    39   0.13    Vigna unguiculata
sp|P16107|CHSY_PETCR|CHSY_PETCR Chalcone synthase (EC 2.3.1.74) (Naringenin...    39   0.13    Petroselinum crispum
sp|P30073|CHS1_MEDSA|CHS1_MEDSA Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    39   0.13    Medicago sativa [alfalfa]
sp|Q9FSC0|ACS2_RUTGR|ACS2_RUTGR Acridone synthase II (EC 2.3.1.159).>gb:RGR...    39   0.13    Ruta graveolens
gb:AP003797_1833493 Oryza sativa (japonica cultivar-group) genom...    39   0.17    
gb:AF511474_1807273 Chrysanthemum vestitum chalcone synthase (CH...    39   0.17    
gb:AF511473_1807272 Chrysanthemum vestitum chalcone synthase (CH...    39   0.17    
gb:AF511472_1807271 Chrysanthemum chanetii chalcone synthase (CH...    39   0.17    
gb:AF511467_1807266 Chrysanthemum lavandulifolium chalcone synth...    39   0.17    
gb:AF511466_1807265 Chrysanthemum lavandulifolium chalcone synth...    39   0.17    
gb:AF511464_1807263 Chrysanthemum lavandulifolium chalcone synth...    39   0.17    
gb:AF511460_1807259 Chrysanthemum indicum chalcone synthase (CHS...    39   0.17    
gb:AF511459_1807258 Chrysanthemum indicum chalcone synthase (CHS...    39   0.17    
gb:AB015872_1512736 Vitis vinifera gene for chalcone synthase, c...    39   0.17    
gb:AE017313_439458 Desulfovibrio vulgaris subsp. vulgaris str. H...    39   0.17    
sp|P51075|CHSY_BETVE|CHSY_BETVE Chalcone synthase (EC 2.3.1.74) (Naringenin...    39   0.17    Betula pendula [white birch]
sp|P17957|CHS2_SOYBN|CHS2_SOYBN Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    39   0.17    Glycine max [soybeans]
sp|Q9FSC1|ACS4_RUTGR|ACS4_RUTGR Probable acridone synthase IV (EC 2.3.1.159...    39   0.17    Ruta graveolens
sp|Q9FSC2|ACS3_RUTGR|ACS3_RUTGR Probable acridone synthase III (EC 2.3.1.15...    39   0.17    Ruta graveolens
gb:AJ850132_1814759 Dictamnus albus mRNA for chalcone synthase (...    39   0.22    
gb:AF400567_1796035 Rubus idaeus chalcone synthase 6 (CHS6) mRNA...    39   0.22    
gb:AF358432_1790889 Senna alata isolate calchs3 root-specific ch...    39   0.22    
gb:AF358430_1790887 Senna alata isolate calchs1 root-specific ch...    39   0.22    
gb:AF292369_1783769 Rubus idaeus aromatic polyketide synthase (P...    39   0.22    
gb:AF292367_1783767 Rubus idaeus aromatic polyketide synthase ge...    39   0.22    
gb:AF144536_1771941 Microthlaspi perfoliatum chalcone synthase (...    39   0.22    
gb:AF112082_1769054 Aethionema grandiflora chalcone synthase gen...    39   0.22    
gb:GSPCHS_1680956 Gerbera hybrid cv. 'Terra Regina' chs-like gene.     39   0.22    
gb:AB038246_1519199 Rosa hybrid cultivar 'Kardinal' CHS mRNA for...    39   0.22    
sp|O80400|VPS_HUMLU|VPS_HUMLU Phloroisovalerophenone synthase (EC 2.3.1.15...    39   0.22    Humulus lupulus [common hop]
sp|P51082|CHSB_PEA|CHSB_PEA Chalcone synthase 1B (EC 2.3.1.74) (Naringeni...    39   0.22    Pisum sativum [garden pea]
gb:AP003278_1827107 Oryza sativa (japonica cultivar-group) genom...    38   0.29    
gb:AF511470_1807269 Chrysanthemum nankingense chalcone synthase ...    38   0.29    
gb:AF511463_1807262 Chrysanthemum indicum var. aromaticum chalco...    38   0.29    
gb:AF144535_1771940 Thlaspi arvense chalcone synthase (chs) gene...    38   0.29    
gb:AF112094_1769066 Halimolobos perplexa var. perplexa chalcone ...    38   0.29    
gb:AY237728_1592193 Glycine max chalcone synthase (chs8) gene, c...    38   0.29    
gb:AY170347_1586557 Arachis hypogaea trihydroxystilbene synthase...    38   0.29    
gb:ATH18603_1552043 Arabidopsis thaliana chs gene, partial, exon...    38   0.29    
gb:AB058638_1521722 Lilium hybrid division I LhCHSA mRNA for cha...    38   0.29    
gb:AB027606_1517520 Arachis hypogaea mRNA for stilbene synthase,...    38   0.29    
gb:AY078067_587876 Saccharopolyspora erythraea red pigment gene ...    38   0.29    
pir|A53050|A53050 brefeldin A esterase - Bacillus subtilis>gb:BA...    38   0.29    Bacillus subtilis
pir|S60241|S60241 acridone synthase - Ruta graveolens                  38   0.29    Ruta graveolens
pir|JQ1071|JQ1071 naringenin-chalcone synthase (EC 2.3.1.74) - s...    38   0.29    Glycine max [soybeans]
pir|T15054|T15054 anther-specific protein - wood tobacco>gb:NSCH...    38   0.29    Nicotiana sylvestris
sp|Q9LKP7|CHSY_DIAMO|CHSY_DIAMO Chalcone synthase (EC 2.3.1.74) (Naringenin...    38   0.29    Dianthus monspessulanus
sp|P48389|CHSY_DIACA|CHSY_DIACA Chalcone synthase (EC 2.3.1.74) (Naringenin...    38   0.29    Dianthus caryophyllus [carnation]
sp|P30081|CHS7_SOYBN|CHS7_SOYBN Chalcone synthase 7 (EC 2.3.1.74) (Naringen...    38   0.29    Glycine max [soybeans]
sp|Q01288|CHS6_PEA|CHS6_PEA Chalcone synthase 6 (EC 2.3.1.74) (Naregenin-...    38   0.29    Pisum sativum [garden pea]
sp|P51079|CHS6_MEDSA|CHS6_MEDSA Chalcone synthase 6-4 (EC 2.3.1.74) (Naring...    38   0.29    Medicago sativa [alfalfa]
sp|Q9SBL5|CHS4_SORBI|CHS4_SORBI Chalcone synthase 4 (EC 2.3.1.74) (Naringen...    38   0.29    Sorghum bicolor [broomcorn]
sp|Q9FSB9|CHS1_RUTGR|CHS1_RUTGR Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    38   0.29    Ruta graveolens
gb:AF456446_1801204 Hydrangea macrophylla stilbenecarboxylate sy...    38   0.38    
gb:AF456445_1801203 Hydrangea macrophylla stilbenecarboxylate sy...    38   0.38    
gb:AF112102_1769074 Arabis pauciflora chalcone synthase gene, co...    38   0.38    
gb:AY670100_1620775 Vitis vinifera clone 336744_S4 stilbene synt...    38   0.38    
gb:AB011468_1511334 Hydrangea macrophylla ctas mRNA for coumaroy...    38   0.38    
gb:AME16952_553221 Amycolatopsis balhimycina biosynthetic gene c...    38   0.38    
sp|P51090|CHSY_VITVI|CHSY_VITVI Chalcone synthase (EC 2.3.1.74) (Naringenin...    38   0.38    Vitis vinifera
gb:AF144537_1771942 Alliaria petiolata chalcone synthase (chs) g...    37   0.50    
gb:AF112106_1769078 Capsella rubella chalcone synthase gene, com...    37   0.50    
gb:AF076335_1766180 Brassica napus chalcone synthase B1 (CHSB1) ...    37   0.50    
gb:AF020709_1761696 Vitis vinifera chalcone synthase (CHS) mRNA,...    37   0.50    
gb:AB066275_1522562 Vitis vinifera CHS2 gene for chalcone syntha...    37   0.50    
pir|C75334|C75334 3-oxoacyl-acyl carrier protein synthase III - ...    37   0.50    Deinococcus radiodurans
sp|Q9RT22|FAH2_DEIRA|FAH2_DEIRA 3-oxoacyl-[acyl-carrier-protein] synthase I...    37   0.50    Deinococcus radiodurans
sp|Q9RT23|FAH1_DEIRA|FAH1_DEIRA 3-oxoacyl-[acyl-carrier-protein] synthase I...    37   0.50    Deinococcus radiodurans
sp|P23569|CHSY_PUELO|CHSY_PUELO Chalcone synthase (EC 2.3.1.74) (Naringenin...    37   0.50    Pueraria montana var. lobata [kudzu]
sp|P13417|CHS3_SINAL|CHS3_SINAL Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    37   0.50    Sinapis alba [bai jie]
sp|Q01286|CHS1_PEA|CHS1_PEA Chalcone synthase 1 (EC 2.3.1.74) (Naregenin-...    37   0.50    Pisum sativum [garden pea]
gb:SHU27488_2451523 Suid herpesvirus 1 glycoprotein gX mRNA, par...    37   0.65    
gb:AF232689_2218901 Rat cytomegalovirus Maastricht, complete gen...    37   0.65    
gb:AJ619910_1812275 Arabidopsis thaliana partial chs gene for ch...    37   0.65    
gb:AJ619907_1812272 Arabidopsis thaliana partial chs gene for ch...    37   0.65    
gb:AJ619896_1812261 Arabidopsis halleri partial chs gene for cha...    37   0.65    
gb:AHGSG11_1811128 A.hypogaea resveratrol synthase gene (clone p...    37   0.65    
gb:AF400566_1796034 Rubus idaeus chalcone synthase 11 (CHS11) mR...    37   0.65    
gb:AF400565_1796033 Rubus idaeus chalcone synthase 5 (CHS5) mRNA...    37   0.65    
gb:AF292368_1783768 Rubus idaeus aromatic polyketide synthase (P...    37   0.65    
gb:AF169799_1774228 Lilium hybrid cv. 'Acapulco' chalcone syntha...    37   0.65    
gb:AF144533_1771938 Arabidopsis korshinskyi chalcone synthase (c...    37   0.65    
gb:AF112105_1769077 Arabis procurrens chalcone synthase gene, co...    37   0.65    
gb:AF112096_1769068 Arabis hirsuta chalcone synthase gene, compl...    37   0.65    
gb:AF112095_1769067 Arabidopsis halleri chalcone synthase gene, ...    37   0.65    
gb:AF112093_1769065 Arabidopsis griffithiana isolate AgrifB chal...    37   0.65    
gb:AF112092_1769064 Arabidopsis griffithiana isolate AgrifA chal...    37   0.65    
gb:AF112091_1769063 Arabis glabra chalcone synthase gene, comple...    37   0.65    
gb:S80554_1704595 (tt4(85))=chalcone synthase [Arabidopsis, Lans...    37   0.65    
gb:AY670215_1620890 Vitis vinifera clone 361643_S5 stilbene synt...    37   0.65    
gb:AY670151_1620826 Vitis vinifera clone 357854_S2 stilbene synt...    37   0.65    
gb:AY309966_1598096 Gypsophila paniculata chalcone synthase (chs...    37   0.65    
gb:AY087778_1572805 Arabidopsis thaliana clone 38370 mRNA, compl...    37   0.65    
gb:AE013598_294579 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   0.65    
pir|S00334|S00334 resveratrol synthase (EC 2.3.1.-) (clone pGSG1...    37   0.65    Arachis hypogaea [goober]
pir|T17474|T17474 chalcone synthase homolog PCZA361.6 - Amycolat...    37   0.65    Amycolatopsis orientalis
sp|P20178|THS1_ARAHY|THS1_ARAHY Stilbene synthase 1 (EC 2.3.1.95) (Resverat...    37   0.65    Arachis hypogaea [goober]
sp|Q8PBV1|FABH_XANCP|FABH_XANCP 3-oxoacyl-[acyl-carrier-protein] synthase I...    37   0.65    Xanthomonas campestris pv. campestris
sp|P13114|CHSY_ARATH|CHSY_ARATH Chalcone synthase (EC 2.3.1.74) (Naringenin...    37   0.65    Arabidopsis thaliana [mouse-ear cress]
gb:AJ868240_1815085 Arabidopsis croatica partial chs gene for ch...    37   0.85    
gb:AJ619893_1812258 Arabidopsis lyrata subsp. petraea partial ch...    37   0.85    
gb:AJ619886_1812251 Arabidopsis lyrata subsp. lyrata partial chs...    37   0.85    
gb:AF511469_1807268 Chrysanthemum nankingense chalcone synthase ...    37   0.85    
gb:AF227963_1778887 Arachis hypogaea resveratrol synthase 3 and ...    37   0.85    
gb:AF227963_1778886 Arachis hypogaea resveratrol synthase 3 and ...    37   0.85    
gb:AF144541_1771946 Sisymbrium irio chalcone synthase (chs) gene...    37   0.85    
gb:AF144540_1771945 Cardamine pratensis chalcone synthase (chs) ...    37   0.85    
gb:AF144539_1771944 Cardamine rivularis chalcone synthase (chs) ...    37   0.85    
gb:AF144538_1771943 Cardamine penzesii chalcone synthase (chs) g...    37   0.85    
gb:AF144531_1771936 Arabidopsis himalaica chalcone synthase (chs...    37   0.85    
gb:AF112104_1769076 Arabidopsis lyrata subsp. petraea isolate Cp...    37   0.85    
gb:AF112103_1769075 Arabidopsis lyrata subsp. petraea isolate Ap...    37   0.85    
gb:AF112100_1769072 Arabidopsis lyrata chalcone synthase gene, c...    37   0.85    
gb:AF112098_1769070 Arabis lignifera chalcone synthase gene, com...    37   0.85    
gb:AF112090_1769062 Arabis fendleri chalcone synthase gene, comp...    37   0.85    
gb:AF112088_1769060 Arabis drummondii isolate AdrumM chalcone sy...    37   0.85    
gb:AF076333_1766178 Brassica napus chalcone synthase A1 (CHSA1) ...    37   0.85    
gb:PSU88077_1702569 Phalaenopsis sp. 'True Lady' chalcone syntha...    37   0.85    
gb:AY825502_1629038 Phalaenopsis hybrid cultivar chalcone syntha...    37   0.85    
gb:AY670323_1620998 Vitis vinifera clone 361793_S3 stilbene synt...    37   0.85    
gb:AY670320_1620995 Vitis vinifera clone 361790_S3 stilbene synt...    37   0.85    
gb:AY670283_1620958 Vitis vinifera clone 361736_S3 stilbene synt...    37   0.85    
gb:AY670248_1620923 Vitis vinifera clone 361686_S1 stilbene synt...    37   0.85    
gb:AY670231_1620906 Vitis vinifera clone 361665_S3 stilbene synt...    37   0.85    
gb:AY670089_1620764 Vitis vinifera clone 325905_S3 stilbene synt...    37   0.85    
gb:AY656677_1620253 Camellia sinensis chalcone synthase (CHS) mR...    37   0.85    
gb:AY570927_1615616 Camellia sinensis var. sinensis chalcone syn...    37   0.85    
gb:AY289103_1594830 Lupinus luteus clone LlCHS2.1 chalcone synth...    37   0.85    
gb:AY221245_1590540 Allium cepa cultivar H6 (doubled haploid lin...    37   0.85    
gb:AY169403_1586508 Camellia sinensis chalcone synthase (CHS) mR...    37   0.85    
gb:AB008748_1510543 Scutellaria baicalensis mRNA for chalcone sy...    37   0.85    
gb:AF228524_490356 Streptomyces ansochromogenes strain 7100 SanE...    37   0.85    
pir|S71620|S71620 bibenzyl synthase (clone BibSy811) - Phalaenop...    37   0.85    
sp|O32220|COPA_BACSU|COPA_BACSU Copper-transporting P-type ATPase copA (EC ...    37   0.85    
sp|Q9SEP2|CHSY_CARAN|CHSY_CARAN Chalcone synthase (EC 2.3.1.74) (Naringenin...    37   0.85    
sp|P48385|CHSY_CALCH|CHSY_CALCH Chalcone synthase (EC 2.3.1.74) (Naringenin...    37   0.85    
sp|Q9XGX1|CHS7_SORBI|CHS7_SORBI Chalcone synthase 7 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|Q9SBL3|CHS6_SORBI|CHS6_SORBI Chalcone synthase 6 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|O23730|CHS4_BROFI|CHS4_BROFI Chalcone synthase 4 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|P48388|CHS3_CAMSI|CHS3_CAMSI Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|Q9XJ57|CHS2_CITSI|CHS2_CITSI Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|P48386|CHS1_CAMSI|CHS1_CAMSI Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    37   0.85    
sp|P53416|BBS_PHASS|BBS_PHASS Bibenzyl synthase (EC 2.3.1.-).>pir|S71619|S...    37   0.85    
gb:AF326911_1786770 Rheum palmatum benzalacetone synthase (bas) ...    36   1.1     
gb:AF174529_1774481 Aubrieta deltoidea chalcone synthase (chs) g...    36   1.1     
gb:AF112109_1769081 Aubrieta deltoidea chalcone synthase gene, c...    36   1.1     
gb:AF112089_1769061 Arabis drummondii isolate AdrumT chalcone sy...    36   1.1     
gb:BFI131830_1632884 Bromheadia finlaysoniana mRNA for bibenzyl ...    36   1.1     
gb:AY670315_1620990 Vitis vinifera clone 361781_L1 stilbene synt...    36   1.1     
gb:AY670302_1620977 Vitis vinifera clone 361764_L2 stilbene synt...    36   1.1     
gb:AY670294_1620969 Vitis vinifera clone 361753_S4 stilbene synt...    36   1.1     
gb:AY670279_1620954 Vitis vinifera clone 361732_E1 stilbene synt...    36   1.1     
gb:AY670268_1620943 Vitis vinifera clone 361718_L1 stilbene synt...    36   1.1     
gb:AY670220_1620895 Vitis vinifera clone 361649_S1 stilbene synt...    36   1.1     
gb:AY670171_1620846 Vitis vinifera clone 357877_P6 stilbene synt...    36   1.1     
gb:AY670168_1620843 Vitis vinifera clone 357873_L3 stilbene synt...    36   1.1     
gb:AY670118_1620793 Vitis vinifera clone 357812_P4 stilbene synt...    36   1.1     
gb:AY670103_1620778 Vitis vinifera clone 337604_L1 stilbene synt...    36   1.1     
gb:AY670090_1620765 Vitis vinifera clone 328329_S4 stilbene synt...    36   1.1     
gb:AY228486_1591290 Brassica oleracea chalcone synthase (chs) mR...    36   1.1     
gb:AB074485_1523251 Malus x domestica MdCHS mRNA for chalcone sy...    36   1.1     
gb:AY142782_591965 Heliobacillus mobilis 3-oxoacyl-[acyl-carrier...    36   1.1     
gb:AP008226_578747 Thermus thermophilus HB8 genomic DNA, complet...    36   1.1     
gb:AF521085_518812 Streptomyces nanchangensis NS3226 polyether i...    36   1.1     
gb:AE017230_411708 Mycobacterium avium subsp. paratuberculosis s...    36   1.1     
pir|S26415|S26415 naringenin-chalcone synthase (EC 2.3.1.74) - a...    36   1.1     
pir|S56675|S56675 naringenin-chalcone synthase homolog RJ5 - gar...    36   1.1     
pir|S44368|S44368 naringenin-chalcone synthase (EC 2.3.1.74) - a...    36   1.1     
pir|S53313|S53313 stilbene synthase - grape                            36   1.1     
sp|P51076|CHSY_FRAAN|CHSY_FRAAN Chalcone synthase RJ5 (EC 2.3.1.74) (Naring...    36   1.1     
sp|P51080|CHS7_MEDSA|CHS7_MEDSA Chalcone synthase (EC 2.3.1.74) (Naringenin...    36   1.1     
sp|O23884|CHS5_PEA|CHS5_PEA Chalcone synthase 5 (EC 2.3.1.74) (Naregenin-...    36   1.1     
sp|P51078|CHS5_MEDSA|CHS5_MEDSA Chalcone synthase 4-2 (EC 2.3.1.74) (Naring...    36   1.1     
sp|O23882|CHS4_PEA|CHS4_PEA Chalcone synthase 4 (EC 2.3.1.74) (Naregenin-...    36   1.1     
sp|O23883|CHS3_PEA|CHS3_PEA Chalcone synthase 3 (EC 2.3.1.74) (Naregenin-...    36   1.1     
sp|P51084|CHS2_TRISU|CHS2_TRISU Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    36   1.1     
sp|Q9SBL7|CHS2_SORBI|CHS2_SORBI Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    36   1.1     
sp|P24825|CHS2_MAIZE|CHS2_MAIZE Chalcone synthase C2 (EC 2.3.1.74) (Naringe...    36   1.1     
gb:ALFCHS4A_1818963 Medicago sativa chalcone synthase (CHS4) mRN...    36   1.4     
gb:AF112097_1769069 Arabis jacquinii chalcone synthase gene, com...    36   1.4     
gb:AF112084_1769056 Arabis alpina isolate AalpEU chalcone syntha...    36   1.4     
gb:MTR277211_1687614 Medicago truncatula mRNA for putative chalc...    36   1.4     
gb:CAR012690_1645134 Cicer arietinum mRNA for chalcone synthase.       36   1.4     
gb:AY670230_1620905 Vitis vinifera clone 361664_S1 stilbene synt...    36   1.4     
gb:AY670127_1620802 Vitis vinifera clone 357823_P2 stilbene synt...    36   1.4     
gb:AY643842S2_1619174 Hordeum vulgare subsp. vulgare clones BAC ...    36   1.4     
gb:AY289104_1594831 Lupinus luteus clone LlCHS4.1 chalcone synth...    36   1.4     
gb:AY193768_1588831 Arachis glabrata resveratrol synthase (rs) g...    36   1.4     
gb:AY054278_1563098 Arabidopsis thaliana AT5g13930/MAC12_11 mRNA...    36   1.4     
gb:BX571662_779246 Wolinella succinogenes, complete genome; segm...    36   1.4     
gb:AF200320_487757 Bradyrhizobium japonicum IntA (intA) and PipA...    36   1.4     
gb:AB026892_4435 Achromobacter xylosoxidans subsp. xylosoxidans ...    36   1.4     
pir|S35165|S35165 naringenin-chalcone synthase (EC 2.3.1.74) 4 -...    36   1.4     
pir|S53315|S53315 stilbene synthase - grape                            36   1.4     
sp|P51069|THS3_ARAHY|THS3_ARAHY Stilbene synthase 3 (EC 2.3.1.95) (Resverat...    36   1.4     
sp|Q8PNE8|FABH_XANAC|FABH_XANAC 3-oxoacyl-[acyl-carrier-protein] synthase I...    36   1.4     
sp|Q8Y573|FABH_LISMO|FABH_LISMO 3-oxoacyl-[acyl-carrier-protein] synthase I...    36   1.4     
sp|Q929H1|FABH_LISIN|FABH_LISIN 3-oxoacyl-[acyl-carrier-protein] synthase I...    36   1.4     
sp|P49440|CHSY_PHAVU|CHSY_PHAVU Chalcone synthase 17 (EC 2.3.1.74) (Naringe...    36   1.4     
sp|Q9SEP4|CHSY_ARAAL|CHSY_ARAAL Chalcone synthase (EC 2.3.1.74) (Naringenin...    36   1.4     
sp|Q9SBL4|CHS5_SORBI|CHS5_SORBI Chalcone synthase 5 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|P30075|CHS4_MEDSA|CHS4_MEDSA Chalcone synthase 4 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|P51085|CHS3_TRISU|CHS3_TRISU Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|P30074|CHS2_MEDSA|CHS2_MEDSA Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|P51083|CHS1_TRISU|CHS1_TRISU Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|Q9XGX2|CHS1_SORBI|CHS1_SORBI Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    36   1.4     
sp|Q9SML4|CHS1_CICAR|CHS1_CICAR Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    36   1.4     
gb:AY659200_2148210 Synthetic construct Peudomonas aeruginosa cl...    35   1.9     
gb:AHGSC2_1811127 A.hypogaea resveratrol synthase mRNA (clone pG...    35   1.9     
gb:AF315345_1785413 Hypericum androsaemum chalcone synthase mRNA...    35   1.9     
gb:AF268382_1782041 Allium cepa chalcone synthase (CHS1) mRNA, p...    35   1.9     
gb:AF144534_1771939 Lepidium campestre chalcone synthase (chs) g...    35   1.9     
gb:AF144530_1771935 Rorippa amphibia chalcone synthase (chs) gen...    35   1.9     
gb:AF112108_1769080 Barbarea vulgaris chalcone synthase gene, co...    35   1.9     
gb:AF112107_1769079 Arabis turrita chalcone synthase gene, compl...    35   1.9     
gb:AF076336_1766181 Brassica napus chalcone synthase B2 (CHSB2) ...    35   1.9     
gb:SASCHS1_1704768 Mustard mRNA for chalcone synthase (SCHS1).         35   1.9     
gb:MIN427537_1686340 Matthiola incana chs gene for chalcone synt...    35   1.9     
gb:AY847706_1630756 Marchantia polymorpha stilbenecarboxylate sy...    35   1.9     
gb:AY670271_1620946 Vitis vinifera clone 361722_S2 stilbene synt...    35   1.9     
gb:AY670216_1620891 Vitis vinifera clone 361644_L1 stilbene synt...    35   1.9     
gb:AY670143_1620818 Vitis vinifera clone 357844_R1 stilbene synt...    35   1.9     
gb:AY570926_1615615 Camellia sinensis var. sinensis chalcone syn...    35   1.9     
gb:BA000030_700176 Streptomyces avermitilis MA-4680 genomic DNA,...    35   1.9     
gb:AE017333_447091 Bacillus licheniformis DSM 13, complete genom...    35   1.9     
pir|S29556|S29556 naringenin-chalcone synthase (EC 2.3.1.74) - a...    35   1.9     
pir|S09062|SYNPHS trihydroxystilbene synthase (EC 2.3.1.95) - pe...    35   1.9     
sp|P20077|THS2_ARAHY|THS2_ARAHY Stilbene synthase 2 (EC 2.3.1.95) (Resverat...    35   1.9     
sp|Q01200|PRIA_LENED|PRIA_LENED PriA protein precursor.>pir|S23106|S23106 p...    35   1.9     
sp|O22652|CHSY_RAPSA|CHSY_RAPSA Chalcone synthase (EC 2.3.1.74) (Naringenin...    35   1.9     
sp|P17818|CHSY_MATIN|CHSY_MATIN Chalcone synthase (EC 2.3.1.74) (Naringenin...    35   1.9     
sp|P30078|CHSY_MALDO|CHSY_MALDO Chalcone synthase (EC 2.3.1.74) (Naregenin-...    35   1.9     
sp|O23731|CHS8_BROFI|CHS8_BROFI Chalcone synthase 8 (EC 2.3.1.74) (Naringen...    35   1.9     
sp|P51088|CHS6_TRISU|CHS6_TRISU Chalcone synthase 6 (EC 2.3.1.74) (Naringen...    35   1.9     
sp|P51087|CHS5_TRISU|CHS5_TRISU Chalcone synthase 5 (EC 2.3.1.74) (Naringen...    35   1.9     
sp|O23729|CHS3_BROFI|CHS3_BROFI Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    35   1.9     
sp|P13416|CHS1_SINAL|CHS1_SINAL Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    35   1.9     
sp|P24824|CHS1_MAIZE|CHS1_MAIZE Chalcone synthase WHP1 (EC 2.3.1.74) (Narin...    35   1.9     
sp|Q9XJ58|CHS1_CITSI|CHS1_CITSI Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    35   1.9     
gb:HHU92288_2409910 Human herpesvirus 6 serotype B putative majo...    35   2.5     
gb:AP004573_1841822 Oryza sativa (japonica cultivar-group) genom...    35   2.5     
gb:AJ868239_1815084 Arabidopsis halleri subsp. gemmifera partial...    35   2.5     
gb:AF511468_1807267 Chrysanthemum nankingense chalcone synthase ...    35   2.5     
gb:AF511462_1807261 Chrysanthemum indicum chalcone synthase (CHS...    35   2.5     
gb:AF358431_1790888 Senna alata isolate calchs2 root-specific ch...    35   2.5     
gb:AF112087_1769059 Arabis blepharophylla chalcone synthase gene...    35   2.5     
gb:AF076334_1766179 Brassica napus chalcone synthase A2 (CHSA2) ...    35   2.5     
gb:AY670310_1620985 Vitis vinifera clone 361775_A3 stilbene synt...    35   2.5     
gb:AY670307_1620982 Vitis vinifera clone 361771_S1 stilbene synt...    35   2.5     
gb:AY670122_1620797 Vitis vinifera clone 357817_A1 stilbene synt...    35   2.5     
gb:AY085918_1570981 Arabidopsis thaliana clone 19658 mRNA, compl...    35   2.5     
gb:AB002582_1508720 Perilla frutescens mRNA for chalcone synthas...    35   2.5     
gb:AE016959_1021122 Oryza sativa (japonica cultivar-group) chrom...    35   2.5     
gb:BX640446_815673 Bordetella bronchiseptica strain RB50, comple...    35   2.5     
gb:BX640432_811303 Bordetella parapertussis strain 12822, comple...    35   2.5     
gb:PSEPHNABA_160873 P.aeruginosa anthranilate synthase alpha (ph...    35   2.5     
pir|T08179|T08179 LRG5 protein - Chlamydomonas reinhardtii>gb:CR...    35   2.5     
pir|T10231|T10231 anther-specific protein homolog T11I11.90 - Ar...    35   2.5     
pir|T09618|T09618 naringenin-chalcone synthase (EC 2.3.1.74) A -...    35   2.5     
pir|T10999|T10999 naringenin-chalcone synthase (EC 2.3.1.74) CHS...    35   2.5     
pir|T10962|T10962 naringenin-chalcone synthase (EC 2.3.1.74) CHS...    35   2.5     
pir|T10961|T10961 naringenin-chalcone synthase (EC 2.3.1.74) CHS...    35   2.5     
pir|T11000|T11000 naringenin-chalcone synthase (EC 2.3.1.74) CHS...    35   2.5     
pir|T10960|T10960 naringenin-chalcone synthase (EC 2.3.1.74) CHS...    35   2.5     
pir|S12223|S12223 naringenin-chalcone synthase (EC 2.3.1.74) 1 -...    35   2.5     
pir|D35116|D35116 hypothetical protein 2 (phnA 5' region) - Pseu...    35   2.5     
sp|P20582|PQSD_PSEAE|PQSD_PSEAE PQB biosynthetic 3-oxoacyl-[acyl-carrier-pr...    35   2.5     
sp|Q9PCG4|FABH_XYLFA|FABH_XYLFA 3-oxoacyl-[acyl-carrier-protein] synthase I...    35   2.5     
sp|O04111|CHSY_PERFR|CHSY_PERFR Chalcone synthase (EC 2.3.1.74) (Naringenin...    35   2.5     
sp|P48397|CHSA_IPOPU|CHSA_IPOPU Chalcone synthase A (EC 2.3.1.74) (Naringen...    35   2.5     
sp|Q96562|CHS2_HORVU|CHS2_HORVU Chalcone synthase 2 (EC 2.3.1.74) (Naringen...    35   2.5     
sp|P48390|CHS1_GERHY|CHS1_GERHY Chalcone synthase 1 (EC 2.3.1.74) (Naringen...    35   2.5     
gb:AP005325_1850678 Oryza sativa (japonica cultivar-group) genom...    35   3.2     
gb:AP004133_1838098 Oryza sativa (japonica cultivar-group) genom...    35   3.2     
gb:AP002883_1823643 Oryza sativa (japonica cultivar-group) genom...    35   3.2     
gb:AF274281_1782434 Vitis vinifera resveratrol synthase (RS1) mR...    35   3.2     
gb:AF144532_1771937 Cochlearia danica chalcone synthase (chs) ge...    35   3.2     
gb:HLU304877_1681862 Humulus lupulus chs_H1 gene for chalcone sy...    35   3.2     
gb:AY670322_1620997 Vitis vinifera clone 361792_D3 stilbene synt...    35   3.2     
gb:AY670321_1620996 Vitis vinifera clone 361791_E2 stilbene synt...    35   3.2     
gb:AY670313_1620988 Vitis vinifera clone 361778_B1 stilbene synt...    35   3.2     
gb:AY670288_1620963 Vitis vinifera clone 361742_K1 stilbene synt...    35   3.2     
gb:AY670285_1620960 Vitis vinifera clone 361738_B1 stilbene synt...    35   3.2     
gb:AY670277_1620952 Vitis vinifera clone 361730_H3 stilbene synt...    35   3.2     
gb:AY670276_1620951 Vitis vinifera clone 361728_D3 stilbene synt...    35   3.2     
gb:AY670259_1620934 Vitis vinifera clone 361704_H2 stilbene synt...    35   3.2     
gb:AY670255_1620930 Vitis vinifera clone 361696_D4 stilbene synt...    35   3.2     
gb:AY670247_1620922 Vitis vinifera clone 361685_D4 stilbene synt...    35   3.2     
gb:AY670239_1620914 Vitis vinifera clone 361677_P4 stilbene synt...    35   3.2     
gb:AY670218_1620893 Vitis vinifera clone 361646_B1 stilbene synt...    35   3.2     
gb:AY670200_1620875 Vitis vinifera clone 361625_P1 stilbene synt...    35   3.2     
gb:AY670196_1620871 Vitis vinifera clone 361619_K1 stilbene synt...    35   3.2     
gb:AY670192_1620867 Vitis vinifera clone 361614_E1 stilbene synt...    35   3.2     
gb:AY670185_1620860 Vitis vinifera clone 361604_E3 stilbene synt...    35   3.2     
gb:AY670175_1620850 Vitis vinifera clone 357882_B2 stilbene synt...    35   3.2     
gb:AY670173_1620848 Vitis vinifera clone 357879_P6 stilbene synt...    35   3.2     
gb:AY670172_1620847 Vitis vinifera clone 357878_D4 stilbene synt...    35   3.2     
gb:AY670169_1620844 Vitis vinifera clone 357874_H1 stilbene synt...    35   3.2     
gb:AY670165_1620840 Vitis vinifera clone 357869_D3 stilbene synt...    35   3.2     
gb:AY670147_1620822 Vitis vinifera clone 357849_H1 stilbene synt...    35   3.2     
gb:AY670117_1620792 Vitis vinifera clone 357810_D3 stilbene synt...    35   3.2     
gb:AY670111_1620786 Vitis vinifera clone 357804_P6 stilbene synt...    35   3.2     
gb:AY670109_1620784 Vitis vinifera clone 357802_D2 stilbene synt...    35   3.2     
gb:AY670108_1620783 Vitis vinifera clone 339008_P5 stilbene synt...    35   3.2     
gb:AY670104_1620779 Vitis vinifera clone 337605_P3 stilbene synt...    35   3.2     
gb:AY670101_1620776 Vitis vinifera clone 337601_B1 stilbene synt...    35   3.2     
gb:AY670095_1620770 Vitis vinifera clone 336739_P5 stilbene synt...    35   3.2     
gb:AY670092_1620767 Vitis vinifera clone 328336_E1 stilbene synt...    35   3.2     
gb:A27274_1448236 H.sapiens TGR-CL11/TGR-C15.                          35   3.2     
pir|S11044|S11044 stilbene synthase (EC 2.3.1.-) - grape               35   3.2     
sp|P28343|THS1_VITVI|THS1_VITVI Stilbene synthase 1 (EC 2.3.1.95) (Resverat...    35   3.2     
sp|O34746|FAH1_BACSU|FAH1_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase I...    35   3.2     
sp|Q9SBL6|CHS3_SORBI|CHS3_SORBI Chalcone synthase 3 (EC 2.3.1.74) (Naringen...    35   3.2     
sp|Q01287|CHS2_PEA|CHS2_PEA Chalcone synthase 2 (EC 2.3.1.74) (Naregenin-...    35   3.2     
gb:AF511471_1807270 Chrysanthemum chanetii chalcone synthase (CH...    34   4.2     
gb:AF511461_1807260 Chrysanthemum indicum chalcone synthase (CHS...    34   4.2     
gb:AF352395_1790523 Hypericum androsaemum benzophenone synthase ...    34   4.2     
gb:AY741319_1626348 Dendrobium hybrid cultivar chalcone synthase...    34   4.2     
gb:AY670244_1620919 Vitis vinifera clone 361682_M1 stilbene synt...    34   4.2     
gb:AY670154_1620829 Vitis vinifera clone 357857_M2 stilbene synt...    34   4.2     
gb:AY670148_1620823 Vitis vinifera clone 357851_M2 stilbene synt...    34   4.2     
gb:AY670140_1620815 Vitis vinifera clone 357838_S5 stilbene synt...    34   4.2     
gb:AY146702_1583899 Camellia yunnanensis clone CyunA2 chalcone s...    34   4.2     
gb:AB046666_1520535 Scutellaria baicalensis CHS-C mRNA for chalc...    34   4.2     
gb:AB012923_1511969 Torenia hybrida mRNA for chalcone synthase, ...    34   4.2     
gb:AY345585S1_1429188 Canis familiaris clone 5' plakoglobin mRNA...    34   4.2     
gb:AF164027_1246620 Leishmania tropica surface antigen P2 (PSA-2...    34   4.2     
gb:AK004055_1152206 Mus musculus 18-day embryo whole body cDNA, ...    34   4.2     
gb:BA000030_698142 Streptomyces avermitilis MA-4680 genomic DNA,...    34   4.2     
gb:AP006840_568637 Symbiobacterium thermophilum DNA, complete ge...    34   4.2     
gb:AJ605139_526662 Actinoplanes teichomyceticus gene cluster for...    34   4.2     
pir|S56700|S55465 chalcone synthase 2 - gerbera hybrid                 34   4.2     
pir|AE3048|AE3048 3-oxoacyl-(acyl-carrier-protein) synthase III ...    34   4.2     
pir|F98237|F98237 bioZ protein (AF311738) [imported] - Agrobacte...    34   4.2     
sp|Q9Z4Y5|FAH2_STRCO|FAH2_STRCO 3-oxoacyl-[acyl-carrier-protein] synthase I...    34   4.2     
sp|Q87CL7|FABH_XYLFT|FABH_XYLFT 3-oxoacyl-[acyl-carrier-protein] synthase I...    34   4.2     
sp|Q89K89|FABH_BRAJA|FABH_BRAJA 3-oxoacyl-[acyl-carrier-protein] synthase I...    34   4.2     
sp|O22586|CHSY_ONOVI|CHSY_ONOVI Chalcone synthase (EC 2.3.1.74) (Naringenin...    34   4.2     
sp|P48398|CHSB_IPOPU|CHSB_IPOPU Chalcone synthase B (EC 2.3.1.74) (Naringen...    34   4.2     
sp|P48391|2PS_GERHY|2PS_GERHY 2-pyrone synthase (EC 2.3.1.-) (2-PS) (G2ps1...    34   4.2     
gb:AF311783_1785076 Nicotiana tabacum chalcone synthase mRNA, co...    34   5.5     
gb:AF169800_1774229 Lilium hybrid cv. 'Acapulco' chalcone syntha...    34   5.5     
gb:AY873969_1631582 Zingiber officinale chalcone synthase mRNA, ...    34   5.5     
gb:AY670308_1620983 Vitis vinifera clone 361772_T2 stilbene synt...    34   5.5     
gb:AY670272_1620947 Vitis vinifera clone 361723_T1 stilbene synt...    34   5.5     
gb:AY670241_1620916 Vitis vinifera clone 361679_T2 stilbene synt...    34   5.5     
gb:AY670238_1620913 Vitis vinifera clone 361675_U1 stilbene synt...    34   5.5     
gb:AY670219_1620894 Vitis vinifera clone 361647_B2 stilbene synt...    34   5.5     


>gb:AY072823_1567407 Gossypium hirsutum fiddlehead-like protein
           (FDH) mRNA, complete cds.
          Length = 535

 Score =  346 bits (888), Expect(2) = 7e-97
 Identities = 166/229 (72%), Positives = 189/229 (82%), Gaps = 9/229 (3%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMGCSA+LLSNRRRDY RAKYRLEH+VRTHK ADDRSFR+IYQ+ED++G KGLK+
Sbjct: 304 PNCFFRMGCSAVLLSNRRRDYRRAKYRLEHLVRTHKGADDRSFRSIYQEEDEQGFKGLKV 363

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFG--------SSSQRPYIP 660
           SK+L  IGG+ALKTNITTLGPLVLP SEQL FFATL+W H FG        S S +PYIP
Sbjct: 364 SKDLTEIGGDALKTNITTLGPLVLPFSEQLFFFATLIWRHFFGGDKSKTSLSPSSKPYIP 423

Query: 659 DYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEA 480
           DYKLAF+HFC++A SK VLDELQ N+ L + +ME SR TLHRFGNTSSSSIWYELAYLEA
Sbjct: 424 DYKLAFEHFCVHAASKTVLDELQKNLELSENNMEASRMTLHRFGNTSSSSIWYELAYLEA 483

Query: 479 KGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA-NPWLDCIHTYP 336
           K +V  GDR+WQI FGSGFKCNS VWR++RR+R P+  NPWLDCI  YP
Sbjct: 484 KERVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRDNPWLDCIDRYP 532



 Score = 31.6 bits (70), Expect(2) = 7e-97
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G+DRSM +PN F
Sbjct: 292  NWYPGRDRSMLVPNCF 307



>gb:AMA310739_1819158 Antirrhinum majus afi gene for putative
           beta-ketoacyl-CoA synthase, exons 1-3.
          Length = 526

 Score =  344 bits (882), Expect(2) = 3e-95
 Identities = 163/225 (72%), Positives = 189/225 (84%), Gaps = 4/225 (1%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMGCSA+LLSNRRRDYGRAKYRLEHIVRTHK ADDRSFR++YQ+ED +  KG+K+
Sbjct: 299 PNCYFRMGCSAVLLSNRRRDYGRAKYRLEHIVRTHKGADDRSFRSVYQEEDSQTFKGIKV 358

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSS----SQRPYIPDYKL 648
           SK+LV IGGEA+KTNITTLGPLVLP SEQL+FF+TLVW  + GS     S  PYIPDYKL
Sbjct: 359 SKDLVEIGGEAIKTNITTLGPLVLPFSEQLLFFSTLVWKLMSGSGANSMSSNPYIPDYKL 418

Query: 647 AFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKV 468
           AF+HFC++A SK VLDELQ N+ L D ++E SRA LHRFGNTSSSSIWYELAYLEAKG++
Sbjct: 419 AFEHFCMHAASKTVLDELQRNLELSDKNLEASRAVLHRFGNTSSSSIWYELAYLEAKGQI 478

Query: 467 AGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYPR 333
             GDR+WQ+ FGSGFKCN+ VW+AVR+IR P  NPW+DCI  YPR
Sbjct: 479 KRGDRVWQLSFGSGFKCNTPVWKAVRKIRKPERNPWVDCIDGYPR 523



 Score = 28.5 bits (62), Expect(2) = 3e-95
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G +RSM IPN +
Sbjct: 287  NWYPGNERSMLIPNCY 302



>gb:AY206684_1589529 Tropaeolum majus fiddlehead-like protein mRNA,
           complete cds.>gb:AY258900_1593316 Tropaeolum majus
           fiddlehead-like protein (FDH) gene, complete cds.
          Length = 538

 Score =  340 bits (871), Expect(2) = 1e-94
 Identities = 164/231 (70%), Positives = 187/231 (80%), Gaps = 11/231 (4%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMGCSA+LLSNRR DY RAKY L+H+VRTHK ADDRSFR IYQ+ED+EG KGLK+
Sbjct: 305 PNCYFRMGCSAVLLSNRRGDYRRAKYSLQHLVRTHKGADDRSFRCIYQEEDEEGYKGLKV 364

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFG-----------SSSQRP 669
           SKEL+ IGG+ALKTNITTLGPLVLP SEQLIFFATL+W +L G           S S +P
Sbjct: 365 SKELMEIGGDALKTNITTLGPLVLPFSEQLIFFATLIWRNLLGTDPNKNKTSKQSLSSKP 424

Query: 668 YIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAY 489
           YIPDYKLAF+HFC++A SK+VLDELQ N+ L D +ME SR TLHRFGNTSSSSIWYELAY
Sbjct: 425 YIPDYKLAFEHFCVHAASKIVLDELQKNLELSDDNMEASRMTLHRFGNTSSSSIWYELAY 484

Query: 488 LEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           +EAK +V  GDR+WQI FGSGFKCNS VWR++RR+R P  NPWLD I  YP
Sbjct: 485 MEAKERVKRGDRIWQISFGSGFKCNSLVWRSMRRVRKPNRNPWLDWIDRYP 535



 Score = 30.4 bits (67), Expect(2) = 1e-94
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G+DRSM IPN +
Sbjct: 293  NWYPGQDRSMLIPNCY 308



>gb:AC126223_1740538 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBb0076N15, complete sequence.
          Length = 595

 Score =  330 bits (845), Expect(2) = 3e-91
 Identities = 156/234 (66%), Positives = 188/234 (80%), Gaps = 14/234 (5%)
 Frame = -3

Query: 995  PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
            P   FR GC+A+LLSNRRRD+ RAKY+LEHIVRTHK ADDRSFR++YQ+ED++  KGL I
Sbjct: 357  PNAFFRAGCAAVLLSNRRRDFHRAKYQLEHIVRTHKGADDRSFRSVYQEEDEQRIKGLSI 416

Query: 815  SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGS--------------SS 678
            S++LV +GG ALKTNITTLGPLVLP SEQ++FFA +++ HLF S              S+
Sbjct: 417  SRDLVEVGGHALKTNITTLGPLVLPFSEQILFFAGVLFRHLFPSKTSAPPPPSADGDASA 476

Query: 677  QRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYE 498
              PYIPD+K AF+HFC++A S+ VL+ LQ N+GLRDGD+E SRA LHRFGNTSSSSIWYE
Sbjct: 477  AAPYIPDFKRAFEHFCMHAASRDVLEHLQGNLGLRDGDLEASRAALHRFGNTSSSSIWYE 536

Query: 497  LAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
            LAYLEAKG+V  GDR+WQ+ FGSGFKCNSAVWRAVRR+R P  +PWLDC+  YP
Sbjct: 537  LAYLEAKGRVRRGDRVWQLAFGSGFKCNSAVWRAVRRVRRPARSPWLDCVEQYP 590



 Score = 29.3 bits (64), Expect(2) = 3e-91
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = -1

Query: 1027 WYSGKDRSMXIPNXF 983
            WY+GK RSM IPN F
Sbjct: 346  WYAGKRRSMLIPNAF 360



>gb:AF214501S2_1777844 Arabidopsis thaliana fiddlehead protein (fdh)
            gene, fdh-6 allele, complete cds.
          Length = 550

 Score =  317 bits (812), Expect(2) = 2e-87
 Identities = 157/246 (63%), Positives = 188/246 (76%), Gaps = 26/246 (10%)
 Frame = -3

Query: 995  PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
            P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302  PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815  SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLV----------------------- 705
            S++L+ +GGEALKTNITTLGPLVLP SEQL+FFA L+                       
Sbjct: 362  SRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATAK 421

Query: 704  WGHLFGSSSQ--RPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRF 531
               +  SSS   +PYIPDYKLAF+HFC +A SKVVL+ELQ N+GL + +ME SR TLHRF
Sbjct: 422  TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHRF 481

Query: 530  GNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA-NPWLD 354
            GNTSSS IWYELAY+EAK  V  GDR+WQI FGSGFKCNS VW+A+R+++ PT  NPW+D
Sbjct: 482  GNTSSSGIWYELAYMEAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVD 541

Query: 353  CIHTYP 336
            CI+ YP
Sbjct: 542  CINRYP 547



 Score = 29.6 bits (65), Expect(2) = 2e-87
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>pir|B84658|B84658 beta-ketoacyl-CoA synthase (FIDDLEHEAD) [imported]
            - Arabidopsis thaliana>gb:AX353344_1466051 Sequence 1
            from Patent EP1174517.>gb:AC004484_1531789 Arabidopsis
            thaliana chromosome 2 clone T1D16 map B68, complete
            sequence.>gb:ATH010713_1551913 Arabidopsis thaliana fdh
            gene.>gb:AY039563_1560276 Arabidopsis thaliana
            At2g26250/T1D16.11 mRNA, complete
            cds.>gb:AY149961_1584910 Arabidopsis thaliana
            At2g26250/T1D16.11 mRNA, complete
            cds.>gb:BT002360_1635963 Arabidopsis thaliana clone
            U09034 putative beta-ketoacyl-CoA synthase FIDDLEHEAD
            (At2g26250) mRNA, complete cds.>gb:AF214489S2_1777838
            Arabidopsis thaliana cultivar Landsberg erecta fiddlehead
            protein (fdh) gene, complete cds.>gb:AF337910_1787645
            Arabidopsis thaliana putative beta-ketoacyl-CoA synthase
            FIDDLEHEAD (At2g26250) mRNA, complete cds.
          Length = 550

 Score =  317 bits (812), Expect(2) = 2e-87
 Identities = 157/246 (63%), Positives = 188/246 (76%), Gaps = 26/246 (10%)
 Frame = -3

Query: 995  PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
            P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302  PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815  SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLV----------------------- 705
            S++L+ +GGEALKTNITTLGPLVLP SEQL+FFA L+                       
Sbjct: 362  SRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATAK 421

Query: 704  WGHLFGSSSQ--RPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRF 531
               +  SSS   +PYIPDYKLAF+HFC +A SKVVL+ELQ N+GL + +ME SR TLHRF
Sbjct: 422  TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHRF 481

Query: 530  GNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA-NPWLD 354
            GNTSSS IWYELAY+EAK  V  GDR+WQI FGSGFKCNS VW+A+R+++ PT  NPW+D
Sbjct: 482  GNTSSSGIWYELAYMEAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVD 541

Query: 353  CIHTYP 336
            CI+ YP
Sbjct: 542  CINRYP 547



 Score = 29.6 bits (65), Expect(2) = 2e-87
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>gb:AF214503S2_1777845 Arabidopsis thaliana fiddlehead protein (fdh)
            gene, fdh-7 allele, complete cds.
          Length = 550

 Score =  315 bits (808), Expect(2) = 5e-87
 Identities = 156/246 (63%), Positives = 188/246 (76%), Gaps = 26/246 (10%)
 Frame = -3

Query: 995  PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
            P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302  PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815  SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLV----------------------- 705
            S++L+ +GGEALKTNITTLGPLVLP SEQL+FFA L+                       
Sbjct: 362  SRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATAK 421

Query: 704  WGHLFGSSSQ--RPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRF 531
               +  SSS   +PYIPDYKLAF+HFC +A SKVVL+ELQ N+GL + +ME SR TLHRF
Sbjct: 422  TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHRF 481

Query: 530  GNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA-NPWLD 354
            GNTSSS IWYELAY++AK  V  GDR+WQI FGSGFKCNS VW+A+R+++ PT  NPW+D
Sbjct: 482  GNTSSSGIWYELAYMKAKESVRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVD 541

Query: 353  CIHTYP 336
            CI+ YP
Sbjct: 542  CINRYP 547



 Score = 29.6 bits (65), Expect(2) = 5e-87
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>gb:AF214495S2_1777841 Arabidopsis thaliana fiddlehead protein (fdh)
            gene, fdh-3 allele, complete cds.
          Length = 550

 Score =  314 bits (805), Expect(2) = 1e-86
 Identities = 156/246 (63%), Positives = 187/246 (76%), Gaps = 26/246 (10%)
 Frame = -3

Query: 995  PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
            P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302  PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815  SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLV----------------------- 705
            S++L+ +GGEALKTNITTLGPLVLP SEQL+FFA L+                       
Sbjct: 362  SRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATAK 421

Query: 704  WGHLFGSSSQ--RPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRF 531
               +  SSS   +PYIPDYKLAF+HFC +A SKVVL+ELQ N+GL + +ME SR TLHRF
Sbjct: 422  TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHRF 481

Query: 530  GNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA-NPWLD 354
            GNTSSS IWYELAY+EAK  V  GDR+WQI F SGFKCNS VW+A+R+++ PT  NPW+D
Sbjct: 482  GNTSSSGIWYELAYMEAKESVRRGDRVWQIAFDSGFKCNSVVWKAMRKVKKPTRNNPWVD 541

Query: 353  CIHTYP 336
            CI+ YP
Sbjct: 542  CINRYP 547



 Score = 29.6 bits (65), Expect(2) = 1e-86
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>gb:AX155071_1462774 Sequence 117 from Patent WO0138484.
          Length = 519

 Score =  291 bits (745), Expect(2) = 1e-78
 Identities = 134/223 (60%), Positives = 175/223 (78%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A+LLSN+RRD  R+KY+L H+VRTHK ADD+ +  +YQ++D++G  G+ +
Sbjct: 291 PNCLFRVGGAAILLSNKRRDGSRSKYQLNHVVRTHKGADDKCYNCVYQEQDEQGNMGVSL 350

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GE LK NITTLGPLVLP+SEQL+FF+TLV   +F +   +PYIPD+KLAFDH
Sbjct: 351 SKDLMAIAGETLKANITTLGPLVLPLSEQLLFFSTLVARKVF-NMKVKPYIPDFKLAFDH 409

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ N+ L  G  EPSR TLHRFGNTSSSSIWYELAY+EAKG++  G+
Sbjct: 410 FCIHAGGRAVIDELEKNLQLTPGHCEPSRMTLHRFGNTSSSSIWYELAYMEAKGRMRRGN 469

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYPRAI 327
           R+WQI FGSGFKCNSAVW+A+R I+    +PW  CI  YP+ +
Sbjct: 470 RVWQIAFGSGFKCNSAVWQALRNIKPSEKSPWAHCIDEYPQHV 512



 Score = 26.2 bits (56), Expect(2) = 1e-78
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  RSM IPN
Sbjct: 279  NWYFGNRRSMLIPN 292



>pir|F86327|F86327 protein F18O14.21 [imported] - Arabidopsis
           thaliana>gb:AE005172_890908 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC025808_1539568 Genomic sequence for
           Arabidopsis thaliana BAC F18O14 from chromosome I,
           complete sequence.
          Length = 516

 Score =  289 bits (740), Expect(2) = 6e-78
 Identities = 134/220 (60%), Positives = 173/220 (78%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G SA+LLSN+ RD  R+KYRL H+VRTH+ ADD++FR +YQ++DD G+ G+ +
Sbjct: 293 PNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVYQEQDDTGRTGVSL 352

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GE LKTNITTLGPLVLP+SEQ++FF TLV   LF +   +PYIPD+KLAF+H
Sbjct: 353 SKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-NGKVKPYIPDFKLAFEH 411

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ N+ L    +E SR TLHRFGNTSSSSIWYELAY+EAKG++  G+
Sbjct: 412 FCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMRRGN 471

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSA+W A+R ++    +PW DCI  YP
Sbjct: 472 RVWQIAFGSGFKCNSAIWEALRHVKPSNNSPWEDCIDKYP 511



 Score = 25.4 bits (54), Expect(2) = 6e-78
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  +SM IPN
Sbjct: 281  NWYFGNKKSMLIPN 294



>gb:AC120986_1740004 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1781_H11, complete sequence.
          Length = 514

 Score =  288 bits (738), Expect(2) = 1e-77
 Identities = 138/220 (62%), Positives = 171/220 (77%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A+LLSNR  D  RAKY L+H+VRTHK AD+++F  +YQ++DDEGK G+ +
Sbjct: 281 PNCLFRVGGAAVLLSNRGADRRRAKYALKHVVRTHKGADNKAFNCVYQEQDDEGKTGVSL 340

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I G ALKTNITTLGPLVLP SEQL+FFATLV   LF +   +PYIPD+KLAF+H
Sbjct: 341 SKDLMAIAGGALKTNITTLGPLVLPFSEQLLFFATLVAKKLFNAKI-KPYIPDFKLAFEH 399

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ N+ L+   +E SR TLHRFGNTSSSSIWYELAY+EAKG+V  G 
Sbjct: 400 FCIHAGGRAVIDELEKNLQLQPVHVEASRMTLHRFGNTSSSSIWYELAYMEAKGRVRRGH 459

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW A+R +     +PW DCI  YP
Sbjct: 460 RIWQIAFGSGFKCNSAVWHALRNVNPSPESPWEDCIDRYP 499



 Score = 25.0 bits (53), Expect(2) = 1e-77
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  +SM IPN
Sbjct: 269  NWYFGNRKSMLIPN 282



>gb:AY308831_1597852 Marchantia polymorpha FAE1 gene, complete cds.
          Length = 527

 Score =  285 bits (730), Expect(2) = 5e-77
 Identities = 134/220 (60%), Positives = 171/220 (77%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A+LLSN+R +  RAKY+L H VRTHK ADD+ FR +YQ+ED++   G+ +
Sbjct: 300 PNCLFRVGGAAILLSNKRSEKRRAKYQLVHTVRTHKGADDKCFRCVYQEEDEKNFMGVSL 359

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I G+ALKTNITTLGPLVLP+SEQL+FF  LV   +F +   +PYIPD+KLAFDH
Sbjct: 360 SKDLMAIAGDALKTNITTLGPLVLPLSEQLLFFGILVARKVF-NMKVKPYIPDFKLAFDH 418

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ N+ L    +EPSR TLHRFGNTSSSSIWYEL Y+E+KG++  GD
Sbjct: 419 FCIHAGGRAVIDELEKNLQLTKDHVEPSRMTLHRFGNTSSSSIWYELNYIESKGRMKKGD 478

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+AVR ++ P   PW  CI +YP
Sbjct: 479 RVWQIAFGSGFKCNSAVWQAVRTLKPPARGPWTHCIDSYP 518



 Score = 26.2 bits (56), Expect(2) = 5e-77
 Identities = 10/14 (71%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  RSM IPN
Sbjct: 288  NWYYGNRRSMLIPN 301



>gb:AY183914_1587918 Marchantia polymorpha
           beta-ketoacyl-CoA-synthase gene, complete cds.
          Length = 537

 Score =  284 bits (727), Expect(2) = 3e-76
 Identities = 135/216 (62%), Positives = 170/216 (78%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+ ++  RAKY L H VRTHK AD + F  + Q+EDDEGK G+ +S++L
Sbjct: 312 FRMGGAAILLSNKMKERRRAKYELVHTVRTHKGADPKCFSCVVQEEDDEGKIGVSLSRDL 371

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALK NITTLGPLVLP+SEQ++FFATLV   LF     +PYIPD+KLAF+HFCI+
Sbjct: 372 MGVAGDALKANITTLGPLVLPLSEQILFFATLVGRKLF-KMKIKPYIPDFKLAFEHFCIH 430

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG+V  GDRLWQ
Sbjct: 431 AGGRAVLDELEKNLNLTEWHMEPSRMTLYRFGNTSSSSLWYELAYTEAKGRVRRGDRLWQ 490

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I FGSGFKCNSAVWRA+R ++ P  +PW D I ++P
Sbjct: 491 IAFGSGFKCNSAVWRALRTVKSPKQSPWADEIDSFP 526



 Score = 25.0 bits (53), Expect(2) = 3e-76
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRS  + N
Sbjct: 295  LNWYMGNDRSKMLSN 309



>gb:AY308830_1597851 Marchantia polymorpha FAE3 gene, complete cds.
          Length = 529

 Score =  284 bits (727), Expect(2) = 6e-76
 Identities = 135/216 (62%), Positives = 168/216 (77%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+RR+  RAKY L H VRTHK ADD+ FR +YQ+ED  G  G+ +S+EL
Sbjct: 309 FRMGGAAVLLSNKRRERRRAKYELLHTVRTHKGADDKCFRCVYQEEDSTGSLGVSLSREL 368

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G ALK NITTLGPLVLP+SEQ++FFA+LV    F +   +PYIPD+KLAF+HFCI+
Sbjct: 369 MAVAGNALKANITTLGPLVLPLSEQILFFASLV-ARKFLNMKMKPYIPDFKLAFEHFCIH 427

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EA+G+V  GDRLWQ
Sbjct: 428 AGGRAVLDELEKNLDLTEWHMEPSRMTLYRFGNTSSSSLWYELAYTEAQGRVKRGDRLWQ 487

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I FGSGFKCNSAVWRA+R ++ P  N W D I  +P
Sbjct: 488 IAFGSGFKCNSAVWRALRTVKPPVNNAWSDVIDRFP 523



 Score = 23.9 bits (50), Expect(2) = 6e-76
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRS  + N
Sbjct: 292  LNWYFGDDRSKLMSN 306



>pir|T00951|T00951 probable 3-oxoacyl-[acyl-carrier-protein]
           synthase (EC 2.3.1.41) F20D22.1 - Arabidopsis
           thaliana>gb:AE005172_889440 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F20D22_1677739 Arabidopsis thaliana
           chromosome 1 BAC F20D22 sequence, complete sequence.
          Length = 528

 Score =  280 bits (717), Expect(2) = 1e-75
 Identities = 137/223 (61%), Positives = 170/223 (76%), Gaps = 7/223 (3%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKK--GLKISK 810
           FRMG +A+LLSNR  D  R+KY+L H VRTHK +DD +F  +YQ+ED++  K  G+ +SK
Sbjct: 290 FRMGGAAVLLSNRSSDRCRSKYQLIHTVRTHKGSDDNAFNCVYQREDNDDNKQIGVSLSK 349

Query: 809 ELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFC 630
            L+ I GEALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAF+HFC
Sbjct: 350 NLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFNVKKIKPYIPDFKLAFEHFC 409

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           I+A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG++  GDR 
Sbjct: 410 IHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGDRT 469

Query: 449 WQIVFGSGFKCNSAVWRAVRRI-----RMPTANPWLDCIHTYP 336
           WQI FGSGFKCNSAVWRA+R I     +    NPW+D IH +P
Sbjct: 470 WQIAFGSGFKCNSAVWRALRTIDPSKEKKKKTNPWIDEIHEFP 512



 Score = 26.9 bits (58), Expect(2) = 1e-75
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 273  LNWYLGNDRSMLLSN 287



>gb:BT015917_1642535 Arabidopsis thaliana At1g04220 gene, complete
           cds.
          Length = 518

 Score =  280 bits (717), Expect(2) = 1e-75
 Identities = 137/223 (61%), Positives = 170/223 (76%), Gaps = 7/223 (3%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKK--GLKISK 810
           FRMG +A+LLSNR  D  R+KY+L H VRTHK +DD +F  +YQ+ED++  K  G+ +SK
Sbjct: 280 FRMGGAAVLLSNRSSDRCRSKYQLIHTVRTHKGSDDNAFNCVYQREDNDDNKQIGVSLSK 339

Query: 809 ELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFC 630
            L+ I GEALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAF+HFC
Sbjct: 340 NLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFNVKKIKPYIPDFKLAFEHFC 399

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           I+A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG++  GDR 
Sbjct: 400 IHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGDRT 459

Query: 449 WQIVFGSGFKCNSAVWRAVRRI-----RMPTANPWLDCIHTYP 336
           WQI FGSGFKCNSAVWRA+R I     +    NPW+D IH +P
Sbjct: 460 WQIAFGSGFKCNSAVWRALRTIDPSKEKKKKTNPWIDEIHEFP 502



 Score = 26.9 bits (58), Expect(2) = 1e-75
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 263  LNWYLGNDRSMLLSN 277



>gb:AC098832_1736894 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1268_B08, complete sequence.
          Length = 520

 Score =  280 bits (715), Expect(2) = 1e-75
 Identities = 137/220 (62%), Positives = 167/220 (75%), Gaps = 4/220 (1%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNR     R+KY+L H VRTH+ ADDR F  + Q+ED +GK G+ +SK+L
Sbjct: 293 FRMGGAAILLSNRGSARRRSKYQLVHTVRTHRGADDRCFGCVTQREDADGKTGVSLSKDL 352

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + GEALKTNITTLGPLVLP+SEQL+FFATLV   +      +PYIPD+KLAF+HFCI+
Sbjct: 353 MAVAGEALKTNITTLGPLVLPMSEQLLFFATLVTRKVL-KRKVKPYIPDFKLAFEHFCIH 411

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L D  MEPSR TLHRFGNTSSSS+WYELAY EAKG++  GDR WQ
Sbjct: 412 AGGRAVLDELEKNLQLSDWHMEPSRMTLHRFGNTSSSSLWYELAYAEAKGRIKKGDRTWQ 471

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPT----ANPWLDCIHTYP 336
           I FGSGFKCNSAVWRA+R +         NPW+D IH +P
Sbjct: 472 IAFGSGFKCNSAVWRALRSVNPAKENNFTNPWIDEIHRFP 511



 Score = 27.3 bits (59), Expect(2) = 1e-75
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 276  LNWYFGNDRSMLVSN 290



>pir|F84538|F84538 probable beta-ketoacyl-CoA synthase [imported] -
           Arabidopsis thaliana>gb:AC007047_1535082 Arabidopsis
           thaliana chromosome 2 clone F16F14 map mi398, complete
           sequence.
          Length = 512

 Score =  281 bits (718), Expect(2) = 5e-75
 Identities = 132/220 (60%), Positives = 170/220 (77%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G SA+LLSN+ +D  R+KY+L H VRTHK A +++F  +YQ++DD GK G+ +
Sbjct: 289 PNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVYQEQDDNGKTGVSL 348

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITTLGPLVLP+SEQ++FF TLV   LF +S  +PYIPD+KLAFDH
Sbjct: 349 SKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-NSKLKPYIPDFKLAFDH 407

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ N+ L    +E SR TLHRFGNTSSSSIWYELAY+EAKG++  G+
Sbjct: 408 FCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSSSIWYELAYIEAKGRMKKGN 467

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW A+  ++   ++PW  CI  YP
Sbjct: 468 RVWQIAFGSGFKCNSAVWVALNNVKPSVSSPWEHCIDRYP 507



 Score = 24.3 bits (51), Expect(2) = 5e-75
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  ++M IPN
Sbjct: 277  NWYFGNKKAMLIPN 290



>gb:AY074518_1567567 Arabidopsis thaliana putative beta-ketoacyl-CoA
           synthase (At1g04220) mRNA, partial cds.
          Length = 523

 Score =  278 bits (710), Expect(2) = 6e-75
 Identities = 136/223 (60%), Positives = 169/223 (75%), Gaps = 7/223 (3%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKK--GLKISK 810
           FRMG +A+LLSNR  D  R+KY+L H VRTHK +DD +F  +YQ+ED++  K  G+ +SK
Sbjct: 285 FRMGGAAVLLSNRSSDRCRSKYQLIHTVRTHKGSDDNAFNCVYQREDNDDNKQIGVSLSK 344

Query: 809 ELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFC 630
            L+ I GEALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAF+HFC
Sbjct: 345 NLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFNVKKIKPYIPDFKLAFEHFC 404

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           I+A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WY LAY EAKG++  GDR 
Sbjct: 405 IHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYGLAYSEAKGRIKRGDRT 464

Query: 449 WQIVFGSGFKCNSAVWRAVRRI-----RMPTANPWLDCIHTYP 336
           WQI FGSGFKCNSAVWRA+R I     +    NPW+D IH +P
Sbjct: 465 WQIAFGSGFKCNSAVWRALRTIDPSKEKKKKTNPWIDEIHEFP 507



 Score = 26.9 bits (58), Expect(2) = 6e-75
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 268  LNWYLGNDRSMLLSN 282



>gb:AY070727_1566879 Arabidopsis thaliana At1g68530/T26J14_10 mRNA,
           complete cds.>gb:AY093969_1575475 Arabidopsis thaliana
           At1g68530/T26J14_10 mRNA, complete cds.
          Length = 497

 Score =  281 bits (720), Expect(2) = 6e-75
 Identities = 130/220 (59%), Positives = 167/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+ +SNRR D  RAKY+L H+VRTH+ ADD+SF  +Y++ED EG  G+ +
Sbjct: 270 PNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGINL 329

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+F  +L+   +F +   +PYIPD+KLAF+H
Sbjct: 330 SKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-NPKWKPYIPDFKLAFEH 388

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+E+KG++  GD
Sbjct: 389 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRGD 448

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ P   PW DCI  YP
Sbjct: 449 RVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP 488



 Score = 23.1 bits (48), Expect(2) = 6e-75
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 258  NYYQGNERAMLLPN 271



>pir|T52308|T52308 very-long-chain fatty acid condensing enzyme CUT1
           [validated] - Arabidopsis thaliana>gb:AE005173_894474
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011915_1537546 Arabidopsis thaliana
           chromosome 1 BAC T26J14 genomic sequence, complete
           sequence.>gb:AF129511_1770660 Arabidopsis thaliana
           very-long-chain fatty acid condensing enzyme CUT1 (CUT1)
           mRNA, complete cds.
          Length = 497

 Score =  281 bits (720), Expect(2) = 6e-75
 Identities = 130/220 (59%), Positives = 167/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+ +SNRR D  RAKY+L H+VRTH+ ADD+SF  +Y++ED EG  G+ +
Sbjct: 270 PNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGINL 329

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+F  +L+   +F +   +PYIPD+KLAF+H
Sbjct: 330 SKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-NPKWKPYIPDFKLAFEH 388

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+E+KG++  GD
Sbjct: 389 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRGD 448

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ P   PW DCI  YP
Sbjct: 449 RVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP 488



 Score = 23.1 bits (48), Expect(2) = 6e-75
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 258  NYYQGNERAMLLPN 271



>gb:AY087518_1572548 Arabidopsis thaliana clone 36276 mRNA, complete
           sequence.
          Length = 492

 Score =  281 bits (720), Expect(2) = 6e-75
 Identities = 130/220 (59%), Positives = 167/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+ +SNRR D  RAKY+L H+VRTH+ ADD+SF  +Y++ED EG  G+ +
Sbjct: 265 PNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEGHVGINL 324

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+F  +L+   +F +   +PYIPD+KLAF+H
Sbjct: 325 SKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-NPKWKPYIPDFKLAFEH 383

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+E+KG++  GD
Sbjct: 384 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRGD 443

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ P   PW DCI  YP
Sbjct: 444 RVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP 483



 Score = 23.1 bits (48), Expect(2) = 6e-75
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 253  NYYQGNERAMLLPN 266



>gb:AY035030_1559808 Arabidopsis thaliana putative beta-ketoacyl-CoA
           synthase (At5g43760) mRNA, complete cds.
          Length = 529

 Score =  276 bits (705), Expect(2) = 2e-74
 Identities = 137/222 (61%), Positives = 168/222 (75%), Gaps = 6/222 (2%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDE----GKKGLKI 816
           FRMG +A+LLSNR  D  R+KY+L H VRTHK ADD +F  +YQ+ED+     GK G+ +
Sbjct: 296 FRMGGAAVLLSNRSSDRSRSKYQLIHTVRTHKGADDNAFGCVYQREDNNAEEAGKIGVSL 355

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK L+ I GEALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAF+H
Sbjct: 356 SKNLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFKVKKIKPYIPDFKLAFEH 415

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG++  GD
Sbjct: 416 FCIHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGD 475

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRI--RMPTANPWLDCIHTYP 336
           R WQI FGSGFKCNSAVW+A+R I       NPW+D I  +P
Sbjct: 476 RTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDFP 517



 Score = 26.9 bits (58), Expect(2) = 2e-74
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 279  LNWYLGNDRSMLLSN 293



>gb:AB026651_1517270 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQD19.>gb:AY150469_1585034 Arabidopsis thaliana
           beta-ketoacyl-CoA synthase (At5g43760) mRNA, complete
           cds.>gb:AF424620_1798958 Arabidopsis thaliana
           AT5g43760/MQD19_11 mRNA, complete cds.
          Length = 529

 Score =  276 bits (705), Expect(2) = 2e-74
 Identities = 137/222 (61%), Positives = 168/222 (75%), Gaps = 6/222 (2%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDE----GKKGLKI 816
           FRMG +A+LLSNR  D  R+KY+L H VRTHK ADD +F  +YQ+ED+     GK G+ +
Sbjct: 296 FRMGGAAVLLSNRSSDRSRSKYQLIHTVRTHKGADDNAFGCVYQREDNNAEETGKIGVSL 355

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK L+ I GEALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAF+H
Sbjct: 356 SKNLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFKVKKIKPYIPDFKLAFEH 415

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG++  GD
Sbjct: 416 FCIHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLWYELAYSEAKGRIKRGD 475

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRI--RMPTANPWLDCIHTYP 336
           R WQI FGSGFKCNSAVW+A+R I       NPW+D I  +P
Sbjct: 476 RTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDFP 517



 Score = 26.9 bits (58), Expect(2) = 2e-74
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 279  LNWYLGNDRSMLLSN 293



>pir|T05271|T05271 probable 3-oxoacyl-[acyl-carrier-protein]
           synthase (EC 2.3.1.41) - Arabidopsis
           thaliana>gb:ATCHRIV81_1547412 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 81.>gb:ATT4L20_1556055
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20
           (ESSA project).
          Length = 487

 Score =  278 bits (710), Expect(2) = 4e-74
 Identities = 130/220 (59%), Positives = 166/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G SA+LLSN+  D  R+KY+L H VRTHK +D+ +F  +YQ++D+  K G+ +
Sbjct: 263 PNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGSDENAFNCVYQEQDECLKTGVSL 322

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALKTNIT+LGPLVLP+SEQ++FFAT V   LF    ++PYIPD+KLA DH
Sbjct: 323 SKDLMAIAGEALKTNITSLGPLVLPISEQILFFATFVAKRLFNDKKKKPYIPDFKLALDH 382

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DEL+ ++ L    +E SR TLHRFGNTSSSSIWYELAY EAKG++  G+
Sbjct: 383 FCIHAGGRAVIDELEKSLKLSPKHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMRKGN 442

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW A+R +     NPW  CIH YP
Sbjct: 443 RVWQIAFGSGFKCNSAVWVALRNVEPSVNNPWEHCIHRYP 482



 Score = 24.3 bits (51), Expect(2) = 4e-74
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G  ++M IPN
Sbjct: 251  NWYFGNKKAMLIPN 264



>gb:AY642539_1619106 Brassica napus fatty acid elongase
           3-ketoacyl-CoA synthase gene, complete cds.
          Length = 528

 Score =  275 bits (704), Expect(2) = 5e-74
 Identities = 130/218 (59%), Positives = 168/218 (77%), Gaps = 2/218 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR+D  ++KY L ++VRTHK +DD+++  +YQKED+ G  G+ +++EL
Sbjct: 307 FRMGGAAILLSNRRQDRSKSKYELVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLAREL 366

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGP+VLP+SEQL+F  +LV   L      +PYIPD+KLAF+HFCI+
Sbjct: 367 MSVAGDALKTNITTLGPMVLPLSEQLMFLVSLVKRKLL-KLKVKPYIPDFKLAFEHFCIH 425

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE+Q N+ L+D  MEPSR TLHRFGNTSSSS+WYE+AY EAKG+V  GDRLWQ
Sbjct: 426 AGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAGDRLWQ 485

Query: 443 IVFGSGFKCNSAVWRAVRRIRMP--TANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +     T N W   I  YP
Sbjct: 486 IAFGSGFKCNSAVWKALRVVSTEELTGNAWAGSIENYP 523



 Score = 26.2 bits (56), Expect(2) = 5e-74
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 290  LNWYFGNDRSMLLCN 304



>pir|A84663|A84663 probable beta-ketoacyl-CoA synthase [imported] -
           Arabidopsis thaliana>gb:AC003105_1531081 Arabidopsis
           thaliana chromosome 2 clone F18A8 map B68, complete
           sequence.>gb:BT003854_1636982 Arabidopsis thaliana clone
           RAFL16-02-C13 (R50015) putative beta-ketoacyl-CoA
           synthase (At2g26640) mRNA, complete
           cds.>gb:BT005692_1638632 Arabidopsis thaliana clone
           U50015 putative beta-ketoacyl-CoA synthase (At2g26640)
           mRNA, complete cds.
          Length = 509

 Score =  276 bits (707), Expect(2) = 5e-74
 Identities = 137/217 (63%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+R D  R+KY L   VRTHK ADD+ F  I Q+ED   K G+ +SKEL
Sbjct: 285 FRMGGAAILLSNKRWDRRRSKYELVDTVRTHKGADDKCFGCITQEEDSASKIGVTLSKEL 344

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP SEQL+FFATLV   LF     +PYIPD+KLAF+HFCI+
Sbjct: 345 MAVAGDALKTNITTLGPLVLPTSEQLLFFATLVGRKLF-KMKIKPYIPDFKLAFEHFCIH 403

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG++  GDR+WQ
Sbjct: 404 AGGRAVLDELEKNLKLTEWHMEPSRMTLYRFGNTSSSSLWYELAYSEAKGRIKKGDRIWQ 463

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNS+VWRAVR +      NPW+D IH +P
Sbjct: 464 IAFGSGFKCNSSVWRAVRSVNPKKEKNPWMDEIHEFP 500



 Score = 25.0 bits (53), Expect(2) = 5e-74
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRS  + N
Sbjct: 268  LNWYFGNDRSKLVSN 282



>pir|F86141|F86141 protein T25K16.11 [imported] - Arabidopsis
           thaliana>gb:AE005172_889163 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007323_1535793 Genomic sequence for
           Arabidopsis thaliana BAC T25K16 from chromosome I,
           complete sequence.>gb:AY074285_1567445 Arabidopsis
           thaliana putative fatty acid elongase 3-ketoacyl-CoA
           synthase 1 (At1g01120) mRNA, complete
           cds.>gb:AY096568_1576108 Arabidopsis thaliana putative
           fatty acid elongase 3-ketoacyl-CoA synthase 1
           (At1g01120) mRNA, complete cds.
          Length = 528

 Score =  275 bits (703), Expect(2) = 7e-74
 Identities = 130/218 (59%), Positives = 169/218 (77%), Gaps = 2/218 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR+D  ++KY L ++VRTHK +DD+++  +YQKED+ G  G+ +++EL
Sbjct: 307 FRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLAREL 366

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGP+VLP+SEQL+F  +LV   +F     +PYIPD+KLAF+HFCI+
Sbjct: 367 MSVAGDALKTNITTLGPMVLPLSEQLMFLISLVKRKMF-KLKVKPYIPDFKLAFEHFCIH 425

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE+Q N+ L+D  MEPSR TLHRFGNTSSSS+WYE+AY EAKG+V  GDRLWQ
Sbjct: 426 AGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAGDRLWQ 485

Query: 443 IVFGSGFKCNSAVWRAVRRIRMP--TANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +     T N W   I  YP
Sbjct: 486 IAFGSGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYP 523



 Score = 26.2 bits (56), Expect(2) = 7e-74
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 290  LNWYFGNDRSMLLCN 304



>gb:SCU37088_1710216 Simmondsia chinensis beta-ketoacyl-CoA synthase
           mRNA, complete cds.
          Length = 521

 Score =  274 bits (700), Expect(2) = 7e-74
 Identities = 132/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A++LSNR RD  R+KY+L H VRTHK ADD+S+R + Q+ED+  K G+ +SK+L
Sbjct: 294 FRMGGAAIILSNRWRDRRRSKYQLLHTVRTHKGADDKSYRCVLQQEDENNKVGVALSKDL 353

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + GEALK NITTLGPLVLP+SEQL+FFATLV   +F  ++ +PYIPD+KLA  HFCI+
Sbjct: 354 MAVAGEALKANITTLGPLVLPMSEQLLFFATLVARKVFKMTNVKPYIPDFKLAAKHFCIH 413

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  K VLDEL+ N+ L    +EPSR TL+RFGNTSSSS+WYELAY EAKG++  GDR W 
Sbjct: 414 AGGKAVLDELETNLELTPWHLEPSRMTLYRFGNTSSSSLWYELAYAEAKGRIRKGDRTWM 473

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNS VWRA+R +      NPW+D I  +P
Sbjct: 474 IGFGSGFKCNSVVWRALRSVNPAREKNPWMDEIENFP 510



 Score = 27.3 bits (59), Expect(2) = 7e-74
 Identities = 11/15 (73%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM I N
Sbjct: 277  LNWYWGNDRSMLITN 291



>gb:AF053345_1764442 Arabidopsis thaliana fatty acid elongase
           3-ketoacyl-CoA synthase 1 (KCS1) gene, complete cds.
          Length = 520

 Score =  275 bits (703), Expect(2) = 7e-74
 Identities = 130/218 (59%), Positives = 169/218 (77%), Gaps = 2/218 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR+D  ++KY L ++VRTHK +DD+++  +YQKED+ G  G+ +++EL
Sbjct: 299 FRMGGAAILLSNRRQDRKKSKYSLVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLAREL 358

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGP+VLP+SEQL+F  +LV   +F     +PYIPD+KLAF+HFCI+
Sbjct: 359 MSVAGDALKTNITTLGPMVLPLSEQLMFLISLVKRKMF-KLKVKPYIPDFKLAFEHFCIH 417

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE+Q N+ L+D  MEPSR TLHRFGNTSSSS+WYE+AY EAKG+V  GDRLWQ
Sbjct: 418 AGGRAVLDEVQKNLDLKDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAGDRLWQ 477

Query: 443 IVFGSGFKCNSAVWRAVRRIRMP--TANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +     T N W   I  YP
Sbjct: 478 IAFGSGFKCNSAVWKALRPVSTEEMTGNAWAGSIDQYP 515



 Score = 26.2 bits (56), Expect(2) = 7e-74
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 282  LNWYFGNDRSMLLCN 296



>gb:AF458093_1801420 Persea americana fatty acid elongase mRNA,
           partial cds.
          Length = 261

 Score =  275 bits (702), Expect(2) = 7e-74
 Identities = 135/217 (62%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNR  D  R+KY+L H VRTH  ADDR+F  + Q+ED+ GK G+ +SK+L
Sbjct: 35  FRMGGAAILLSNRWSDRRRSKYQLVHTVRTHIGADDRAFNCVSQEEDEAGKVGVSLSKDL 94

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + I GEALK+NITTLGP+VLP+SEQL+FFATL    +F     +PYIPD+KLAF+HFCI+
Sbjct: 95  MVIAGEALKSNITTLGPMVLPMSEQLLFFATLAARKVF-KMKIKPYIPDFKLAFEHFCIH 153

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDELQ N+ L D  MEPSR TL+RFGNTSSSS+WYEL Y EAKG+V  GDR+WQ
Sbjct: 154 AGGRAVLDELQKNLELSDWQMEPSRMTLYRFGNTSSSSLWYELGYSEAKGRVMKGDRMWQ 213

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNSAVWRA+R +      +PW+D I ++P
Sbjct: 214 IAFGSGFKCNSAVWRALRSVNPAKEKSPWMDDIDSFP 250



 Score = 26.6 bits (57), Expect(2) = 7e-74
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWYSG +R+M + N
Sbjct: 18   LNWYSGNNRAMLVTN 32



>gb:AF082033_1766575 Hemerocallis hybrid cultivar
           senescence-associated protein 15 (SA15) mRNA, complete
           cds.
          Length = 517

 Score =  273 bits (699), Expect(2) = 1e-73
 Identities = 132/225 (58%), Positives = 166/225 (73%), Gaps = 9/225 (4%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+R+D  RAKYRL H VRTHK ADD  +  +YQ+ED+ GK G+ ++KEL
Sbjct: 291 FRMGGAAVLLSNKRKDAKRAKYRLLHTVRTHKGADDSCYNCVYQREDEGGKVGVSLAKEL 350

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP++EQ  F ATL+   L      RPYIP++K AF+HFC++
Sbjct: 351 MAVAGDALKTNITTLGPLVLPLTEQGKFLATLITRKLLKLKGVRPYIPNFKRAFEHFCVH 410

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE++ N+GL   DME SR+ LHRFGNTSSSS+WYELAY EAKG+V  GDR+WQ
Sbjct: 411 AGGRAVLDEVEKNLGLEKTDMEASRSVLHRFGNTSSSSLWYELAYNEAKGRVGKGDRVWQ 470

Query: 443 IVFGSGFKCNSAVWRAVRRI---------RMPTANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A++ +              NPW DCI  YP
Sbjct: 471 IGFGSGFKCNSAVWKAMKDVPAIDRTASGSSRMCNPWGDCIDRYP 515



 Score = 26.9 bits (58), Expect(2) = 1e-73
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 274  LNWYFGNDRSMLLSN 288



>gb:AP005008_1847226 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0544H11.>gb:AP005915_1860068 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0056C19.
          Length = 519

 Score =  268 bits (685), Expect(2) = 7e-73
 Identities = 130/220 (59%), Positives = 164/220 (74%), Gaps = 4/220 (1%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNR  +  R+KY L H VRTHK  DD+ F  + Q+ED EG  G+ +SK+L
Sbjct: 288 FRMGGAAILLSNRWSERRRSKYELVHTVRTHKGGDDKCFGCVTQEEDGEGNVGVALSKDL 347

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP+SEQL+F ATLV   L    + +PYIPD+KLAF+HFC++
Sbjct: 348 MAVAGDALKTNITTLGPLVLPLSEQLLFMATLVAKKLLKMKNVKPYIPDFKLAFEHFCVH 407

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE++ N+ L +  MEPSR TL+RFGNTSSSS+WYELAY EAKG+V   DR+WQ
Sbjct: 408 AGGRAVLDEIEKNLSLGEWQMEPSRMTLYRFGNTSSSSLWYELAYSEAKGRVRRRDRVWQ 467

Query: 443 IVFGSGFKCNSAVWRAVRRI----RMPTANPWLDCIHTYP 336
           I FGSGFKCNSAVWRA+R +         NPW+D I  +P
Sbjct: 468 IAFGSGFKCNSAVWRALRSVDPEEEALKKNPWMDEIDRFP 507



 Score = 29.6 bits (65), Expect(2) = 7e-73
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWYSG DRSM + N
Sbjct: 271  LNWYSGNDRSMLVSN 285



>gb:AY082610_1569189 Tropaeolum majus putative fatty acid elongase
           mRNA, complete cds.
          Length = 503

 Score =  275 bits (704), Expect = 8e-73
 Identities = 133/217 (61%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+  D  R+KYRL H VRTHK  +D  F  + +KED +GK G+ +SK L
Sbjct: 282 FRMGGAAILLSNKMSDRWRSKYRLVHTVRTHKGTEDNCFSCVTRKEDSDGKIGISLSKNL 341

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP+SEQL+FFATLV   +F    Q PYIPD+KLAF+HFCI+
Sbjct: 342 MAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKVFKMKLQ-PYIPDFKLAFEHFCIH 400

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L    MEPSR +L+RFGNTSSSS+WYELAY EAKG++  GDR+WQ
Sbjct: 401 AGGRAVLDELEKNLKLSSWHMEPSRMSLYRFGNTSSSSLWYELAYSEAKGRIKKGDRVWQ 460

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +      NPW+D IH +P
Sbjct: 461 IAFGSGFKCNSAVWKALRNVNPAEEKNPWMDEIHLFP 497



>gb:AY642538_1619105 Brassica napus fatty acid elongase
           3-ketoacyl-CoA synthase mRNA, complete cds.
          Length = 528

 Score =  271 bits (693), Expect(2) = 1e-72
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 2/218 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR+D  ++KY L ++VRTHK +DD+++  +YQKED+ G  G+ +++EL
Sbjct: 307 FRMGGAAILLSNRRQDRSKSKYELVNVVRTHKGSDDKNYNCVYQKEDERGTIGVSLAREL 366

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGP+VLP+S QL+F  +LV   L      +PYIPD+KLAF+HFCI+
Sbjct: 367 MSVAGDALKTNITTLGPMVLPLSGQLMFSVSLVKRKLL-KLKVKPYIPDFKLAFEHFCIH 425

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDE+Q N+ L D  MEPSR TLHRFGNTSSSS+WYE+AY EAKG+V  GDRLWQ
Sbjct: 426 AGGRAVLDEVQKNLDLEDWHMEPSRMTLHRFGNTSSSSLWYEMAYTEAKGRVKAGDRLWQ 485

Query: 443 IVFGSGFKCNSAVWRAVRRIRMP--TANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +     T N W   I  YP
Sbjct: 486 IAFGSGFKCNSAVWKALRVVSTEELTGNAWAGSIENYP 523



 Score = 26.2 bits (56), Expect(2) = 1e-72
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 290  LNWYFGNDRSMLLCN 304



>gb:AY088928_1573936 Arabidopsis thaliana clone 99793 mRNA, complete
           sequence.
          Length = 492

 Score =  272 bits (696), Expect(2) = 4e-72
 Identities = 127/220 (57%), Positives = 165/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LLSNRR D  RAKY+L H+VRTH+ ADD+S+  + ++ED  G  G+ +
Sbjct: 265 PNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGINL 324

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+F ++L+   +F +   +PYIPD+K AF+H
Sbjct: 325 SKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-NPKWKPYIPDFKQAFEH 383

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+EA+G++   D
Sbjct: 384 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRND 443

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ PT   W DCI  YP
Sbjct: 444 RVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP 483



 Score = 23.1 bits (48), Expect(2) = 4e-72
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 253  NYYKGNERAMLLPN 266



>pir|F86384|F86384 probable protein fatty acid condensing enzyme
           CUT1 [imported] - Arabidopsis
           thaliana>gb:AE005172_891466 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC079281_1732447 Arabidopsis thaliana
           chromosome 1 BAC F2J7 genomic sequence, complete
           sequence.
          Length = 492

 Score =  272 bits (696), Expect(2) = 4e-72
 Identities = 127/220 (57%), Positives = 165/220 (75%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LLSNRR D  RAKY+L H+VRTH+ ADD+S+  + ++ED  G  G+ +
Sbjct: 265 PNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGINL 324

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+F ++L+   +F +   +PYIPD+K AF+H
Sbjct: 325 SKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-NPKWKPYIPDFKQAFEH 383

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+EA+G++   D
Sbjct: 384 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRND 443

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ PT   W DCI  YP
Sbjct: 444 RVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP 483



 Score = 23.1 bits (48), Expect(2) = 4e-72
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 253  NYYKGNERAMLLPN 266



>gb:AP003623_1831642 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0642B07.
          Length = 519

 Score =  268 bits (686), Expect(2) = 1e-71
 Identities = 131/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR D  R+KY L H VRTHK A+D+ F  + Q+ED+ GK G+ +SK+L
Sbjct: 292 FRMGGAAILLSNRRSDRRRSKYELVHTVRTHKGANDKCFGCVTQEEDEIGKIGVSLSKDL 351

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP+SEQL+F ATLV   +      +PYIPD+KLAF+HFCI+
Sbjct: 352 MAVAGDALKTNITTLGPLVLPLSEQLLFMATLVAKKVL-KMKIKPYIPDFKLAFEHFCIH 410

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L D  MEPSR TL+RFGNTSSSS+WYELAY EAKG++   DR+WQ
Sbjct: 411 AGGRAVLDELEKNLELTDWHMEPSRMTLYRFGNTSSSSLWYELAYTEAKGRIRKRDRIWQ 470

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A++ +      NPW+D I  +P
Sbjct: 471 IAFGSGFKCNSAVWKALQTVNPAKEKNPWMDEIDNFP 507



 Score = 25.4 bits (54), Expect(2) = 1e-71
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G +RSM + N
Sbjct: 275  LNWYFGNNRSMLVSN 289



>gb:AF247134_1780576 Limnanthes douglasii fatty acid elongase 1-like
           protein mRNA, complete cds.
          Length = 505

 Score =  268 bits (686), Expect(2) = 1e-71
 Identities = 131/220 (59%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSN+  D  R+KY+L   VR+HK ADD  +  I+Q+ED  GK G+ +SK L
Sbjct: 286 FRMGGAAVLLSNKTSDKKRSKYQLVTTVRSHKGADDNCYGCIFQEEDSNGKIGVSLSKNL 345

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP+SEQL+FFATLV   +F     +PYIPD+KLAFDHFCI+
Sbjct: 346 MAVAGDALKTNITTLGPLVLPMSEQLLFFATLVARKVF-KKKIKPYIPDFKLAFDHFCIH 404

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L    +EPSR TL+RFGNTSSSS+WYELAY EAKG++  G+R+WQ
Sbjct: 405 AGGRAVLDELEKNLQLSSWHLEPSRMTLYRFGNTSSSSLWYELAYSEAKGRIRKGERVWQ 464

Query: 443 IVFGSGFKCNSAVWRAVRRI-RMPTANPWLDCIHTYPRAI 327
           I FGSGFKCNSAVW+A++ +      NPW+D IH +P A+
Sbjct: 465 IGFGSGFKCNSAVWKALKSVDPKKEKNPWMDEIHQFPVAV 504



 Score = 25.4 bits (54), Expect(2) = 1e-71
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRS  + N
Sbjct: 269  LNWYMGNDRSKLVSN 283



>gb:BT004205_1637301 Arabidopsis thaliana clone RAFL16-04-C18
           (R50146) putative fatty acid condensing enzyme CUT1
           (At1g25450) mRNA, complete cds.
          Length = 492

 Score =  269 bits (688), Expect(2) = 3e-71
 Identities = 126/220 (57%), Positives = 164/220 (74%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LLSNRR D  RAKY+L H+VRTH+ ADD+S+  + ++ED  G  G+ +
Sbjct: 265 PNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNGNVGINL 324

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I GEALK NITT+GPLVLP SEQL+  ++L+   +F +   +PYIPD+K AF+H
Sbjct: 325 SKDLMTIAGEALKANITTIGPLVLPASEQLLSLSSLIGRKIF-NPKWKPYIPDFKQAFEH 383

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ N+ L    +E SR TLHRFGNTSSSS+WYEL+Y+EA+G++   D
Sbjct: 384 FCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELSYIEAQGRMKRND 443

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+WQI FGSGFKCNSAVW+  R I+ PT   W DCI  YP
Sbjct: 444 RVWQIAFGSGFKCNSAVWKCNRTIKTPTDGAWSDCIERYP 483



 Score = 23.1 bits (48), Expect(2) = 3e-71
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 253  NYYKGNERAMLLPN 266



>gb:ZMA292770_1731494 Zea mays mRNA for putative fatty acid longase
           (fae2 gene).
          Length = 513

 Score =  266 bits (680), Expect(2) = 5e-71
 Identities = 129/217 (59%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNRR D  R+KY L H VRTHK A+D+ F  + Q+ED+ GK G+ +SK+L
Sbjct: 286 FRMGGAAILLSNRRSDRRRSKYELVHTVRTHKGANDKCFGCVTQEEDEIGKIGVSLSKDL 345

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP+SEQL+F  TL+   +      +PYIPD+KLAF+HFCI+
Sbjct: 346 MAVAGDALKTNITTLGPLVLPLSEQLLFMGTLIAKKVL-KMKIKPYIPDFKLAFEHFCIH 404

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLDEL+ N+ L D  MEPSR TL+RFGNTSSSS+WYELAY EAKG++   DR+WQ
Sbjct: 405 AGGRAVLDELEKNLELTDWHMEPSRMTLYRFGNTSSSSLWYELAYTEAKGRIRKRDRIWQ 464

Query: 443 IVFGSGFKCNSAVWRAVRRIR-MPTANPWLDCIHTYP 336
           I FGSGFKCNSAVW+A+R +      +PW+D I  +P
Sbjct: 465 IAFGSGFKCNSAVWKALRTVNPAKEKSPWMDEIDNFP 501



 Score = 25.4 bits (54), Expect(2) = 5e-71
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G +RSM + N
Sbjct: 269  LNWYFGNNRSMLVSN 283



>gb:AF214499S2_1777843 Arabidopsis thaliana fiddlehead protein (fdh)
           gene, fdh-5 allele, complete cds.
          Length = 508

 Score =  254 bits (650), Expect(2) = 8e-69
 Identities = 131/207 (63%), Positives = 155/207 (74%), Gaps = 25/207 (12%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302 PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLV----------------------- 705
           S++L+ +GGEALKTNITTLGPLVLP SEQL+FFA L+                       
Sbjct: 362 SRDLMEVGGEALKTNITTLGPLVLPFSEQLLFFAALLRRTFSPAAKTSTTTSFSTSATAK 421

Query: 704 WGHLFGSSSQ--RPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRF 531
              +  SSS   +PYIPDYKLAF+HFC +A SKVVL+ELQ N+GL + +ME SR TLHRF
Sbjct: 422 TNGIKSSSSDLSKPYIPDYKLAFEHFCFHAASKVVLEELQKNLGLSEENMEASRMTLHRF 481

Query: 530 GNTSSSSIWYELAYLEAKGKVAGGDRL 450
           GNTSSS IWYELAY+EAK  V  GDR+
Sbjct: 482 GNTSSSGIWYELAYMEAKESVRRGDRV 508



 Score = 29.6 bits (65), Expect(2) = 8e-69
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>gb:AF490459_1804782 Brassica napus 3-ketoacyl-CoA synthase gene,
           complete cds.
          Length = 506

 Score =  262 bits (669), Expect = 9e-69
 Identities = 120/216 (55%), Positives = 159/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+ RD  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPRDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIERYP 487



>gb:AF490460_1804783 Brassica oleracea 3-ketoacyl-CoA synthase gene,
           complete cds.
          Length = 506

 Score =  261 bits (668), Expect = 1e-68
 Identities = 120/216 (55%), Positives = 159/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+ RD  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPRDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AE016959_1021031 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087723_1734156
           Oryza sativa chromosome 10 clone OSJNBa0036D19, complete
           sequence.>gb:AE017059_1750850 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 13 of 77 of the
           complete sequence.
          Length = 598

 Score =  256 bits (655), Expect(2) = 1e-68
 Identities = 121/200 (60%), Positives = 157/200 (78%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A LLS+R  D  RAKYRL H VRTHK A D  F ++YQ+ED+ G+ G+ +++EL
Sbjct: 299 FRMGGAAALLSSRGGDARRAKYRLLHTVRTHKGAADGCFGSVYQREDERGRVGVSLAREL 358

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
           + + G+ALKTNITTLGPLVLP++EQL F  +LV   +    ++RPYIPD++ AF+HFC++
Sbjct: 359 MAVAGDALKTNITTLGPLVLPLAEQLKFLRSLVLRRVLRRGARRPYIPDFRRAFEHFCVH 418

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VL+E+Q ++GL DGDME S+  LHRFGNTSSSS+WYELAY EAKG+V  G R+WQ
Sbjct: 419 AGGRAVLEEVQRSLGLGDGDMEASKCALHRFGNTSSSSLWYELAYAEAKGRVRRGHRVWQ 478

Query: 443 IVFGSGFKCNSAVWRAVRRI 384
           I FGSGFKCNSAVWRA+R +
Sbjct: 479 IGFGSGFKCNSAVWRALRDV 498



 Score = 26.9 bits (58), Expect(2) = 1e-68
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            LNWY G DRSM + N
Sbjct: 282  LNWYFGNDRSMLLSN 296



>gb:BJU558198_1633054 Brassica juncea fae1.2 gene for
           beta-ketoacyl-CoA synthase FAE1.2, allele E2.
          Length = 506

 Score =  259 bits (662), Expect = 6e-68
 Identities = 119/216 (55%), Positives = 159/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+ RD  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPRDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMAKKLFKDKVKHYYVPDFKLAVDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALSNVKASTNSPWEHCIDRYP 487



>gb:AX358197_1466208 Sequence 41 from Patent WO0194565.
          Length = 506

 Score =  259 bits (662), Expect = 6e-68
 Identities = 119/216 (55%), Positives = 158/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G++ WQ
Sbjct: 392 AGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKAWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALRNVKASANSPWQHCIDRYP 487



>gb:AE016959_1022579 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017094_1752398
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 48 of 77 of the complete sequence.
          Length = 523

 Score =  258 bits (660), Expect = 1e-67
 Identities = 131/221 (59%), Positives = 165/221 (74%), Gaps = 5/221 (2%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDY-GRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKE 807
           FR+G +A+LLSNR  D  GRAKY+L H VRTH+ A D+SF  + Q+EDD G+ G+ +SKE
Sbjct: 286 FRVGGAAILLSNRAADRRGRAKYQLIHTVRTHRGAHDQSFGCVTQEEDDAGEVGVSLSKE 345

Query: 806 LVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCI 627
           L+ + GEALKTNITTLGPLVLP+SEQL F AT+V   +F  +  + Y+PD+KLA DHFCI
Sbjct: 346 LMVVAGEALKTNITTLGPLVLPISEQLRFLATVVLKRVF-RADVKAYLPDFKLALDHFCI 404

Query: 626 YAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLW 447
           +A  + VLDEL+ ++ L   DMEPSR TL+RFGNTSSSS+WYELAY EAKG++  GDR+W
Sbjct: 405 HAGGRGVLDELEKSLKLSPWDMEPSRMTLYRFGNTSSSSLWYELAYCEAKGRIKRGDRVW 464

Query: 446 QIVFGSGFKCNSAVWRAVRRIRMPTA----NPWLDCIHTYP 336
           QI FGSGFKCNSAVWRA+R +         NPW+  +   P
Sbjct: 465 QIAFGSGFKCNSAVWRALRTVDAAGLDAGDNPWMKEVDMLP 505



>pir|T07900|T07900 probable 3-oxoacyl-[acyl-carrier-protein]
           synthase (EC 2.3.1.41) FAE1 - rape>gb:AX358161_1466190
           Sequence 5 from Patent WO0194565.>gb:BNU50771_1633690
           Brassica napus fatty acid elongase (FAE1) homolog mRNA,
           complete cds.
          Length = 505

 Score =  258 bits (659), Expect = 1e-67
 Identities = 118/216 (54%), Positives = 158/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+ RD  R+KY L H VRTH  ADD+SFR + Q +D+ G+ G+ +SK++
Sbjct: 271 FRVGGAAILLSNKPRDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGQTGVSLSKDI 330

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 331 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDEIKHYYVPDFKLAIDHFCIH 390

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+E KG++  G+++WQ
Sbjct: 391 AGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSSIWYELAYIEPKGRMKKGNKVWQ 450

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 451 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 486



>gb:AX358191_1466205 Sequence 35 from Patent WO0194565.
          Length = 506

 Score =  258 bits (658), Expect = 2e-67
 Identities = 119/216 (55%), Positives = 158/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY+L H VRTH  ADD+SFR + Q++D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKSGDRRRSKYKLVHTVRTHTGADDKSFRCVQQEDDESGKIGVCLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  NI TLGPL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI+
Sbjct: 332 TNVAGTTLTKNIATLGPLILPLSEKFLFFATFVAKKLLKDKIKHYYVPDFKLAVDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G++ WQ
Sbjct: 392 AGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKAWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALRNVKASANSPWQHCIDRYP 487



>gb:AX358183_1466201 Sequence 27 from Patent WO0194565.
          Length = 506

 Score =  258 bits (658), Expect = 2e-67
 Identities = 119/216 (55%), Positives = 158/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY+L H VRTH  ADD+SFR + Q++D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKSGDRRRSKYKLVHTVRTHTGADDKSFRCVQQEDDESGKIGVCLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  NI TLGPL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI+
Sbjct: 332 TNVAGTTLTKNIATLGPLILPLSEKFLFFATFVAKKLLKDKIKHYYVPDFKLAVDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G++ WQ
Sbjct: 392 AGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKAWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALRNVKASANSPWQHCIDRYP 487



>pir|T05272|T05272 fatty acid elongase 1 - Arabidopsis
           thaliana>gb:AX358157_1466188 Sequence 1 from Patent
           WO0194565.>gb:ATCHRIV81_1547413 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 81.>gb:ATT4L20_1556056
           Arabidopsis thaliana DNA chromosome 4, BAC clone T4L20
           (ESSA project).>gb:ATU29142_1556883 Arabidopsis thaliana
           fatty acid elongase 1 (Fae1) gene, complete cds.
          Length = 506

 Score =  258 bits (658), Expect = 2e-67
 Identities = 119/216 (55%), Positives = 158/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY+L H VRTH  ADD+SFR + Q++D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKSGDRRRSKYKLVHTVRTHTGADDKSFRCVQQEDDESGKIGVCLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  NI TLGPL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI+
Sbjct: 332 TNVAGTTLTKNIATLGPLILPLSEKFLFFATFVAKKLLKDKIKHYYVPDFKLAVDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G++ WQ
Sbjct: 392 AGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKAWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALRNVKASANSPWQHCIDRYP 487



>gb:AX358187_1466203 Sequence 31 from Patent WO0194565.
          Length = 506

 Score =  256 bits (655), Expect = 4e-67
 Identities = 118/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G++ WQ
Sbjct: 392 AGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKAWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALRNVKASANSPWQHCIDRYP 487



>gb:AF490461_1804784 Brassica rapa 3-ketoacyl-CoA synthase gene,
           complete cds.
          Length = 506

 Score =  255 bits (652), Expect = 9e-67
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:BJU558197_1633053 Brassica juncea fae1.1 gene for
           beta-ketoacyl-CoA synthase FAE1.1, allele E1.
          Length = 506

 Score =  255 bits (652), Expect = 9e-67
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AF274750_1782491 Brassica napus beta-ketoacyl-CoA synthase
           (FAE1.1) mRNA, complete cds.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358195_1466207 Sequence 39 from Patent WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358193_1466206 Sequence 37 from Patent WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358177_1466198 Sequence 21 from Patent WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358175_1466197 Sequence 19 from Patent WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358173_1466196 Sequence 17 from Patent WO0194565.
          Length = 505

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 271 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 330

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 331 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 390

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 391 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 450

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 451 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 486



>gb:AX358171_1466195 Sequence 15 from Patent WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX127155_1461718 Sequence 2 from Patent
           WO0129238.>gb:AX358189_1466204 Sequence 33 from Patent
           WO0194565.
          Length = 506

 Score =  254 bits (650), Expect = 2e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>pir|D84906|D84906 probable beta-ketoacyl-CoA synthase [imported] -
           Arabidopsis thaliana>gb:AC005819_1533024 Arabidopsis
           thaliana chromosome 2 clone T3A4 map CIC06C03, complete
           sequence.>gb:AF188485_1775229 Arabidopsis thaliana
           putative 3-keto-acyl-CoA synthase (HIC) gene, complete
           cds.
          Length = 466

 Score =  252 bits (644), Expect(2) = 2e-66
 Identities = 123/223 (55%), Positives = 158/223 (70%), Gaps = 3/223 (1%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A++LSNR +D  R+KY L HIVRTHK + D+ +    QKED +G  G+ +
Sbjct: 241 PNCLFRVGGAAVMLSNRSQDRVRSKYELTHIVRTHKGSSDKHYTCAEQKEDSKGIVGVAL 300

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SKEL  + G++LKTN+T LGPLVLP+SE+L F   LV   LF      PY+PD+KL F H
Sbjct: 301 SKELTVVAGDSLKTNLTALGPLVLPLSEKLRFILFLVKSKLFRLKVS-PYVPDFKLCFKH 359

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + +LD ++  +GL + D+EPSR TLHRFGNTSSSS+WYELAY+EAK +V  GD
Sbjct: 360 FCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLHRFGNTSSSSLWYELAYVEAKCRVKRGD 419

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRI---RMPTANPWLDCIHTYP 336
           R+WQ+ FGSGFKCNS VWRA+R I        NPW D +H YP
Sbjct: 420 RVWQLAFGSGFKCNSIVWRALRTIPANESLVGNPWGDSVHKYP 462



 Score = 24.3 bits (51), Expect(2) = 2e-66
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            L+ Y G DRSM +PN
Sbjct: 228  LSMYRGNDRSMLVPN 242



>gb:ATAC009400_1542962 Arabidopsis thaliana chromosome III BAC
           F14P13 genomic sequence, complete sequence.
          Length = 459

 Score =  252 bits (643), Expect(2) = 2e-66
 Identities = 123/223 (55%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A++LSNR +D  R+KY L HIVRTHK + D+ +    QKED +G  G+ +
Sbjct: 234 PNCLFRVGGAAVMLSNRSQDRVRSKYELTHIVRTHKGSSDKHYTCAEQKEDSKGIVGVAL 293

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SKEL  + G+ LKTN+T LGPLVLP+SE+L F   LV   LF      PY+PD+KL F H
Sbjct: 294 SKELTVVAGDTLKTNLTALGPLVLPLSEKLRFILFLVKSKLFRLKVS-PYVPDFKLCFKH 352

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + +LD ++  +GL + D+EPSR TLHRFGNTSSSS+WYELAY+EAK +V  GD
Sbjct: 353 FCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLHRFGNTSSSSLWYELAYVEAKCRVKRGD 412

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRI---RMPTANPWLDCIHTYP 336
           R+WQ+ FGSGFKCNS VWRA+R I        NPW D +H YP
Sbjct: 413 RVWQLAFGSGFKCNSIVWRALRTIPANESLVGNPWGDSVHKYP 455



 Score = 24.3 bits (51), Expect(2) = 2e-66
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPN 989
            L+ Y G DRSM +PN
Sbjct: 221  LSMYRGNDRSMLVPN 235



>gb:AX358185_1466202 Sequence 29 from Patent WO0194565.
          Length = 506

 Score =  253 bits (646), Expect = 4e-66
 Identities = 117/216 (54%), Positives = 157/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY+L H VRTH  ADD+SFR + Q++D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKSGDRRRSKYKLVHTVRTHTGADDKSFRCVQQEDDESGKIGVCLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  NI TLGPL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI+
Sbjct: 332 TNVAGTTLTKNIATLGPLILPLSEKFLFFATFVAKKLLKDKIKHYYVPDFKLAVDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX351158_1466033 Sequence 1 from Patent
           WO0190364.>gb:AF367052_1791700 Lesquerella fendleri
           3-ketoacyl-CoA synthase (KCS3) gene, complete cds.
          Length = 496

 Score =  253 bits (645), Expect = 6e-66
 Identities = 117/216 (54%), Positives = 159/216 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+ RD  R+KY+L H VRTH  ADD S+R + Q+ED+ GK G+++SK++
Sbjct: 270 FRIGGAAILLSNKPRDKRRSKYKLAHTVRTHTGADDMSYRCVQQEEDEMGKVGVRLSKDI 329

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G A+K NI+TLGPL+LP+SE+L++F + +   L     +  Y+PD KLA +HFCI+
Sbjct: 330 TTVAGTAVKKNISTLGPLILPLSEKLLYFVSFIAKKLLKEKIKNYYVPDLKLAINHFCIH 389

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + VLD L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  GD+ WQ
Sbjct: 390 AGGRGVLDVLEKNLRLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGDKAWQ 449

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct: 450 IALGSGFKCNSAVWVALRNVKASANSPWEHCIDRYP 485



>gb:AF490462_1804785 Brassica napus 3-ketoacyl-CoA synthase gene,
           complete cds.
          Length = 506

 Score =  252 bits (644), Expect = 8e-66
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LL N+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLFNKPGDRRRSKYELVHTVRTHAGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358181_1466200 Sequence 25 from Patent WO0194565.
          Length = 506

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358179_1466199 Sequence 23 from Patent WO0194565.
          Length = 506

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358169_1466194 Sequence 13 from Patent WO0194565.
          Length = 506

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358167_1466193 Sequence 11 from Patent WO0194565.
          Length = 506

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358165_1466192 Sequence 9 from Patent WO0194565.
          Length = 505

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 271 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 330

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 331 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 390

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 391 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 450

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 451 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 486



>pir|T07934|T07934 probable 3-oxoacyl-[acyl-carrier-protein]
           synthase (EC 2.3.1.41) fae1 - rape>gb:AX358159_1466189
           Sequence 3 from Patent WO0194565.>gb:AF009563_1761112
           Brassica napus 3-ketoacyl-CoA synthase (fae1) mRNA,
           complete cds.
          Length = 506

 Score =  252 bits (643), Expect = 1e-65
 Identities = 116/216 (53%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>gb:AX358163_1466191 Sequence 7 from Patent WO0194565.
          Length = 506

 Score =  250 bits (639), Expect = 3e-65
 Identities = 115/216 (53%), Positives = 155/216 (71%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  AD +SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADGKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+E KG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEXKGRMKKGNKVWQ 451

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++  T +PW  CI  YP
Sbjct: 452 IALGSGFKCNSAVWVALNNVKASTNSPWEHCIDRYP 487



>pir|T04771|T04771 fatty acid elongase homolog F10M10.20 -
           Arabidopsis thaliana>gb:ATCHRIV81_1547386 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           81.>gb:ATF10M10_1548129 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F10M10 (ESSA project).
          Length = 493

 Score =  249 bits (635), Expect = 8e-65
 Identities = 120/216 (55%), Positives = 152/216 (70%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSNR  D  RAKY L H VR H  ADDRS+    Q+ED++G  G+ +SK L
Sbjct: 270 FRIGGAAILLSNRSIDRKRAKYELVHTVRVHTGADDRSYECATQEEDEDGIVGVSLSKNL 329

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             +    LK NI TLGPLVLP+SE+  FF   V    F +   + YIPD+KLAF+HFCI+
Sbjct: 330 PMVAARTLKINIATLGPLVLPISEKFHFFVRFV-KKKFLNPKLKHYIPDFKLAFEHFCIH 388

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + ++DE++ N+ L   D+E SR TLHRFGNTSSSSIWYELAY EAKG++  GDR+WQ
Sbjct: 389 AGGRALIDEMEKNLHLTPLDVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMTKGDRIWQ 448

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNS+VW A+R ++  T NPW  C+H YP
Sbjct: 449 IALGSGFKCNSSVWVALRNVKPSTNNPWEQCLHKYP 484



>gb:AC105729_1738003 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1607A12, complete sequence.
          Length = 524

 Score =  248 bits (632), Expect = 2e-64
 Identities = 121/202 (59%), Positives = 157/202 (77%), Gaps = 2/202 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKA-ADDRSFRAIYQKEDDEGKKGLKISKE 807
           FRMG +A+LLSNRR +  RAKY+L H VRTH+  A DRS+  + Q+ED  G  G+ +SKE
Sbjct: 271 FRMGGAAVLLSNRRAERRRAKYQLMHTVRTHRGGASDRSYACVTQEEDGAGNVGVSLSKE 330

Query: 806 LVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFG-SSSQRPYIPDYKLAFDHFC 630
           L+ + G+AL+TNITTLGPLVLP+SEQL F AT+V   +FG ++  +PY+PD+  A DHFC
Sbjct: 331 LMSVAGDALRTNITTLGPLVLPLSEQLRFLATVVLRRVFGHAAGVKPYLPDFTAALDHFC 390

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           I+A  + VLDEL+ ++ L    MEPSR TL+RFGNTSSSS+WYEL+Y EAKG++  GDR+
Sbjct: 391 IHAGGRGVLDELERSLKLSAWHMEPSRMTLYRFGNTSSSSLWYELSYCEAKGRIRRGDRV 450

Query: 449 WQIVFGSGFKCNSAVWRAVRRI 384
           WQI FGSGFKCNSAVW+A+R +
Sbjct: 451 WQIAFGSGFKCNSAVWKALRTV 472



>gb:AY695435_1623508 Lesquerella fendleri 3-ketoacyl-CoA synthase
           (KCS45) gene, complete cds.
          Length = 487

 Score =  244 bits (624), Expect = 2e-63
 Identities = 113/216 (52%), Positives = 156/216 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  +  R+KY+L H VRTH  ADD+SFR + Q++DD GK G+ ++K++
Sbjct: 268 FRLGGAAILLSNKSGERRRSKYKLLHTVRTHTGADDKSFRCVQQEDDDMGKTGVSLTKDI 327

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             +    +  NI TLGPLVLP+SE+++FF T +    F +   + YIPD+K A DHFCI+
Sbjct: 328 TSVASRTITKNIATLGPLVLPISEKILFFITYIHKK-FVNDKVKHYIPDFKRAIDHFCIH 386

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + ++DEL+ N+GL   D+EPSR+TLHRFGNTSSSSIWYELAY EAKG++  G++ WQ
Sbjct: 387 AGGRALIDELEKNLGLLPIDVEPSRSTLHRFGNTSSSSIWYELAYTEAKGRMKKGNKAWQ 446

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNSAVW A+  ++    +PW  C+  YP
Sbjct: 447 IALGSGFKCNSAVWVALCDVKPSVNSPWEHCLDKYP 482



>pir|H84524|H84524 probable fatty acid elongase [imported] -
           Arabidopsis thaliana>gb:AC005957_1533259 Arabidopsis
           thaliana chromosome 2 clone T15J14 map mi398, complete
           sequence.
          Length = 476

 Score =  243 bits (620), Expect = 5e-63
 Identities = 119/216 (55%), Positives = 150/216 (69%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSNR RD  RAKY L H VR H  +DDRSF    Q+ED++G  G+ ++K L
Sbjct: 257 FRVGGAAVLLSNRSRDRNRAKYELVHTVRIHTGSDDRSFECATQEEDEDGIIGVTLTKNL 316

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             +    LK NI TLGPLVLP+ E+L FF T V    F     R Y PD+KLAF+HFCI+
Sbjct: 317 PMVAARTLKINIATLGPLVLPLKEKLAFFITFVKKKYF-KPELRNYTPDFKLAFEHFCIH 375

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + ++DEL+ N+ L    +E SR TLHRFGNTSSSSIWYELAY EAKG++  GDR+WQ
Sbjct: 376 AGGRALIDELEKNLKLSPLHVEASRMTLHRFGNTSSSSIWYELAYTEAKGRMKEGDRIWQ 435

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  GSGFKCNS+VW A+R ++    +PW DC+  YP
Sbjct: 436 IALGSGFKCNSSVWVALRDVKPSANSPWEDCMDRYP 471



>gb:AF333040_1787301 Dunaliella salina beta-ketoacyl-CoA synthase
           mRNA, partial cds.
          Length = 621

 Score =  236 bits (601), Expect(2) = 8e-63
 Identities = 114/205 (55%), Positives = 150/205 (73%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A+LLSNRRRD  RAKY L+H+VRTH  A D+++  I+Q EDDE   G+++
Sbjct: 384 PNCLFRVGGAAMLLSNRRRDGLRAKYELQHVVRTHLGAKDQAYGCIFQTEDDEDNVGVRL 443

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           +KEL+ + GEALK N+TTLGPLVLP+SEQ +F   L+    F +   +PYIPD+KLAFD 
Sbjct: 444 TKELMAVAGEALKVNVTTLGPLVLPISEQALFIFNLIVRKTF-NKKLKPYIPDFKLAFDK 502

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
            CI+   + V+DE++  + L    +EPSRA L R+GN SSSSIWY LAY+E+   V  GD
Sbjct: 503 ICIHTGGRAVIDEIEKQLRLTPEMVEPSRAVLFRYGNVSSSSIWYVLAYMESIEGVKRGD 562

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIR 381
           R+WQ+ FGSGFKCNSAVWR+ RRI+
Sbjct: 563 RIWQLGFGSGFKCNSAVWRSKRRIK 587



 Score = 28.5 bits (62), Expect(2) = 8e-63
 Identities = 10/14 (71%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G DRSM +PN
Sbjct: 372  NWYFGNDRSMLLPN 385



>gb:AP004888_1846680 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005319_1850517 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643A10.
          Length = 485

 Score =  237 bits (605), Expect(2) = 1e-61
 Identities = 118/223 (52%), Positives = 154/223 (69%), Gaps = 3/223 (1%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LLS       +A++RL  +VRT   A D ++  +YQ+ED  G  G+ +
Sbjct: 262 PNCLFRMGGAAVLLSTNG---AKARFRLARVVRTLTGAQDGAYHCVYQEEDGRGNVGINL 318

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I G+ALK NITT+GPLVLP SEQL+F  + +   +  S   +PYIPD++ AF+H
Sbjct: 319 SKDLMSIAGDALKANITTMGPLVLPASEQLLFALSFMARKVL-SGRIKPYIPDFRTAFEH 377

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ ++ L D  +E SR TLHRFGNTSSSS+WYELAY+EAKG++  GD
Sbjct: 378 FCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSLWYELAYVEAKGRMRKGD 437

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTAN---PWLDCIHTYP 336
           R+W I FGSGFKCNSA W  +R    P AN   PW  CIH YP
Sbjct: 438 RVWMIGFGSGFKCNSAAWECIR----PAANADGPWATCIHRYP 476



 Score = 23.1 bits (48), Expect(2) = 1e-61
 Identities = 7/14 (50%), Positives = 12/14 (85%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G++R+M +PN
Sbjct: 250  NYYMGQERAMLLPN 263



>gb:AF114171_1769156 Sorghum bicolor BAC clone 25.M18, complete
           sequence.>gb:AF527808_1808429 Sorghum bicolor clone BAC
           SBTXS_0040L6 php200725 orthologous region.
          Length = 532

 Score =  238 bits (607), Expect = 1e-61
 Identities = 124/237 (52%), Positives = 159/237 (67%), Gaps = 17/237 (7%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LL+N   +  RAKY+L H VRTH+ ADDR++R +YQ+ED+ G  G+ +
Sbjct: 282 PNCIFRMGGAAVLLTNHGTERRRAKYQLLHTVRTHQGADDRAYRCVYQEEDESGHVGVAL 341

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF------------GSSSQR 672
           SK+L+ +  EALKTNITTLGP VLP+SE++     LV G               G S  R
Sbjct: 342 SKDLMSVAAEALKTNITTLGPRVLPMSEKMKMM--LVGGKAAVVQVLGVQQQGQGGSRSR 399

Query: 671 PYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELA 492
           PYIPD   AF+HFCI+A  + VLD ++ ++ L    MEPSR TL+R+GNTSSSS+WYELA
Sbjct: 400 PYIPDLTTAFEHFCIHAGGRAVLDTVERSLDLSAWHMEPSRMTLYRWGNTSSSSLWYELA 459

Query: 491 YLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRI-----RMPTANPWLDCIHTYP 336
           Y EAKG+V  G R+ QI FGSGFKCNSAVWRA+R I          NPW++ IH +P
Sbjct: 460 YTEAKGRVRRGHRVCQIAFGSGFKCNSAVWRALRTIDPAKESAAAGNPWVEEIHRFP 516



>gb:AP004740_1844144 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0092H22.
          Length = 492

 Score =  234 bits (597), Expect(2) = 4e-61
 Identities = 112/220 (50%), Positives = 154/220 (70%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A+LLS  R    +A++RL  +VRT   A D ++R ++Q+ED EG +G+ +
Sbjct: 269 PNCLFRMGGAAVLLSTSR---AKARFRLSRVVRTLTGAQDSAYRCVFQEEDGEGHRGINL 325

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I G++LK NIT +GPLVLP SEQL+F  + +   +  +   +PY+PD+++AF+H
Sbjct: 326 SKDLMTIAGDSLKANITAIGPLVLPASEQLLFALSFIARRVL-NRRVKPYLPDFRMAFEH 384

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ ++GL D  +E SR  LHRFGNTSSSS+WYELAY+EAKG++  GD
Sbjct: 385 FCIHAGGRAVIDELQRSLGLSDEHVEASRMALHRFGNTSSSSVWYELAYIEAKGRMRPGD 444

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+W I FGSGFKCNSA W  +   R     PW D I  YP
Sbjct: 445 RVWMIGFGSGFKCNSAAWECISPAR-NADGPWADSICRYP 483



 Score = 24.3 bits (51), Expect(2) = 4e-61
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y GK+R+M +PN
Sbjct: 257  NYYVGKERAMLLPN 270



>gb:BJFAE1_1633024 B.juncea fae1 gene.
          Length = 509

 Score =  234 bits (597), Expect = 2e-60
 Identities = 111/216 (51%), Positives = 148/216 (68%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D++GK G+ +SK++
Sbjct: 275 FRVGGAAILLSNKSGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDEDGKIGVCLSKDI 334

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  NI    PL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI 
Sbjct: 335 TNVAGTTLTKNIAICRPLILPLSEKFLFFATSVAMKLLKDKIKHYYVPDFKLAVDHFCIQ 394

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
              + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+E K ++  G++ WQ
Sbjct: 395 PGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEPKERLKKGNKGWQ 454

Query: 443 IVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           I  G GFKCNSAVW A+  ++    +PW  CI  YP
Sbjct: 455 IALGLGFKCNSAVWVALNNVKASANSPWEHCIDRYP 490



>gb:AB023028_1515302 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K20J1.
          Length = 464

 Score =  226 bits (577), Expect(2) = 4e-59
 Identities = 109/217 (50%), Positives = 150/217 (69%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+L+S+   D   AKY L H+VR +KA DDR++R IYQ  D + K+G+ I+K++
Sbjct: 236 FRMGAAAVLMSSNDHDRDNAKYELLHVVRKNKAKDDRAYRCIYQDIDSDEKQGVSITKDV 295

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFAT-LVWGHLFGSSSQRPYIPDYKLAFDHFCI 627
           + + G+ LK N+T+LGPLVLP  EQ  +    ++   L    S   Y P++K AF+HFCI
Sbjct: 296 ISVAGDMLKMNLTSLGPLVLPYLEQFQYVIQHILCKKLKIYESNSSYTPNFKTAFEHFCI 355

Query: 626 YAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLW 447
           +   + V+  ++ N+ L   D+EPS+ TLHRFGNTSSSSIWY L+YLEAK ++  GDR+ 
Sbjct: 356 HTGGRAVIQAMEMNLKLTKVDIEPSKMTLHRFGNTSSSSIWYALSYLEAKRRMKKGDRVL 415

Query: 446 QIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           QI FGSGFKCNSAVWR +R++   T N WLD I +YP
Sbjct: 416 QIAFGSGFKCNSAVWRCIRKVEPNTENKWLDFIDSYP 452



 Score = 25.4 bits (54), Expect(2) = 4e-59
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            +WY GKDRSM + N
Sbjct: 220  HWYIGKDRSMLLTN 233



>gb:AP004630_1842300 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0031A09.>gb:AP004993_1846893 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0037N01.
          Length = 504

 Score =  229 bits (584), Expect = 7e-59
 Identities = 112/228 (49%), Positives = 154/228 (67%), Gaps = 5/228 (2%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGR--AKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGL 822
           P   FRMG  A+LLS  R       +++RL HIVRT  AA+DR++R  Y +ED +G  G+
Sbjct: 270 PTALFRMGGVAMLLSTSRSSATTTTSRFRLAHIVRTLNAAEDRAYRCAYHEEDGDGNLGV 329

Query: 821 KISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRP---YIPDYK 651
            +SK++V + GE LK NI T+G  VLP+SE+L++  +L+   + GS  ++    ++PD++
Sbjct: 330 NLSKDIVPVAGEMLKANIATVGSRVLPLSEKLLYALSLLARKVAGSRRRKAIKLHVPDFR 389

Query: 650 LAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGK 471
            AF+HFCI+A  + V+D +Q+ +GL D D+E SR  LHRFGNTSSSS+WYELAY+EAKG+
Sbjct: 390 TAFEHFCIHAGGRSVIDAVQSGLGLADEDVEASRMALHRFGNTSSSSVWYELAYVEAKGR 449

Query: 470 VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYPRAI 327
           +  GDR+W I FGSGFKCNSA W  +         PW D IH YP AI
Sbjct: 450 MRRGDRVWMICFGSGFKCNSAAWECISLPARDADGPWADSIHQYPVAI 497



>pir|C96736|C96736 probable ketoacyl-CoA synthase F23N20.15
           [imported] - Arabidopsis thaliana>gb:AE005173_894693
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016972_1538298 Arabidopsis thaliana
           chromosome 1 BAC F23N20 genomic sequence, complete
           sequence.>gb:BT015084_1642054 Arabidopsis thaliana
           At1g71160 gene, complete cds.
          Length = 460

 Score =  228 bits (581), Expect = 2e-58
 Identities = 108/219 (49%), Positives = 155/219 (70%), Gaps = 3/219 (1%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FRMG +A+LLSNR++D  +AKY+L+HI+RTH  +D  S+ ++ Q+ D+EGK G+ +SK+L
Sbjct: 232 FRMGGAAILLSNRKQDSHKAKYKLQHIIRTHVGSDTESYESVMQQVDEEGKVGVALSKQL 291

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLV---WGHLFGSSSQRPYIPDYKLAFDHF 633
           VR+  +ALK N+  LGP VLP SEQL +  + +   WG       +  Y P++K AF+HF
Sbjct: 292 VRVASKALKINVVQLGPRVLPYSEQLKYIISFIQRKWG-----MHKEIYTPNFKKAFEHF 346

Query: 632 CIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDR 453
           CI+A  + +++ ++ ++ L   D+E SR+TL+R+GNTSSSS+WYEL YLEAKG++  GD+
Sbjct: 347 CIHAGGRAIIEGVEKHLKLDKEDVEASRSTLYRYGNTSSSSLWYELQYLEAKGRMKMGDK 406

Query: 452 LWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           +WQI FGSGFK NSAVW+ +  I     N W D IH YP
Sbjct: 407 VWQIGFGSGFKANSAVWKCISEIDSRGRNAWSDRIHLYP 445



>gb:AP004740_1844163 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0092H22.
          Length = 491

 Score =  226 bits (577), Expect = 4e-58
 Identities = 112/220 (50%), Positives = 147/220 (66%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FR+G +A LLS       +A++RL+H+VRT  AA+D ++  ++Q+ED+ G  G+ +
Sbjct: 268 PICLFRIGGAAALLSTSP---AKARFRLQHVVRTLTAAEDSAYHCVFQEEDEHGNTGINL 324

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SKEL+ I G ALK NIT + PLVLP SEQL F    +      S   +PYIPD++ AF+H
Sbjct: 325 SKELMTIAGNALKANITAIAPLVLPASEQLKFALAFIARKAL-SGRVKPYIPDFRAAFEH 383

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ ++ L D  +E SR  LHRFGNTSSSS+WYELAY+EAKG++  GD
Sbjct: 384 FCIHAGGRAVIDELQRSLCLSDEQVEASRMVLHRFGNTSSSSVWYELAYIEAKGRMRRGD 443

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+W I FGSGFKCNSA W  +   R     PW   IH YP
Sbjct: 444 RVWMIGFGSGFKCNSAAWECISPAR-DADGPWATSIHRYP 482



>gb:AF491878_1804884 Brassica rapa cultivar Tobin fatty acid
           elongase gene, complete cds.
          Length = 509

 Score =  224 bits (572), Expect = 2e-57
 Identities = 109/217 (50%), Positives = 147/217 (67%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D++GK G+ +SK++
Sbjct: 274 FRVGGAAILLSNKSGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDEDGKTGVCLSKDI 333

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  +I    PL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI 
Sbjct: 334 TNVAGTTLTKHIAICRPLILPLSEKFLFFATSVAMKLLKDKIKHYYVPDFKLAVDHFCIQ 393

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL-W 447
              + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+E K ++  G++  W
Sbjct: 394 PGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEPKERLKKGNKKGW 453

Query: 446 QIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           QI  G GFK NSAVW A+  ++    +PW  CI  YP
Sbjct: 454 QIALGLGFKGNSAVWVALNNVKASANSPWEHCIDRYP 490



>gb:AF491876_1804882 Brassica juncea fatty acid elongase (fae 1.1)
           gene, complete cds.>gb:AF491877_1804883 Brassica juncea
           fatty acid elongase (Fae1.2) gene, complete cds.
          Length = 509

 Score =  224 bits (572), Expect = 2e-57
 Identities = 109/217 (50%), Positives = 147/217 (67%), Gaps = 1/217 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D++GK G+ +SK++
Sbjct: 274 FRVGGAAILLSNKSGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDEDGKTGVCLSKDI 333

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  L  +I    PL+LP+SE+ +FFAT V   L     +  Y+PD+KLA DHFCI 
Sbjct: 334 TNVAGTTLTKHIAICRPLILPLSEKFLFFATSVAMKLLKDKIKHYYVPDFKLAVDHFCIQ 393

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL-W 447
              + V+DEL+ N+GL   D+E SR+TLHRFGNTSSSSIWYELAY+E K ++  G++  W
Sbjct: 394 PGGRAVIDELEKNLGLSPIDVEASRSTLHRFGNTSSSSIWYELAYIEPKERLKKGNKKGW 453

Query: 446 QIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           QI  G GFK NSAVW A+  ++    +PW  CI  YP
Sbjct: 454 QIALGLGFKGNSAVWVALNNVKASANSPWEHCIDRYP 490



>gb:AP004630_1842293 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0031A09.>gb:AP004993_1846886 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0037N01.
          Length = 494

 Score =  222 bits (565), Expect(2) = 8e-57
 Identities = 110/220 (50%), Positives = 145/220 (65%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A LLS       +A++RL+H+VRT   A+D +   ++Q+ED+ G  G+ +
Sbjct: 271 PNCLFRMGGAAALLSTSP---AKARFRLKHVVRTLTGAEDSAHHCVFQEEDEHGSIGINL 327

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           SK+L+ I G ALK NIT + PLVLP SEQL F    +      S   +PYIPD++ AF+H
Sbjct: 328 SKDLMTIAGNALKANITAIAPLVLPASEQLKFALAFIARKAL-SGRVKPYIPDFRAAFEH 386

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+A  + V+DELQ ++ L D  ++ SR  LHRFGNTSSSS+WYELAY+EAKG++  GD
Sbjct: 387 FCIHAGGRAVIDELQRSLCLSDEQVQASRMALHRFGNTSSSSVWYELAYVEAKGRMRRGD 446

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           R+W I FGSGFKCNSA W  +   R     PW   IH YP
Sbjct: 447 RVWMIGFGSGFKCNSAAWECISPAR-DDDGPWATSIHRYP 485



 Score = 22.3 bits (46), Expect(2) = 8e-57
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            N+Y G +R+M +PN
Sbjct: 259  NYYVGNERAMLLPN 272



>gb:AP003350_1828524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0702H08.
          Length = 478

 Score =  222 bits (565), Expect = 1e-56
 Identities = 115/225 (51%), Positives = 151/225 (67%), Gaps = 5/225 (2%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A++LSN       A++RL  +VRT  AA D  +R ++Q+ED++G  G+++
Sbjct: 252 PNCLFRMGAAAMILSNSP---DHARFRLGRVVRTVTAARDSDYRCVFQEEDEQGNTGIRL 308

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQL---IFFATLVWGHLFGSSSQ-RPYIPDYKL 648
           SK+L    G ALK+NI   GPLVLP SEQL   I F       L G + + R Y PD++ 
Sbjct: 309 SKDLATTAGHALKSNIAAFGPLVLPASEQLLVAISFLKRKLKQLSGHAGKVRLYRPDFRT 368

Query: 647 AFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKV 468
           AF+HFCI+A  + V+DE+Q  +GL D D+E SR TLHRFGNTSSSS+ YELAYLEAKG++
Sbjct: 369 AFEHFCIHAGGRGVIDEVQHGLGLSDDDVEASRMTLHRFGNTSSSSVLYELAYLEAKGRM 428

Query: 467 AGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTAN-PWLDCIHTYP 336
             GDR+W I FG+GF CNS  W  V+    P A+ PW+DCIH YP
Sbjct: 429 KRGDRVWMISFGAGFDCNSVAWECVK--PAPDADGPWVDCIHRYP 471



>gb:BCY14974_1632827 Brassica campestris fae1 gene, low erucic acid
           line.
          Length = 459

 Score =  221 bits (564), Expect = 1e-56
 Identities = 103/188 (54%), Positives = 139/188 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD+SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDKSFRCVQQGDDENGKIGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFK 420
           I  GSGFK
Sbjct: 452 IALGSGFK 459



>gb:BCY14975_1632828 Brassica campestris fae1 gene, high erucic acid
           line.
          Length = 458

 Score =  221 bits (562), Expect = 2e-56
 Identities = 103/188 (54%), Positives = 138/188 (73%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLSN+  D  R+KY L H VRTH  ADD SFR + Q +D+ GK G+ +SK++
Sbjct: 271 FRVGGAAILLSNKPGDRRRSKYELVHTVRTHTGADDYSFRCVQQGDDENGKTGVSLSKDI 330

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI TLGPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 331 TDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 390

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 391 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 450

Query: 443 IVFGSGFK 420
           I  GSGFK
Sbjct: 451 IALGSGFK 458



>gb:BOY14981_1633938 Brassica oleracea fae1 gene.
          Length = 459

 Score =  214 bits (546), Expect = 2e-54
 Identities = 101/188 (53%), Positives = 136/188 (72%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A+LLS +  D  R+KY L H VRTH  ADD SFR + Q +D+ GK G+ +SK++
Sbjct: 272 FRVGGAAILLSIKPGDRRRSKYELVHTVRTHTGADDFSFRCVQQGDDENGKTGVSLSKDI 331

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIY 624
             + G  +K NI T GPL+LP+SE+L+FF T +   LF    +  Y+PD+KLA DHFCI+
Sbjct: 332 TDVAGRTVKKNIATWGPLILPLSEKLLFFVTFMGKKLFKDKIKHYYVPDFKLAIDHFCIH 391

Query: 623 APSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQ 444
           A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSSIWYELAY+EAKG++  G+++WQ
Sbjct: 392 AGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSSIWYELAYIEAKGRMKKGNKVWQ 451

Query: 443 IVFGSGFK 420
           I  GSGFK
Sbjct: 452 IALGSGFK 459



>gb:AF054498_1764541 Brassica napus fatty acid elongase 1 (FAE1-2)
           gene, partial cds.
          Length = 168

 Score =  202 bits (513), Expect = 1e-50
 Identities = 91/166 (54%), Positives = 123/166 (74%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K NI TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>pir|T07846|T07846 probable beta-ketoacyl synthetase 2 - rape
           (fragment)
          Length = 168

 Score =  202 bits (513), Expect = 1e-50
 Identities = 91/166 (54%), Positives = 123/166 (74%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K NI TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>gb:AF054497_1764540 Brassica napus fatty acid elongase 1 (FAE1-1)
           gene, partial cds.
          Length = 168

 Score =  198 bits (504), Expect = 1e-49
 Identities = 89/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K NI TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>pir|T07845|T07845 beta-ketoacyl synthetase 1 - rape (fragment)
          Length = 168

 Score =  198 bits (504), Expect = 1e-49
 Identities = 89/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K NI TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKNIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>gb:AF054500_1764543 Brassica oleracea fatty acid elongase 1 (FAE1)
           gene, partial cds.
          Length = 168

 Score =  197 bits (500), Expect = 4e-49
 Identities = 89/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K +I TLGPL+LP+SE+L+F  T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKHIATLGPLILPLSEKLLFSVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>pir|T14434|T14434 probable beta-ketoacyl synthetase 1 - wild
           cabbage  (fragment)
          Length = 168

 Score =  197 bits (500), Expect = 4e-49
 Identities = 89/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K +I TLGPL+LP+SE+L+F  T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKHIATLGPLILPLSEKLLFSVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  K V+D L+ N+GL   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGKAVIDVLEKNLGLAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>gb:AF054499_1764542 Brassica rapa fatty acid elongase 1 (FAE1)
           gene, partial cds.
          Length = 168

 Score =  196 bits (499), Expect = 5e-49
 Identities = 88/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K +I TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKHIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>pir|T14385|T14385 fatty acid elongase 1 - turnip (fragment)
          Length = 168

 Score =  196 bits (499), Expect = 5e-49
 Identities = 88/166 (53%), Positives = 122/166 (73%)
 Frame = -3

Query: 869 FRAIYQKEDDEGKKGLKISKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF 690
           FR + Q +D+ GK G+ +SK++  + G  +K +I TLGPL+LP+SE+L+FF T +   LF
Sbjct: 1   FRCVQQGDDENGKTGVSLSKDITDVAGRTVKKHIATLGPLILPLSEKLLFFVTFMGKKLF 60

Query: 689 GSSSQRPYIPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSS 510
               +  Y+PD+KLA DHFCI+A  + V+D L+ N+ L   D+E SR+TLHRFGNTSSSS
Sbjct: 61  KDKIKHYYVPDFKLAIDHFCIHAGGRAVIDVLEKNLALAPIDVEASRSTLHRFGNTSSSS 120

Query: 509 IWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPT 372
           IWYELAY+EAKG++  G+++WQI  GSGFKCNSAVW A+  ++  T
Sbjct: 121 IWYELAYIEAKGRMKKGNKVWQIALGSGFKCNSAVWVALNNVKAST 166



>gb:AP005508_1853064 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0711F01.
          Length = 482

 Score =  196 bits (498), Expect = 6e-49
 Identities = 99/220 (45%), Positives = 138/220 (62%), Gaps = 1/220 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR+G +A L+++     G AKY L   +RTH   DD ++ A  Q ED+EG  G+ ++K+L
Sbjct: 237 FRVGSAAALVTDVAARRGDAKYELVRTLRTHHGGDDAAYNAAVQMEDEEGNVGVALTKDL 296

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGS-SSQRPYIPDYKLAFDHFCI 627
           VR+ G  L+ +I TL P VLPVSE L +   +   ++ G+  +    +PD++ AF+H CI
Sbjct: 297 VRVAGAGLRQHIATLAPHVLPVSELLRYVWRVARAYVAGNPKAVAAIVPDFQRAFEHMCI 356

Query: 626 YAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLW 447
           ++  K V+D +   M      +EP+RATLHRFGNTSSS ++YELAY EAK +V  GDRLW
Sbjct: 357 HSGGKAVIDAVVKLMAFGPQVVEPARATLHRFGNTSSSLVFYELAYFEAKRRVRAGDRLW 416

Query: 446 QIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYPRAI 327
            + FG+GFK  S VWRA+R       NPW  C H YP A+
Sbjct: 417 MLAFGTGFKACSNVWRALRDSAPDADNPWNACAHRYPAAL 456



>gb:AY392440_1325147 Dictyostelium discoideum probable
           3-oxoacyl-acyl-carrier protein synthase gene, complete
           cds.
          Length = 516

 Score =  194 bits (492), Expect(2) = 9e-49
 Identities = 96/202 (47%), Positives = 138/202 (68%), Gaps = 2/202 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKIS--K 810
           FRMG +A++LSN+ + Y   KYRL   VR  K   D ++ A+YQ ED++G KG++++  +
Sbjct: 307 FRMGGAAIMLSNKSKYYWTGKYRLVASVRVTKC-HDAAYNAVYQTEDNKGNKGVRLATGR 365

Query: 809 ELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFC 630
           +L+ + G+ +KTN T LGP+VLP SEQ+ FF       L G      Y+P++K AF HFC
Sbjct: 366 DLMTVVGDCMKTNFTILGPMVLPWSEQIKFFVNFCHRKLVGGKKVPAYVPNFKKAFQHFC 425

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           I+A  + V+D L+ N  L   D+EPSRATL+R+GNTSSSSIWYEL ++E +  V  G+++
Sbjct: 426 IHAGGRAVIDGLEENFNLSPYDVEPSRATLYRYGNTSSSSIWYELNFIEKQHSVKCGEKV 485

Query: 449 WQIVFGSGFKCNSAVWRAVRRI 384
            Q+ FGSGFK NS VW+++R I
Sbjct: 486 LQLSFGSGFKMNSLVWQSIRDI 507



 Score = 23.5 bits (49), Expect(2) = 9e-49
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY G +R+M + N
Sbjct: 291  NWYRGNERAMLVTN 304



>pir|T49095|T49095 beta-ketoacyl-CoA synthase like protein -
           Arabidopsis thaliana>gb:ATF4F15_1550682 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F4F15.
          Length = 451

 Score =  191 bits (484), Expect(2) = 1e-47
 Identities = 100/213 (46%), Positives = 134/213 (62%), Gaps = 1/213 (0%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A++LS+RR D  RAKY+L  +VRTHK  +D S+++I  +ED +GK+GL +
Sbjct: 269 PNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLVRTHKGMEDTSYKSIELREDRDGKQGLYV 328

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           S++++ +G  ALK NI TLG L                                + +F+H
Sbjct: 329 SRDVMEVGRHALKANIATLGRL--------------------------------EPSFEH 356

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
            C+ A SK VLD++  ++ L + +ME SR TL RFGNTSSSSIWYELAYLE K K+  GD
Sbjct: 357 ICVLASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGD 416

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPT-ANPW 360
           R+WQI FGSGFKCNS VW+A++ I  P   NPW
Sbjct: 417 RVWQIGFGSGFKCNSVVWKALKNIDPPRHNNPW 449



 Score = 22.7 bits (47), Expect(2) = 1e-47
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 1027 WYSGKDRSMXIPNXF 983
            WYSG D ++  PN F
Sbjct: 258  WYSGNDVALLPPNCF 272



>gb:AY084713_1569799 Arabidopsis thaliana clone 115725 mRNA,
           complete sequence.
          Length = 444

 Score =  191 bits (484), Expect(2) = 1e-47
 Identities = 100/213 (46%), Positives = 134/213 (62%), Gaps = 1/213 (0%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMG +A++LS+RR D  RAKY+L  +VRTHK  +D S+++I  +ED +GK+GL +
Sbjct: 262 PNCFFRMGAAAVMLSSRRIDRWRAKYQLMQLVRTHKGMEDTSYKSIELREDRDGKQGLYV 321

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDH 636
           S++++ +G  ALK NI TLG L                                + +F+H
Sbjct: 322 SRDVMEVGRHALKANIATLGRL--------------------------------EPSFEH 349

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
            C+ A SK VLD++  ++ L + +ME SR TL RFGNTSSSSIWYELAYLE K K+  GD
Sbjct: 350 ICVLASSKKVLDDIHKDLKLTEENMEASRRTLERFGNTSSSSIWYELAYLEHKAKMKRGD 409

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPT-ANPW 360
           R+WQI FGSGFKCNS VW+A++ I  P   NPW
Sbjct: 410 RVWQIGFGSGFKCNSVVWKALKNIDPPRHNNPW 442



 Score = 22.7 bits (47), Expect(2) = 1e-47
 Identities = 8/15 (53%), Positives = 10/15 (66%)
 Frame = -1

Query: 1027 WYSGKDRSMXIPNXF 983
            WYSG D ++  PN F
Sbjct: 251  WYSGNDVALLPPNCF 265



>pir|D86212|D86212 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889782 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY062700_1565356 Arabidopsis thaliana
           Unknown protein (At1g07720; F24B9.18) mRNA, complete
           cds.>gb:AY128794_1580874 Arabidopsis thaliana unknown
           protein (At1g07720) mRNA, complete cds.>gb:F24B9_1677974
           Arabidopsis thaliana chromosome 1 BAC F24B9 sequence,
           complete sequence.>gb:AF428349_1799279 Arabidopsis
           thaliana At1g07720/F24B9_16 mRNA, complete cds.
          Length = 478

 Score =  175 bits (444), Expect(2) = 6e-44
 Identities = 97/231 (41%), Positives = 135/231 (58%), Gaps = 15/231 (6%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G  A+LL+N+R    RA ++L  +VRTH  A D SF A  QKED+ G  G+ + K L
Sbjct: 217 FRSGGCAVLLTNKRSLSRRAMFKLRCLVRTHHGARDDSFNACVQKEDELGHIGVHLDKTL 276

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF-----GSSSQRPYIP------- 660
            +    A   N+  + P +LPV+E L F   L+   L      GS++     P       
Sbjct: 277 PKAATRAFIDNLKVITPKILPVTELLRFMLCLLLKKLRSSPSKGSTNVTQAAPKAGVKAG 336

Query: 659 -DYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLE 483
            ++K   DHFCI+   K V+D +  ++ L + D+EP+R TLHRFGNTS+SS+WY L Y+E
Sbjct: 337 INFKTGIDHFCIHTGGKAVIDAIGYSLDLNEYDLEPARMTLHRFGNTSASSLWYVLGYME 396

Query: 482 AKGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTA--NPWLDCIHTYP 336
           AK ++  GDR++ I FG+GFKCNS VW  VR + +  A  N W  CI+ YP
Sbjct: 397 AKKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLNVGEAVGNVWNHCINQYP 447



 Score = 25.8 bits (55), Expect(2) = 6e-44
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWYSG +RSM + N
Sbjct: 201  NWYSGNNRSMILAN 214



>gb:AC084022_1733281 Oryza sativa chromosome 3 BAC OSJNBa0011H24
           genomic sequence, complete sequence.
          Length = 466

 Score =  176 bits (447), Expect(2) = 4e-43
 Identities = 94/222 (42%), Positives = 126/222 (56%), Gaps = 3/222 (1%)
 Frame = -3

Query: 992 QLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKIS 813
           Q  FR G +A+LLSN     GRAK  L  +VR+  AA D ++  I Q+EDD+G +G+ IS
Sbjct: 220 QCLFRCGGAAVLLSNDPAHRGRAKMELRRLVRSTTAASDDAYSCIMQREDDDGLRGVSIS 279

Query: 812 KELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIP---DYKLAF 642
           K L +    A   N+  L P VLP  E     A L W +L      R       + K   
Sbjct: 280 KALPKAALRAFAANLQRLLPRVLPAMEIARLAADLAWQNLLQRRRHRGQTKLKINLKAGV 339

Query: 641 DHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG 462
           DH C++A    V+D ++ + GL + D+EP R TLHR+GNTS+SS+WY L+Y+EAKG++  
Sbjct: 340 DHICLHAGGVAVIDAVKKSFGLEERDVEPLRMTLHRWGNTSASSVWYVLSYMEAKGRLRR 399

Query: 461 GDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           GD++  + FGSGFKCNS VW       M     W DCI  YP
Sbjct: 400 GDKVLMVTFGSGFKCNSCVWEVAG--DMADKGAWADCIDAYP 439



 Score = 21.9 bits (45), Expect(2) = 4e-43
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -1

Query: 1030 NWYSGKDRSMXI 995
            +WY+GK+R+M +
Sbjct: 207  HWYAGKERTMML 218



>gb:AP006175_1861395 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0669G04.
          Length = 483

 Score =  174 bits (440), Expect(2) = 7e-43
 Identities = 93/228 (40%), Positives = 134/228 (58%), Gaps = 12/228 (5%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR GCSA L++ +R   G  KYRL  + RT++ A+DRS+R+ Y+ EDDEG  G  +   +
Sbjct: 254 FRTGCSAALVTTKRGG-GGVKYRLVSVTRTNQTANDRSYRSGYRDEDDEGITGFTLGHGV 312

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF----GSSSQRPYIPDYKLAFDH 636
            R+  E L+ ++ TL   +LP  E+L + A L+         GS    P +PD++ A +H
Sbjct: 313 GRMVSELLRAHLLTLSLSILPWREKLRYVAALLRHRRHDKKAGSGGGIP-MPDFRAAAEH 371

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FC+ +  + ++  L   +GL +G+ME +    HRFGN S++S+WY+LAY+EAKG+V  GD
Sbjct: 372 FCLPSSGRPMIWRLGQGLGLGEGEMEAALMAFHRFGNQSAASLWYQLAYMEAKGRVRRGD 431

Query: 455 RLWQIVFGSGFKCNSAVWR--------AVRRIRMPTANPWLDCIHTYP 336
            +WQ+  GSG K NS VW         A  R    T  PW DCIH YP
Sbjct: 432 TVWQLAVGSGLKANSLVWERVADDDHFATERHGRTTLGPWADCIHKYP 479



 Score = 23.9 bits (50), Expect(2) = 7e-43
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPNXF 983
            + WYSGKD+S  + N +
Sbjct: 237  VGWYSGKDKSKLLLNCY 253



>gb:AP006175_1861394 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0669G04.
          Length = 427

 Score =  174 bits (440), Expect(2) = 7e-43
 Identities = 93/228 (40%), Positives = 134/228 (58%), Gaps = 12/228 (5%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR GCSA L++ +R   G  KYRL  + RT++ A+DRS+R+ Y+ EDDEG  G  +   +
Sbjct: 198 FRTGCSAALVTTKRGG-GGVKYRLVSVTRTNQTANDRSYRSGYRDEDDEGITGFTLGHGV 256

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF----GSSSQRPYIPDYKLAFDH 636
            R+  E L+ ++ TL   +LP  E+L + A L+         GS    P +PD++ A +H
Sbjct: 257 GRMVSELLRAHLLTLSLSILPWREKLRYVAALLRHRRHDKKAGSGGGIP-MPDFRAAAEH 315

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FC+ +  + ++  L   +GL +G+ME +    HRFGN S++S+WY+LAY+EAKG+V  GD
Sbjct: 316 FCLPSSGRPMIWRLGQGLGLGEGEMEAALMAFHRFGNQSAASLWYQLAYMEAKGRVRRGD 375

Query: 455 RLWQIVFGSGFKCNSAVWR--------AVRRIRMPTANPWLDCIHTYP 336
            +WQ+  GSG K NS VW         A  R    T  PW DCIH YP
Sbjct: 376 TVWQLAVGSGLKANSLVWERVADDDHFATERHGRTTLGPWADCIHKYP 423



 Score = 23.9 bits (50), Expect(2) = 7e-43
 Identities = 8/17 (47%), Positives = 12/17 (70%)
 Frame = -1

Query: 1033 LNWYSGKDRSMXIPNXF 983
            + WYSGKD+S  + N +
Sbjct: 181  VGWYSGKDKSKLLLNCY 197



>gb:AY084716_1569802 Arabidopsis thaliana clone 115769 mRNA,
           complete sequence.
          Length = 476

 Score =  169 bits (429), Expect(2) = 3e-42
 Identities = 90/230 (39%), Positives = 134/230 (58%), Gaps = 14/230 (6%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G  A+LL+N+R    +A ++L+ +VRTH  A + S+    Q ED++G+ G  + K L
Sbjct: 217 FRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREESYNCCIQAEDEQGRVGFYLGKNL 276

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHL-------FGSSSQRPYIP----- 660
            +    A   N+  + P +LPV+E + F   L+   +        GS++  P  P     
Sbjct: 277 PKAATRAFVDNLKVITPKILPVTELIRFMLKLLIKKIKIRQNPSXGSTNLPPGTPLKAGI 336

Query: 659 DYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEA 480
           ++K   +HFCI+   K V+D +  ++ L + D+EP+R TLHRFGNTS+SS+WY LAY+EA
Sbjct: 337 NFKTGIEHFCIHTGGKAVIDGIGHSLDLNEYDIEPARMTLHRFGNTSASSLWYVLAYMEA 396

Query: 479 KGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR--MPTANPWLDCIHTYP 336
           K ++  GDR++ I FG+GFKCNS VW  VR +       N W  CI  YP
Sbjct: 397 KKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTGGESKGNVWNHCIDDYP 446



 Score = 25.8 bits (55), Expect(2) = 3e-42
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWYSG +RSM + N
Sbjct: 201  NWYSGNNRSMILAN 214



>gb:AE016959_1023054 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC069145_1540640
           Oryza sativa chromosome 10 BAC OSJNBb0094K03 genomic
           sequence, complete sequence.>gb:AC078948_1541656 Oryza
           sativa chromosome 10 BAC OSJNBa0001K12 genomic sequence,
           complete sequence.>gb:AE017104_1752873 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 58 of
           77 of the complete sequence.
          Length = 465

 Score =  173 bits (439), Expect(2) = 4e-42
 Identities = 97/222 (43%), Positives = 125/222 (56%), Gaps = 6/222 (2%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G  A  L+N  R    AK RL H+VRTH  A D ++    Q EDD G+ G  + K+L
Sbjct: 225 FRSGGCAYFLTNDPRHRRHAKLRLRHLVRTHTGASDDAYSCALQMEDDAGRPGFHLGKDL 284

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQL-IFFAT-LVWGHLFG----SSSQRPYIPDYKLAF 642
            R    A   N+  L P VLP+ E L + FAT L  G   G    S SQ+P     K   
Sbjct: 285 PRAAVHAFVKNLRLLAPRVLPLPELLRLAFATFLSSGRRSGGKKTSPSQQPLTIRMKAGV 344

Query: 641 DHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG 462
           DHFC++     V+D +   + L + D+EPSR TLHRFGNTS+SS+WY L Y+EAK ++  
Sbjct: 345 DHFCVHTGGAAVIDGVGKGLTLTEHDLEPSRMTLHRFGNTSASSVWYVLGYMEAKRRLRP 404

Query: 461 GDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           GDR+  + FG+GFKCNS VW   + +    A  W DCI  YP
Sbjct: 405 GDRVLMLTFGAGFKCNSCVWTVEKPV--SDAGVWKDCIDHYP 444



 Score = 21.6 bits (44), Expect(2) = 4e-42
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY+G  RS  + N
Sbjct: 209  NWYAGNKRSFMLGN 222



>pir|C84687|C84687 probable fatty acid elongase [imported] -
           Arabidopsis thaliana>gb:AC007171_1535466 Arabidopsis
           thaliana chromosome 2 clone T8O18 map mi54, complete
           sequence.>gb:AY056170_1563496 Arabidopsis thaliana
           putative fatty acid elongase (At2g28630) mRNA, complete
           cds.>gb:AY091195_1574404 Arabidopsis thaliana putative
           fatty acid elongase (At2g28630) mRNA, complete cds.
          Length = 476

 Score =  169 bits (427), Expect(2) = 5e-42
 Identities = 90/230 (39%), Positives = 134/230 (58%), Gaps = 14/230 (6%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G  A+LL+N+R    +A ++L+ +VRTH  A + S+    Q ED++G+ G  + K L
Sbjct: 217 FRSGGCAILLTNKRSLRKKAMFKLKCMVRTHHGAREESYNCCIQAEDEQGRVGFYLGKNL 276

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLF-------GSSSQRPYIP----- 660
            +    A   N+  + P +LPV+E + F   L+   +        GS++  P  P     
Sbjct: 277 PKAATRAFVENLKVITPKILPVTELIRFMLKLLIKKIKIRQNPSKGSTNLPPGTPLKAGI 336

Query: 659 DYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEA 480
           ++K   +HFCI+   K V+D +  ++ L + D+EP+R TLHRFGNTS+SS+WY LAY+EA
Sbjct: 337 NFKTGIEHFCIHTGGKAVIDGIGHSLDLNEYDIEPARMTLHRFGNTSASSLWYVLAYMEA 396

Query: 479 KGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR--MPTANPWLDCIHTYP 336
           K ++  GDR++ I FG+GFKCNS VW  VR +       N W  CI  YP
Sbjct: 397 KKRLKRGDRVFMISFGAGFKCNSCVWEVVRDLTGGESKGNVWNHCIDDYP 446



 Score = 25.8 bits (55), Expect(2) = 5e-42
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWYSG +RSM + N
Sbjct: 201  NWYSGNNRSMILAN 214



>gb:AC084022_1733291 Oryza sativa chromosome 3 BAC OSJNBa0011H24
           genomic sequence, complete sequence.
          Length = 467

 Score =  162 bits (409), Expect(2) = 1e-39
 Identities = 87/228 (38%), Positives = 133/228 (58%), Gaps = 12/228 (5%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G +++L++N     GRAK  L  +VR + AA+D +     Q+EDD+G  G+ +SK L
Sbjct: 218 FRCGGASVLVTNDPVLRGRAKMELGCLVRANIAANDDAHACALQREDDDGTVGISLSKAL 277

Query: 803 VRIGGEALKTNITTLGPLVLPVSE------QLIFFATLVWGHLFGSSSQR------PYIP 660
            +    A   N+  L P +LP++E      QL+    L+      +++ +      P I 
Sbjct: 278 PKAAVRAFAANLRRLAPRILPITELARFAAQLLITKKLLRRRATAATATKHTGGDGPRI- 336

Query: 659 DYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEA 480
           ++K   DHFC++     V++ ++ ++GL D D+EP+R TLHR+GNTS+SS+WY L+Y+EA
Sbjct: 337 NFKTGVDHFCLHPGGTAVIEAVKRSLGLDDDDVEPARMTLHRWGNTSASSLWYVLSYMEA 396

Query: 479 KGKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           KG++  GD++  + FGSGFKCNS VW       M     W DCI  YP
Sbjct: 397 KGRLRRGDKVLMVTFGSGFKCNSCVWEVTG--DMADKGAWADCIDAYP 442



 Score = 25.0 bits (53), Expect(2) = 1e-39
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY+G D+SM + N
Sbjct: 202  NWYTGTDKSMMLAN 215



>gb:AP004120_1837870 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1293_E04.>gb:AP005691_1856130 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0053L11.
          Length = 463

 Score =  159 bits (402), Expect(2) = 9e-39
 Identities = 85/220 (38%), Positives = 123/220 (55%), Gaps = 2/220 (0%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G +A LL+N      RAK  L  +VR H  A D +  A   +ED +G+ G+ +SK L
Sbjct: 218 FRCGGAAALLTNDPAFRSRAKMELRCLVRAHIGAHDDAHAAAVHREDADGRLGVSLSKAL 277

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIP--DYKLAFDHFC 630
            +    A   N+  L P +LP  E   F A L+   L    +        ++K   DHFC
Sbjct: 278 PKAAVRAFTENLQRLAPRILPAGELARFAARLLLRKLLRRKAAAGAAAKINFKTGVDHFC 337

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRL 450
           ++     V++ ++ ++GL   D+EP+R  LHR+GNTS+SS+WY L+Y+EAK ++  GDR+
Sbjct: 338 LHPGGTAVIEAVRKSLGLDSYDVEPARMALHRWGNTSASSLWYVLSYMEAKRRLNAGDRV 397

Query: 449 WQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYPRA 330
             + FGSGFKCNS+ W   +   +  A  W DCIH YP A
Sbjct: 398 LMVTFGSGFKCNSSYWVVTK--DLADAGAWEDCIHDYPPA 435



 Score = 24.6 bits (52), Expect(2) = 9e-39
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            NWY+G D+SM + N
Sbjct: 202  NWYTGTDKSMMLGN 215



>gb:AF214497S2_1777842 Arabidopsis thaliana fiddlehead protein (fdh)
           gene, fdh-4 allele, complete cds.
          Length = 389

 Score =  145 bits (366), Expect(2) = 4e-36
 Identities = 68/88 (77%), Positives = 80/88 (90%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED++G KGLKI
Sbjct: 302 PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEEDEQGFKGLKI 361

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSE 732
           S++L+ +GGEALKTNITTLGPLVLP SE
Sbjct: 362 SRDLMEVGGEALKTNITTLGPLVLPFSE 389



 Score = 29.6 bits (65), Expect(2) = 4e-36
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>pir|T48449|T48449 fatty acid elongase-like protein - Arabidopsis
           thaliana>gb:ATT32M21_1555919 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T32M21 (ESSA
           project).>gb:BT005386_1638326 Arabidopsis thaliana
           At5g04530 mRNA, complete cds.>gb:AK117173_1815219
           Arabidopsis thaliana At5g04530 mRNA for putative fatty
           acid elongase, complete cds, clone: RAFL16-71-K15.
          Length = 464

 Score =  139 bits (349), Expect(2) = 5e-33
 Identities = 76/220 (34%), Positives = 121/220 (55%), Gaps = 4/220 (1%)
 Frame = -3

Query: 983 FRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKISKEL 804
           FR G S++LL+N  R   +A  +L  +VR H  +DD ++    Q ED +G  G  ++K L
Sbjct: 221 FRAGGSSVLLTNAARFKNQALMKLVTVVRAHVGSDDEAYSCCIQMEDRDGHPGFLLTKYL 280

Query: 803 VRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIP----DYKLAFDH 636
            +    AL  N+  L P VLPV E LI +A +       S+ + P       + K    H
Sbjct: 281 KKAAARALTKNLQVLLPRVLPVKE-LIRYAIVRALKRRTSAKREPASSGIGLNLKTGLQH 339

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           FCI+   + +++ +  ++GL + D+EP+R  LHRFGNTSS  +WY L Y+EAK ++  G+
Sbjct: 340 FCIHPGGRAIIEGVGKSLGLTEFDIEPARMALHRFGNTSSGGLWYVLGYMEAKNRLKKGE 399

Query: 455 RLWQIVFGSGFKCNSAVWRAVRRIRMPTANPWLDCIHTYP 336
           ++  +  G+GF+ N+ VW  ++   +   N W D +  YP
Sbjct: 400 KILMMSMGAGFESNNCVWEVLK--DLDDKNVWEDSVDRYP 437



 Score = 25.8 bits (55), Expect(2) = 5e-33
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPN 989
            +WY GKDRSM + N
Sbjct: 205  HWYCGKDRSMMLSN 218



>gb:OSJN00069_1694266 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0050O03, complete sequence.
          Length = 451

 Score =  124 bits (311), Expect(2) = 2e-27
 Identities = 70/172 (40%), Positives = 98/172 (56%), Gaps = 7/172 (4%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKEDDEGKKGLKI 816
           P + FRMG +A+++SN      +A++RL  IVRT  AA D  +R  +Q+EDDEG  G+ +
Sbjct: 271 PNVLFRMGAAAIIMSNSPE---KARFRLGPIVRTLTAARDGDYRCAFQEEDDEGITGINL 327

Query: 815 SKELVRIGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGS-------SSQRPYIPD 657
           SK+L  +   ALK ++   G  VLP SE L    + +   +          S+   Y P 
Sbjct: 328 SKDLPVVAANALKGHLVAFGLAVLPTSELLRVAISFINHKIINKFFTTTKDSNNNYYRPG 387

Query: 656 YKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWY 501
           +   F HFCI+   + VLDE+Q  +GL D DME S  TLHRFGN +SSS+ Y
Sbjct: 388 FHRLFQHFCIHPGGRRVLDEVQRGLGLTDDDMEASHMTLHRFGNMASSSLLY 439



 Score = 21.6 bits (44), Expect(2) = 2e-27
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 508 YGTSWRTWRPRG 473
           Y TS RT RPRG
Sbjct: 439 YSTSLRTSRPRG 450



>gb:AF214505S2_1777846 Arabidopsis thaliana fiddlehead protein (fdh)
           gene, fdh-9 allele, complete cds.
          Length = 352

 Score = 89.4 bits (220), Expect(2) = 2e-19
 Identities = 40/51 (78%), Positives = 46/51 (90%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFRAIYQKED 843
           P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR++YQ+ED
Sbjct: 302 PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFRSVYQEED 352



 Score = 29.6 bits (65), Expect(2) = 2e-19
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>gb:AP005051_1847294 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0458G06.>gb:AP005768_1857531 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039C01.
          Length = 107

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 48/95 (50%), Positives = 64/95 (67%)
 Frame = -3

Query: 797 IGGEALKTNITTLGPLVLPVSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIYAP 618
           I GEAL+TNITTLGPLVLP+SEQL+F A +V   +F  +  + Y+PD+  A DHFCI+A 
Sbjct: 3   IAGEALRTNITTLGPLVLPLSEQLLFLAMVVLHRVF-LAGVKTYLPDFTPALDHFCIHAG 61

Query: 617 SKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSS 513
            + VLDEL+ ++ L    MEPS  T   + + S S
Sbjct: 62  GRGVLDELERSLKLSAWHMEPSWMTHWGYMDDSDS 96



>gb:AF214491S2_1777839 Arabidopsis thaliana fiddlehead protein (fdh)
           gene, fdh-1 allele, complete cds.>gb:AF214493S2_1777840
           Arabidopsis thaliana fiddlehead protein (fdh) gene,
           fdh-2 allele, complete cds.
          Length = 351

 Score = 78.6 bits (192), Expect(2) = 3e-16
 Identities = 36/44 (81%), Positives = 39/44 (88%)
 Frame = -3

Query: 995 PQLXFRMGCSALLLSNRRRDYGRAKYRLEHIVRTHKAADDRSFR 864
           P   FRMGCSA++LSNRRRD+  AKYRLEHIVRTHKAADDRSFR
Sbjct: 302 PNCFFRMGCSAVMLSNRRRDFRHAKYRLEHIVRTHKAADDRSFR 345



 Score = 29.6 bits (65), Expect(2) = 3e-16
 Identities = 11/16 (68%), Positives = 12/16 (75%)
 Frame = -1

Query: 1030 NWYSGKDRSMXIPNXF 983
            NWY G D+SM IPN F
Sbjct: 290  NWYVGSDKSMVIPNCF 305



>pir|C75587|C75587 probable chalcone synthase - Deinococcus
           radiodurans (strain R1)>gb:AE001863_40250 Deinococcus
           radiodurans R1 section 2 of 2 of the complete chromosome
           2.>gb:AE001825_885572 Deinococcus radiodurans R1
           complete chromosome 2.
          Length = 438

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 24/83 (28%), Positives = 47/83 (56%)
 Frame = -3

Query: 641 DHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG 462
           +H+ ++   + +LD+++ ++GL +  M  SR  L R+GN SS+++ + L   +   +V  
Sbjct: 354 EHWAVHPGGRSILDKVEGSLGLSETQMHASREELRRYGNMSSATVLFILR--DLLEEVRD 411

Query: 461 GDRLWQIVFGSGFKCNSAVWRAV 393
           G+R+  + FG G    S +  AV
Sbjct: 412 GERVCAMAFGPGLTVESGLMTAV 434



>gb:AE016959_1022211 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC116926_1739374
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OJ1341F06,
           from chromosome 10, complete
           sequence.>gb:AE017085_1752030 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 39 of 77 of the
           complete sequence.
          Length = 202

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 22/32 (68%), Positives = 24/32 (75%)
 Frame = +1

Query: 391 RTARHTALLHLKPDPNTICQRRSPPATFPLAS 486
           R+AR TALLHLKP+P  ICQ R P  T PLAS
Sbjct: 16  RSARQTALLHLKPEPKPICQTRWPRRTRPLAS 47



>gb:AY847705_1630755 Marchantia polymorpha stilbenecarboxylate
           synthase 1 (STCS1) gene, complete cds.
          Length = 393

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 7/88 (7%)
 Frame = -3

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL-----EAKGK 471
           +C++   + +LDE+   + L+   +E +R  L+ +GN S +S+ + L  +     E K +
Sbjct: 302 WCVHPGGRAILDEVAKTLSLKPEKLEATRDILYNYGNMSGASVLFVLDQMRRRSAEKKSR 361

Query: 470 VAGGDRLWQIV--FGSGFKCNSAVWRAV 393
             G    W +V  FG G     +V RA+
Sbjct: 362 TTGEGCEWGLVVGFGPGLTVEVSVLRAI 389



>gb:AB040027_1519426 Psilotum nudum PnE mRNA for chalcone synthase
           superfamily protein, complete cds.
          Length = 396

 Score = 43.1 bits (100), Expect = 0.009
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 6/111 (5%)
 Frame = -3

Query: 740 VSEQLIFFATLVWGHLFGSSSQRPYIPDYKLAFDHFCIYAPS-KVVLDELQANMGLRDGD 564
           +S  +       + ++FG+      +PD     D F I  P  K +LD++Q+ + L+   
Sbjct: 271 ISNNITHILNNAFENVFGTEE----VPDVN---DIFWIAQPGCKAILDQIQSQLNLQPQK 323

Query: 563 MEPSRATLHRFGNTSSSSIWYELAY-----LEAKGKVAGGDRLWQIVFGSG 426
           +  SRA L  +GN SS  + + L Y     +E K    G    W ++FG G
Sbjct: 324 LSASRAVLAEYGNMSSPCVPFILDYMRHKSMETKCATTGEGYEWGVLFGFG 374



>gb:AJ748188_530232 Pseudomonas aeruginosa partial rpoB gene for RNA
           polymerase subunit B, strain LMG 5827.
          Length = 364

 Score = 42.7 bits (99), Expect = 0.012
 Identities = 49/138 (35%), Positives = 57/138 (41%), Gaps = 23/138 (16%)
 Frame = -1

Query: 739 CRXXXXXSQRW---YGATCLAPPRSGRTYRTTSWPSTTFASTR--PA-RWF-W--TSCRP 587
           CR     S+ W   + AT  A P S       SW      STR  PA  WF W  T  RP
Sbjct: 207 CRPCVPTSRWWVPAWNATWRATPASA------SWLPVVVCSTRSMPAVSWFAWRITRSRP 260

Query: 586 TWA*GTATWSPAAP-----------RYTASATLPAAAYGTSWRTWRPR--GRWP-AATAS 449
                T+T SP+ P           R++A  T   AA  TSW T RP     WP A T +
Sbjct: 261 AKRVSTSTTSPSTPVPTRTPASTSVRWSARVTWLRAA--TSWPTVRPPTWANWPWARTCA 318

Query: 448 GRSCSGPVSNATAPCGGP 395
            RSC G  S +  P   P
Sbjct: 319 LRSCPGTASTSKTPSACP 336



>gb:HLU430353_1681866 Humulus lupulus chs4 gene for CHS-like
           protein.
          Length = 395

 Score = 42.0 bits (97), Expect = 0.020
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 5/68 (7%)
 Frame = -3

Query: 614 KVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL- 450
           + +LDE++A + L+   M  SR  L  FGN SS+ +++ +  L  +    GK   GD L 
Sbjct: 311 RAILDEVEAKLRLKKEKMADSRHVLSEFGNMSSACVFFIMDELRKRSLEEGKSTTGDGLE 370

Query: 449 WQIVFGSG 426
           W ++FG G
Sbjct: 371 WGVLFGFG 378



>sp|P51081|CHSA_PEA Chalcone synthase 1A (EC 2.3.1.74)
           (Naringenin-chalcone synthase 1A).>pir|S49202|S49202
           naringenin-chalcone synthase (EC 2.3.1.74) - garden
           pea>gb:PSCHSAB_1702086 P.sativum gene for chalcone
           synthase.
          Length = 389

 Score = 42.0 bits (97), Expect = 0.020
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKQRKMQATRHVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K K  G    G+ L W ++FG G
Sbjct: 350 RRKSKEDGLATTGEGLEWGVLFGFG 374



>gb:AF508150_1806924 Rheum tataricum stilbene synthase (STS) mRNA,
           complete cds.
          Length = 391

 Score = 41.2 bits (95), Expect = 0.034
 Identities = 20/68 (29%), Positives = 42/68 (61%), Gaps = 5/68 (7%)
 Frame = -3

Query: 614 KVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLE----AKGKVAGGDRL- 450
           + +LD+++A +GL+   ++ +R  L+ +GN SS+ +++ +  +     A G+V  G+ L 
Sbjct: 307 RAILDDIEATVGLKKEKLKATRQVLNDYGNMSSACVFFIMDEMRKKSLANGQVTTGEGLK 366

Query: 449 WQIVFGSG 426
           W ++FG G
Sbjct: 367 WGVLFGFG 374



>sp|Q9ZS40|CHS2_DAUCA Chalcone synthase 2 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 2)
           (DcCHS2).>gb:DCA6780_1675636 Daucus carota mRNA for
           carrot chalcone synthase 2.
          Length = 397

 Score = 40.8 bits (94), Expect = 0.045
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    GK   GD L W 
Sbjct: 313 ILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGDGLDWG 372

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 373 VLFGFG 378



>gb:OSJN00259_1697537 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0079M09, complete sequence.
          Length = 325

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 26/100 (26%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           +  Y  AF  + ++A  + V+D ++  +GL +G +  +R  + ++GNT S++I+  +  +
Sbjct: 227 VTSYDEAF--WLLHAGGRAVVDGVEERLGLGEGKLAVTREVMRQYGNTRSTTIFLAMEEM 284

Query: 485 ----EAKGKVAGGDRL-WQIV--FGSGFKCNSAVWRAVRR 387
               E +G    G+ L W ++  FG G    + + RA+ R
Sbjct: 285 RRRSEERGMATAGEGLEWGMLMAFGPGLTVETMLLRAMPR 324



>gb:AY563038_1615004 Ginkgo biloba chalcone synthase (CHS) gene,
           partial cds.
          Length = 288

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVA-----GGDRLWQ 444
           +LD++++ + L    + PSR  L  +GN SS+ + + + Y+  K K A     G    W 
Sbjct: 222 ILDQVESKLQLHPSKLHPSRHVLSEYGNMSSACVLFIMDYMRKKSKEAACATTGEGFEWG 281

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 282 VLFGFG 287



>gb:AB119057_1527907 Marchantia paleacea var. diptera MpCHSLKG1 gene
           for chalcone synthase-like, complete cds.
          Length = 393

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = -3

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL-----EAKGK 471
           +C++   + +LDE+   + L+   ME +R  L+ +GN S +S+ + L  +     E +  
Sbjct: 302 WCVHPGGRAILDEVARTLNLKPEKMEATRDVLYNYGNMSGASVLFVLDQMRRRSAEKRCS 361

Query: 470 VAGGDRLWQIV--FGSGFKCNSAVWRAV 393
             G    W +V  FG G     +V +A+
Sbjct: 362 TTGEGCEWGLVVGFGPGLTIEVSVLKAI 389



>gb:AB119056_1527906 Marchantia paleacea var. diptera MpCHSLK1 mRNA
           for chalcone synthase-like, complete cds.
          Length = 393

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 7/88 (7%)
 Frame = -3

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL-----EAKGK 471
           +C++   + +LDE+   + L+   ME +R  L+ +GN S +S+ + L  +     E +  
Sbjct: 302 WCVHPGGRAILDEVARTLNLKPEKMEATRDVLYNYGNMSGASVLFVLDQMRRRSAEKRCS 361

Query: 470 VAGGDRLWQIV--FGSGFKCNSAVWRAV 393
             G    W +V  FG G     +V +A+
Sbjct: 362 TTGEGCEWGLVVGFGPGLTIEVSVLKAI 389



>gb:AB061022_1521990 Humulus lupulus chs3 gene for chalcone
           synthase, complete cds.
          Length = 399

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LDE++A + L+   +  SR  L  +GN SS+S+++ +  L  +    GK   GD L W 
Sbjct: 313 ILDEVEAKLELKKEKLAISRHVLSEYGNMSSASVFFVMDELRKRSLEEGKSTTGDGLDWG 372

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 373 VLFGFG 378



>gb:AX775863_1475223 Sequence 133 from Patent WO03048202.
          Length = 143

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 25/66 (37%), Positives = 31/66 (46%)
 Frame = -1

Query: 631 ASTRPARWFWTSCRPTWA*GTATWSPAAPRYTASATLPAAAYGTSWRTWRPRGRWPAATA 452
           +S  P  W+WT   P     T++    APR  AS   P  A   SW  W P  RW  A++
Sbjct: 79  SSGLPCSWWWTQATPAPTWTTSSRLARAPR--ASCASPPCAARASW--W-PSRRWTCASS 133

Query: 451 SGRSCS 434
            G SCS
Sbjct: 134 RGASCS 139



>gb:NSP561198_156222 Actinomadura sp. ATCC 39727 gene cluster for
           biosynthesis of glycopeptide antibiotic A40926, strain
           ATCC 39727.
          Length = 372

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 22/78 (28%), Positives = 37/78 (47%)
 Frame = -3

Query: 638 HFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGG 459
           H+ +++  K V+D +  N+GL   D+  + A L  +GN SS S  +    L  +G    G
Sbjct: 292 HWLVHSGGKKVIDAIVVNLGLSRHDVRHTTAVLRDYGNLSSGSFLFSYERLAGEGVTRPG 351

Query: 458 DRLWQIVFGSGFKCNSAV 405
           D    +  G G    +A+
Sbjct: 352 DYGVLMTMGPGSTIETAL 369



>sp|P48392|CHS3_GERHY Chalcone synthase 3 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 3).>pir|S56701|S55464
           chalcone synthase 3 - gerbera hybrid>gb:GHCHS3_1680028
           G.hybrida mRNA for chalcone synthase.
          Length = 403

 Score = 40.4 bits (93), Expect = 0.059
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GLR+  +  SR  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 315 ILDQVEFKLGLREEKLRASRHVLSEYGNMSSACVLFILDEMRKKSIKDGKTTTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AY262686_1593702 Glycine max cultivar Williams 82 BAC clone
           Gm_ISb001_104_J07, complete
           sequence.>gb:AY262686_1593704 Glycine max cultivar
           Williams 82 BAC clone Gm_ISb001_104_J07, complete
           sequence.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>gb:AY262686_1593701 Glycine max cultivar Williams 82 BAC clone
           Gm_ISb001_104_J07, complete
           sequence.>gb:AY262686_1593705 Glycine max cultivar
           Williams 82 BAC clone Gm_ISb001_104_J07, complete
           sequence.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>pir|JQ2249|JQ2249 naringenin-chalcone synthase (EC 2.3.1.74) -
           soybean>gb:GMACHS2_1680395 G.max Gmachs2 gene for
           chalcone synthase.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>sp|P30080|CHS6_SOYBN Chalcone synthase 6 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 6).>pir|JQ2259|JQ2259
           naringenin-chalcone synthase (EC 2.3.1.74) 6 -
           soybean>gb:SOYCHSVI_1715982 Glycine max chalcone
           synthase (chs6) gene, complete cds.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 IDDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLEWGVLFGFG 373



>sp|P48406|CHS5_SOYBN Chalcone synthase 5 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 5).>pir|S60472|S60472
           naringenin-chalcone synthase (EC 2.3.1.74) 5 -
           soybean>gb:SOYCHSIV_1715981 Glycine max chalcone
           synthase (chs5) gene, complete cds.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>sp|P19168|CHS3_SOYBN Chalcone synthase 3 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 3).>pir|S11486|SYSYC3
           naringenin-chalcone synthase (EC 2.3.1.74) 3 -
           soybean>gb:GMGENE3_1680447 Soybean gene 3 for chalcone
           synthetase protein.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>sp|P24826|CHS1_SOYBN Chalcone synthase 1 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 1).>pir|S15006|SYSYC1
           naringenin-chalcone synthase (EC 2.3.1.74) 1 -
           soybean>gb:AB052783_1521242 Glycine max CHS3 pseudogene
           and ICHS1 gene for chalcone synthase, complete
           cds.>gb:AY262686_1593700 Glycine max cultivar Williams
           82 BAC clone Gm_ISb001_104_J07, complete
           sequence.>gb:AY262686_1593706 Glycine max cultivar
           Williams 82 BAC clone Gm_ISb001_104_J07, complete
           sequence.>gb:GMCHS1_1680423 G.max Gmachs1 gene for
           chalcone synthase.
          Length = 388

 Score = 40.0 bits (92), Expect = 0.077
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +
Sbjct: 291 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQM 348

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 349 RKKSIENGLGTTGEGLDWGVLFGFG 373



>gb:AY221244_1590539 Allium cepa cultivar H6 (doubled haploid line)
           putative chalcone synthase A mRNA, complete cds.
          Length = 391

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   M  +R  L  +GN SS+ + + +  +
Sbjct: 292 IEDYNEVF--WIAHPGGPAILDQVEAKVGLKPERMRATREVLRNYGNMSSACVLFIMDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K K  G    G+ + W ++FG G
Sbjct: 350 RKKSKEEGLGATGEGMEWGVLFGFG 374



>gb:AB022682_1515252 Psilotum nudum mRNA for chalcone synthase,
           complete cds.
          Length = 408

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 6/78 (7%)
 Frame = -3

Query: 641 DHFCIYAPS-KVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAY-----LEA 480
           D F I  P    +LD+++A + LR   +  SRA L  +GN SS+ + + L Y     +E 
Sbjct: 299 DIFWIAHPGGPAILDQIEAKLQLRPEKLAASRAVLADYGNMSSACVHFILDYIRHKSMEN 358

Query: 479 KGKVAGGDRLWQIVFGSG 426
           K    G    W ++FG G
Sbjct: 359 KCTTTGEGYEWGVLFGFG 376



>sp|P30077|CHS9_MEDSA Chalcone synthase 9 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 9).>pir|S35167|S35167
           naringenin-chalcone synthase (EC 2.3.1.74) 9 -
           alfalfa>gb:ALFCHS9A_1818965 Medicago sativa chalcone
           synthase (CHS9) mRNA, complete cds.
          Length = 389

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K   AG    G+ L W ++FG G
Sbjct: 350 RKKSAQAGLKTTGEGLDWGVLFGFG 374



>sp|P51077|CHS3_MEDSA Chalcone synthase 4-1 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 4- 1).>pir|S44367|S44367
           naringenin-chalcone synthase (EC 2.3.1.74) -
           alfalfa>gb:U01018_1726193 Medicago sativa clone MsCHS4-1
           chalcone synthase mRNA, complete cds.
          Length = 389

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K   AG    G+ L W ++FG G
Sbjct: 350 RKKSAQAGLKTTGEGLDWGVLFGFG 374



>sp|Q9FSB8|CHS2_RUTGR Chalcone synthase 2 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 2).>gb:RGR297790_1703460
           Ruta graveolens mRNA for putative chalcone synthase
           (chs2 gene).
          Length = 393

 Score = 39.7 bits (91), Expect = 0.10
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++A +GL++  +  +R  L  +GN SS+ + + L  +  K    G+   G+ L W 
Sbjct: 311 ILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKKCAEEGRATTGEGLDWG 370

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 371 VLFGFG 376



>gb:AF169798_1774227 Lilium hybrid cv. 'Acapulco' chalcone synthase
           (CHS1) mRNA, complete cds.
          Length = 394

 Score = 39.3 bits (90), Expect = 0.13
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWY---ELAYLEAK-GKVAGGDRL-WQ 444
           +LD+++A +GL+   M  +R  L  +GN SS+ + +   E+    AK GK   G+ L W 
Sbjct: 311 ILDQVEAKLGLQKEKMRATRHVLSEYGNMSSACVLFILDEMRKTSAKMGKATTGEGLDWG 370

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 371 VLFGFG 376



>sp|P51089|CHSY_VIGUN Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>pir|S37098|S37098
           naringenin-chalcone synthase (EC 2.3.1.74) -
           cowpea>gb:VUCHSCH_1727425 V.unguiculata mRNA for
           chalcone synthase.
          Length = 388

 Score = 39.3 bits (90), Expect = 0.13
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 4/84 (4%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD++   +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVAQKLGLKPEKMKATRDVLSDYGNMSSACVTFHLDEI 349

Query: 485 EAKG----KVAGGDRLWQIVFGSG 426
           E       K  G D  W ++FG G
Sbjct: 350 EKSVENGLKTTGKDLEWGVLFGFG 373



>sp|P16107|CHSY_PETCR Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>pir|S42523|S42523
           naringenin-chalcone synthase (EC 2.3.1.74) -
           parsley>gb:PHCHAL_1700089 Parsley messenger RNA coding
           for chalcone synthase. Chalcone synthase is the key
           enzyme of flavonoid biosynthesis and catalyses the
           formation of the central intermediate in this pathway,
           naringenin chalcone, from 4-coumaroyl-CoA and three
           molecules of malonyl-CoA. This enzyme is characteristic
           of higher plants.
          Length = 398

 Score = 39.3 bits (90), Expect = 0.13
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 314 ILDQVELKLGLKEEKMRATRQVLSDYGNMSSACVLFILDEMRKKSIEEGKATTGEGLDWG 373

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 374 VLFGFG 379



>sp|P30073|CHS1_MEDSA Chalcone synthase 1 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 1).>pir|S35163|S35163
           naringenin-chalcone synthase (EC 2.3.1.74) 1 -
           alfalfa>gb:ALFCHS1A_1818961 Medicago sativa chalcone
           synthase (CHS1) mRNA, complete cds.
          Length = 389

 Score = 39.3 bits (90), Expect = 0.13
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K   AG    G+ L W ++FG G
Sbjct: 350 RKKSVQAGLKTTGEGLDWGVLFGFG 374



>sp|Q9FSC0|ACS2_RUTGR Acridone synthase II (EC
           2.3.1.159).>gb:RGR297788_1703458 Ruta graveolens mRNA
           for acridone synthase (acs2 gene).
          Length = 391

 Score = 39.3 bits (90), Expect = 0.13
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  S+  +  +GN SSS + + L  +  K    GK   G+ L W 
Sbjct: 309 ILDQIEVKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRNKSLQDGKSTTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AP003797_1833493 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1001_C01.>gb:AP005172_1848736 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0002J01.
          Length = 402

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 21/89 (23%), Positives = 41/89 (46%), Gaps = 5/89 (5%)
 Frame = -3

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGD 456
           + ++  S  ++D++ A +GL  G +  SR  L  +GN S +++ + L  L  + K A   
Sbjct: 313 WAVHPGSSTIMDQVDAALGLEPGKLAASRRVLSDYGNMSGATVIFALDELRRQRKEAAAA 372

Query: 455 RLW-----QIVFGSGFKCNSAVWRAVRRI 384
             W      + FG G   ++ +  A   +
Sbjct: 373 GEWPELGVMMAFGPGMTVDAMLLHATSHV 401



>gb:AF511474_1807273 Chrysanthemum vestitum chalcone synthase
           (CHS43) gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQALSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511473_1807272 Chrysanthemum vestitum chalcone synthase
           (CHS34) gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511472_1807271 Chrysanthemum chanetii chalcone synthase (CHS6)
           gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511467_1807266 Chrysanthemum lavandulifolium chalcone synthase
           (CHS31) gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511466_1807265 Chrysanthemum lavandulifolium chalcone synthase
           (CHS14) gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511464_1807263 Chrysanthemum lavandulifolium chalcone synthase
           (CHS1) gene, partial cds.>gb:AF511465_1807264
           Chrysanthemum lavandulifolium chalcone synthase (CHS8)
           gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNLSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511460_1807259 Chrysanthemum indicum chalcone synthase (CHS4)
           gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF511459_1807258 Chrysanthemum indicum chalcone synthase (CHS3)
           gene, partial cds.
          Length = 276

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AB015872_1512736 Vitis vinifera gene for chalcone synthase,
           complete cds.
          Length = 393

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  +R  L  +GN SS+ + + L  +  K    GK + G+ L W 
Sbjct: 309 ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKASTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AE017313_439458 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 5 of 12 of the complete
           genome.>gb:AE017285_1072619 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 330

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/48 (41%), Positives = 29/48 (60%)
 Frame = -3

Query: 542 LHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSAVWR 399
           +H FGNTS++SI   LA   A+G++  G R+    FG GF   +A+ R
Sbjct: 282 VHDFGNTSAASIPLALADARAQGRIRPGMRVLLTTFGGGFTWGAALLR 329



>sp|P51075|CHSY_BETVE Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>gb:BPCHALSYN_1633984
           B.pendula Roth mRNA for chalcone synthase.
          Length = 395

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD++++ +GL++  +  +R  L  +GN SS+ + + L  +       GKV  G+ L W 
Sbjct: 309 ILDQVESKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRNSLEGGKVTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>sp|P17957|CHS2_SOYBN Chalcone synthase 2 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 2).>pir|S16338|SYSYCN
           naringenin-chalcone synthase (EC 2.3.1.74) 2 -
           soybean>gb:GMSOYCHS_1680576 Soybean Soychs chs 4 gene
           for chalcone synthase (EC 2.3.1.74).
          Length = 388

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++A +GL+   ME +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 308 ILDQVEAKLGLKPEKMEATRHVLSEYGNMSSACVLFILDQMRKKSIENGLGTTGEGLDWG 367

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 368 VLFGFG 373



>sp|Q9FSC1|ACS4_RUTGR Probable acridone synthase IV (EC
           2.3.1.159).>gb:RGR297787_1703457 Ruta graveolens mRNA
           for putative acridone synthase (acs4 gene).
          Length = 391

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  S+  +  +GN SSS + + L  + ++    GK   G+ L W 
Sbjct: 309 ILDQIEEKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRSRSLQDGKSTTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>sp|Q9FSC2|ACS3_RUTGR Probable acridone synthase III (EC
           2.3.1.159).>gb:RGR297786_1703456 Ruta graveolens mRNA
           for putative acridone synthase (acs3 gene).
          Length = 391

 Score = 38.9 bits (89), Expect = 0.17
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  S+  +  +GN SSS + + L  + ++    GK   G+ L W 
Sbjct: 309 ILDQIEEKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRSRSLQDGKSTTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AJ850132_1814759 Dictamnus albus mRNA for chalcone synthase
           (chs1 gene).
          Length = 391

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 309 ILDQVEEKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKCVEEGKATTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF400567_1796035 Rubus idaeus chalcone synthase 6 (CHS6) mRNA,
           complete cds.
          Length = 391

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++A +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF358432_1790889 Senna alata isolate calchs3 root-specific
           chalcone synthase (chs) mRNA, complete cds.
          Length = 389

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   M+ +R  L  +GN SS+ + + +  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 350 RRKSTKDGLGTTGEGLEWGVLFGFG 374



>gb:AF358430_1790887 Senna alata isolate calchs1 root-specific
           chalcone synthase (chs) mRNA, complete cds.
          Length = 389

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   M+ +R  L  +GN SS+ + + +  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEAKLGLKPEKMQATRHVLSEYGNMSSACVLFIMDEM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 350 RRKSTKDGLGTTGEGLEWGVLFGFG 374



>gb:AF292369_1783769 Rubus idaeus aromatic polyketide synthase
           (PKS3) gene, complete cds.
          Length = 391

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++A +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF292367_1783767 Rubus idaeus aromatic polyketide synthase gene,
           complete cds.
          Length = 391

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++A +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLFILDEVRRKSVANGHKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF144536_1771941 Microthlaspi perfoliatum chalcone synthase
           (chs) gene, complete cds.
          Length = 395

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG----GDRL-WQ 444
           +LD ++A +GL+   M  +R  +  +GN SS+ + + L  +  K K  G    G+ L W 
Sbjct: 315 ILDSVEAKLGLKQEKMRATRHVMSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112082_1769054 Aethionema grandiflora chalcone synthase gene,
           complete cds.
          Length = 392

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL+   M  +R  L  FGN SS+ + + L  +  K    G V  G+ L W 
Sbjct: 312 ILDQVEIKLGLKPEKMRATRHVLTEFGNMSSACVLFILDEMRKKSREDGAVTTGEGLEWG 371

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 372 VLFGFG 377



>gb:GSPCHS_1680956 Gerbera hybrid cv. 'Terra Regina' chs-like gene.
          Length = 347

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  + ++   + +LDE++  + L+   +  SR  L  +GN +S+ + + +  +
Sbjct: 242 ISDYNSLF--WMVHPGGRAILDEVELKLNLKKEKLRASRHVLSEYGNLTSACVLFIIDEM 299

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             K    GK   G+ L W ++FG G
Sbjct: 300 RKKSMEDGKKTTGEGLDWGVLFGFG 324



>gb:AB038246_1519199 Rosa hybrid cultivar 'Kardinal' CHS mRNA for
           chalcone synthase, complete cds.
          Length = 389

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++A +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVEAKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSAANGHKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>sp|O80400|VPS_HUMLU Phloroisovalerophenone synthase (EC 2.3.1.156)
           (Valerophenone synthase)
           (3-methyl-1-(trihydroxyphenyl)butan-1-one
           synthase).>pir|JC7639|JC7639 chalcone synthase-like
           protein - hop>gb:AB015430_1512471 Humulus lupulus vps
           mRNA for valerophenone synthase, complete
           cds.>gb:AB047593_1520620 Humulus lupulus vps gene for
           valerophenone synthase, complete cds.
          Length = 394

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWY---ELAYLEAK-GKVAGGDRL-WQ 444
           +LDE++A + L+   M+ SR  L  +GN S +S+++   E+    +K GK   GD L W 
Sbjct: 312 ILDEIEAKLELKKEKMKASREMLSEYGNMSCASVFFIVDEMRKQSSKEGKSTTGDGLEWG 371

Query: 443 IVFGSG 426
            +FG G
Sbjct: 372 ALFGFG 377



>sp|P51082|CHSB_PEA Chalcone synthase 1B (EC 2.3.1.74)
           (Naringenin-chalcone synthase 1B).>pir|S49203|S49203
           naringenin-chalcone synthase (EC 2.3.1.74) - garden
           pea>gb:PSCHSAB_1702087 P.sativum gene for chalcone
           synthase.
          Length = 389

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A + L+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSLF--WIAHPGGPAILDQVEAKLSLKQRKMQATRHVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKGK-----VAGGDRLWQIVFGSG 426
             K K       G    W ++FG G
Sbjct: 350 RRKSKEEQLGTTGEGLEWGVLFGFG 374



>gb:AP003278_1827107 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0518F01.>gb:AP003330_1828018 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1085F01.
          Length = 354

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 7/86 (8%)
 Frame = -3

Query: 629 IYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL----EAKGKVAG 462
           ++A  + +LD +++ +GL    +E SRA + ++GNT SS +   +  +    E +G    
Sbjct: 266 VHAGGREILDRMESKLGLGKEKLEASRAVMAQYGNTRSSCVVLVMEEMRRRSEERGLRTA 325

Query: 461 GDRL---WQIVFGSGFKCNSAVWRAV 393
           G+ L     + FG G    + V RA+
Sbjct: 326 GEGLDMGMLVGFGPGLTVETIVLRAL 351



>gb:AF511470_1807269 Chrysanthemum nankingense chalcone synthase
           (CHS18) gene, partial cds.
          Length = 276

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLKEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           + FG
Sbjct: 272 VFFG 275



>gb:AF511463_1807262 Chrysanthemum indicum var. aromaticum chalcone
           synthase (CHS15) gene, partial cds.
          Length = 276

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 5/64 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL +  M+ +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 212 ILDQVELKLGLNEEKMKATRQVLSEYGNMSSACVLFILDEMRKKSIEDGKTTTGEGLDWG 271

Query: 443 IVFG 432
           ++FG
Sbjct: 272 VLFG 275



>gb:AF144535_1771940 Thlaspi arvense chalcone synthase (chs) gene,
           complete cds.
          Length = 395

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG----GDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + +  +  K K  G    G+ L W 
Sbjct: 315 ILDQVELKLGLKEEKMRATRHVLSEYGNMSSACVLFIMDEMRRKSKEDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112094_1769066 Halimolobos perplexa var. perplexa chalcone
           synthase gene, complete cds.
          Length = 395

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  FGN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRHVLSEFGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AY237728_1592193 Glycine max chalcone synthase (chs8) gene,
           complete cds.
          Length = 389

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RRKSAENGLKTTGEGLEWGVLFGFG 374



>gb:AY170347_1586557 Arachis hypogaea trihydroxystilbene synthase
           mRNA, complete cds.
          Length = 389

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYEL--- 495
           I DY   F  +  +   + +LD+++  + L+   M+ +R  L  +GN SS+ +++ +   
Sbjct: 292 ISDYNSIF--WIAHPGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLM 349

Query: 494 --AYLEAKGKVAGGDRLWQIVFGSG 426
               LE K K  G    W ++FG G
Sbjct: 350 RKRSLEGKLKTTGEGFDWGVLFGFG 374



>gb:ATH18603_1552043 Arabidopsis thaliana chs gene, partial, exons 1
           and 2, JK196 mutant.
          Length = 395

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = -3

Query: 626 YAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGG 459
           Y     +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G
Sbjct: 309 YPGGPAILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTG 368

Query: 458 DRL-WQIVFGSG 426
           + L W ++FG G
Sbjct: 369 EGLEWGVLFGFG 380



>gb:AB058638_1521722 Lilium hybrid division I LhCHSA mRNA for
           chalcone synthase, partial cds.
          Length = 394

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWY---ELAYLEAK-GKVAGGDRL-WQ 444
           +LD++ A +GL+   M  +R  L  +GN SS+ + +   E+    AK GK   G+ L W 
Sbjct: 311 ILDQVAAKLGLQKEKMRATRHVLSEYGNMSSACVLFILDEMRKTSAKMGKATTGEGLDWG 370

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 371 VLFGFG 376



>gb:AB027606_1517520 Arachis hypogaea mRNA for stilbene synthase,
           complete cds.
          Length = 389

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +   + +LD+++  + L+   M+ +R  L  +GN SS+ +++ +  +
Sbjct: 292 ISDYNSIF--WIAHPGGRAILDQVEEKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K   AG    G+ L W ++FG G
Sbjct: 350 RKKSLEAGLKTTGEGLDWGVLFGFG 374



>gb:AY078067_587876 Saccharopolyspora erythraea red pigment gene
           cluster, partial sequence.
          Length = 367

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 641 DHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG 462
           D + I+A    +LD+L   +G+       SRATL ++GN +S+ +   L  +  +G++  
Sbjct: 265 DFYVIHAGGPRILDDLTKFLGVPSEAFRHSRATLAQYGNIASAVVLDALRRIIEEGRLES 324

Query: 461 GDRLWQIVFGSGFKCNSAV 405
           G R     FG G     +V
Sbjct: 325 GARGMIAGFGPGITAEMSV 343



>pir|A53050|A53050 brefeldin A esterase - Bacillus
           subtilis>gb:BACESTERAS_745226 Bacillus subtilis esterase
           gene, complete cds.
          Length = 372

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = -1

Query: 700 ATCLAPPRSGRTYRTTSW--PSTTFASTRPARWFWTSCRPTWA*GTATWSPAAP 545
           AT  +P R G   R  +W   ST+ + TRP     T CRP W+   ATW  + P
Sbjct: 311 ATRASPSREGWRGRAWTWRLASTSGSCTRPTSSSGTGCRPLWSRPCATWPGSPP 364



>pir|S60241|S60241 acridone synthase - Ruta graveolens
          Length = 391

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  S+  +  +GN SSS + + L  + ++    GK   G  L W 
Sbjct: 309 ILDQIEEKLGLKEDKLRASKHVMSEYGNMSSSCVLFVLDEMRSRSLQDGKSTTGQGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>pir|JQ1071|JQ1071 naringenin-chalcone synthase (EC 2.3.1.74) -
           soybean  (fragment)
          Length = 331

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 234 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEM 291

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 292 RRKSAENGHKTTGEGLEWGVLFGFG 316



>pir|T15054|T15054 anther-specific protein - wood
           tobacco>gb:NSCHSLKA1_1691169 Nicotiana sylvestris CHSLK
           gene.>gb:NSCHSLKG3_1691170 Nicotiana sylvestris CHSLK
           gene.
          Length = 363

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 4/85 (4%)
 Frame = -3

Query: 635 FCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL--EAKGKVAG 462
           + ++     +L+ L+  + L+   ++ SR  L  +GN SS++I+Y + Y+  E K K  G
Sbjct: 280 WAVHPGGPAILNRLENTLKLQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKKNG 339

Query: 461 GDRLW--QIVFGSGFKCNSAVWRAV 393
           G+  W   + FG G      + R++
Sbjct: 340 GEE-WGLALAFGPGITFEGILLRSL 363



>sp|Q9LKP7|CHSY_DIAMO Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>gb:AF267173_1781953
           Dianthus monspessulanus chalcone synthase (chs) mRNA,
           complete cds.
          Length = 391

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++A +GL++  +  +R  L  FGN SS+ + + L  +  K    G    G+ L W 
Sbjct: 309 ILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>sp|P48389|CHSY_DIACA Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>pir|T10713|T10713
           naringenin-chalcone synthase (EC 2.3.1.74) - clove
           pink>gb:DCCHSMR_1675661 D.caryophyllus mRNA for chalcone
           synthase.
          Length = 391

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++A +GL++  +  +R  L  FGN SS+ + + L  +  K    G    G+ L W 
Sbjct: 309 ILDQVEAKLGLKEEKLAATRNVLSDFGNMSSACVLFILDEMRKKSLRDGATTTGEGLDWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>sp|P30081|CHS7_SOYBN Chalcone synthase 7 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 7).>pir|JQ2250|JQ2250
           naringenin-chalcone synthase (EC 2.3.1.74) -
           soybean>gb:SOYCHS7A_1715980 Glycine max chalcone
           synthase (chs7) gene, complete cds.
          Length = 389

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RRKSAENGHKTTGEGLEWGVLFGFG 374



>sp|Q01288|CHS6_PEA Chalcone synthase 6 (EC 2.3.1.74)
           (Naregenin-chalcone synthase 6).>pir|S20933|S20933
           naringenin-chalcone synthase (EC 2.3.1.74) 3 - garden
           pea>gb:PSPCHS3_1702329 P.sativum PSCHS3 mRNA for
           chalcone synthase.
          Length = 389

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 IDDYNSIF--WIAHPGGPAILDQVEEKLGLKPEKMKATREVLSEYGNMSSACVLFILDEM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RKKSAQQGLKTTGEGLDWGVLFGFG 374



>sp|P51079|CHS6_MEDSA Chalcone synthase 6-4 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 6-4)
           (Fragment).>pir|S44369|S44369 naringenin-chalcone
           synthase (EC 2.3.1.74) - alfalfa>gb:U01020_1726195
           Medicago sativa clone MsCHS6-4 chalcone synthase mRNA,
           partial cds.
          Length = 285

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 188 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATREVLSEYGNMSSACVLFILDEM 245

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 246 RKKSAQQGLKTTGEGLDWGVLFGFG 270



>sp|Q9SBL5|CHS4_SORBI Chalcone synthase 4 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 4).>gb:AF152551_1772799
           Sorghum bicolor chalcone synthase 4 (CHS4) gene,
           complete cds.
          Length = 401

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++A +GL+   M  +R  L  +GN SS+ + + L  +
Sbjct: 296 ITDYNSIF--WVAHPGGPAILDQVEAKVGLKKERMRATRHVLSEYGNMSSACVLFILDEM 353

Query: 485 EAK----GKVAGGDRL-WQIVFGSG 426
             +    G+   G+ L W ++FG G
Sbjct: 354 RKRSAEDGQATTGEGLDWGVLFGFG 378



>sp|Q9FSB9|CHS1_RUTGR Chalcone synthase 1 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 1).>gb:RGR297789_1703459
           Ruta graveolens mRNA for chalcone synthase (chs1 gene).
          Length = 393

 Score = 38.1 bits (87), Expect = 0.29
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLE----AKGKVAGGDRL-WQ 444
           +LD+++A +GL++  +  +R  L  +GN SS+ + + L  +      +G+   G+ L W 
Sbjct: 311 ILDQVEAKLGLKEEKLRATRQVLSEYGNMSSACVLFILDEMRKNCAEEGRATTGEGLDWG 370

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 371 VLFGFG 376



>gb:AF456446_1801204 Hydrangea macrophylla stilbenecarboxylate
           synthase (STCS2) gene, complete cds.
          Length = 399

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +L+++QA +GL++  +  SR  L  +GN SS+ +++ +  +  +    GK   G+ L W 
Sbjct: 319 ILNQVQAKVGLKEEKLRVSRHILSEYGNMSSACVFFIMDEMRKRSVEEGKGTTGEGLEWG 378

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 379 VLFGFG 384



>gb:AF456445_1801203 Hydrangea macrophylla stilbenecarboxylate
           synthase (STCS1) mRNA, complete cds.
          Length = 399

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +L+++QA +GL++  +  SR  L  +GN SS+ +++ +  +  +    GK   G+ L W 
Sbjct: 319 ILNQVQAKVGLKEEKLRVSRHILSEYGNMSSACVFFIMDEMRKRSVEEGKGTTGEGLEWG 378

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 379 VLFGFG 384



>gb:AF112102_1769074 Arabis pauciflora chalcone synthase gene,
           complete cds.
          Length = 395

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD +Q  +GL+   M  +R  L  +GN SS+ +++ L  ++ K    G    G+ L W 
Sbjct: 315 ILDHVQIKLGLKAEKMRATRHVLSEYGNMSSACVFFILDEMKRKAAEDGAATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AY670100_1620775 Vitis vinifera clone 336744_S4 stilbene
           synthase mRNA, partial cds.
          Length = 151

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 15/89 (16%)
 Frame = -3

Query: 647 AFDHFCI----------YAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYE 498
           AFD  CI          +     +LD ++A +GL    ++ +R  L  +GN SS+ + + 
Sbjct: 45  AFDPICISDWNSLFWIAHPGGPAILDAVEAKVGLDKQKLKATRHILSEYGNMSSACVLFI 104

Query: 497 LAYLEAK----GKVAGGDRL-WQIVFGSG 426
           L  +  K    GK   G+ L W ++FG G
Sbjct: 105 LDEMRKKSLKEGKTTTGEGLDWGVLFGFG 133



>gb:AB011468_1511334 Hydrangea macrophylla ctas mRNA for coumaroyl
           triacetic acid synthase, complete cds.
          Length = 399

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +L+++QA +GL++  +  SR  L  +GN SS+ +++ +  +  +    GK   G+ L W 
Sbjct: 319 ILNQVQAKVGLKEEKLRVSRHILSEYGNMSSACVFFIMDEMRKRSMEEGKGTTGEGLEWG 378

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 379 VLFGFG 384



>gb:AME16952_553221 Amycolatopsis balhimycina biosynthetic gene
           cluster for balhimycin, strain DSM 5908.
          Length = 372

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 20/71 (28%), Positives = 33/71 (46%)
 Frame = -3

Query: 638 HFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGG 459
           H+ +++  K V+D +  N+GL   D+  +   L  +GN SS S  +    L  +G    G
Sbjct: 292 HWLVHSGGKKVIDSVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLAEEGVTRPG 351

Query: 458 DRLWQIVFGSG 426
           D    +  G G
Sbjct: 352 DYGVLMTMGPG 362



>sp|P51090|CHSY_VITVI Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>gb:VVCHS_1727479
           V.vinifera CHS mRNA for chalcone synthase.
          Length = 393

 Score = 37.7 bits (86), Expect = 0.38
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  +R  L  +GN SS+ + + L  +  K    GK + G+ L W 
Sbjct: 309 ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGSTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF144537_1771942 Alliaria petiolata chalcone synthase (chs)
           gene, complete cds.
          Length = 395

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG----GDRL-WQ 444
           +LD+++  +GL+   M  +R  L  +GN SS+ + + L  +  K K  G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112106_1769078 Capsella rubella chalcone synthase gene,
           complete cds.
          Length = 395

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD ++  +GL++  M  +R  L  FGN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDRVEIKLGLKEEKMRATRHVLSEFGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF076335_1766180 Brassica napus chalcone synthase B1 (CHSB1)
           mRNA, complete cds.
          Length = 394

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG----GDRL-WQ 444
           +LD+++  +GL+   M  +R  L  +GN SS+ + + L  +  K K  G    G+ L W 
Sbjct: 314 ILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWG 373

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 374 VLFGFG 379



>gb:AF020709_1761696 Vitis vinifera chalcone synthase (CHS) mRNA,
           complete cds.
          Length = 454

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 309 ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AB066275_1522562 Vitis vinifera CHS2 gene for chalcone synthase,
           complete cds.
          Length = 393

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  +  +R  L  +GN SS+ + + L  +  K    GK   G+ L W 
Sbjct: 309 ILDQVELKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRKKSIEEGKGTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>pir|C75334|C75334 3-oxoacyl-acyl carrier protein synthase III -
           Deinococcus radiodurans (strain R1)>gb:AE002033_42197
           Deinococcus radiodurans R1 section 170 of 229 of the
           complete chromosome 1.>gb:AE000513_883092 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 379

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = -3

Query: 563 MEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSA 408
           +E +   L R+GNTS++SI   LA  +A+G+   GD+L    FG G    +A
Sbjct: 314 IERAVTNLDRYGNTSAASIPLALAEAQAQGRFKDGDQLLLAGFGGGLSWGAA 365



>sp|Q9RT22|FAH2_DEIRA 3-oxoacyl-[acyl-carrier-protein] synthase III
           protein 2 (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase III
           2) (KAS III 2).
          Length = 338

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = -3

Query: 563 MEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFKCNSA 408
           +E +   L R+GNTS++SI   LA  +A+G+   GD+L    FG G    +A
Sbjct: 273 IERAVTNLDRYGNTSAASIPLALAEAQAQGRFKDGDQLLLAGFGGGLSWGAA 324



>sp|Q9RT23|FAH1_DEIRA 3-oxoacyl-[acyl-carrier-protein] synthase III
           protein 1 (EC 2.3.1.41) (Beta-ketoacyl-ACP synthase III
           1) (KAS III 1).>pir|B75334|B75334 3-oxoacyl-acyl carrier
           protein synthase III - Deinococcus radiodurans (strain
           R1)>gb:AE002033_42196 Deinococcus radiodurans R1 section
           170 of 229 of the complete chromosome
           1.>gb:AE000513_883091 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 341

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 3/70 (4%)
 Frame = -3

Query: 563 MEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQIVFGSGFK---CNSAVWRAV 393
           ME +   L R+GNTS+ ++   L      G++ GG +L  +VFG G     C    W   
Sbjct: 267 MEKTVINLDRYGNTSAGTVPLALYEAVNDGRIQGGQQLLMVVFGGGLSWAACTMKWWGGR 326

Query: 392 RRIRMPTANP 363
             +    A P
Sbjct: 327 PSLHAQVAQP 336



>sp|P23569|CHSY_PUELO Chalcone synthase (EC 2.3.1.74)
           (Naringenin-chalcone synthase).>pir|JQ0911|SYFJCP
           naringenin-chalcone synthase (EC 2.3.1.74) I - kudzu
           vine>gb:PUECHS_1702858 Pueraria lobata mRNA for chalcone
           synthase, complete cds.
          Length = 389

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M+ +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMKATRDVLSDYGNMSSACVLFILDEM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RRKSAENGLKTTGEGLEWGVLFGFG 374



>sp|P13417|CHS3_SINAL Chalcone synthase 3 (EC 2.3.1.74)
           (Naringenin-chalcone synthase 3).>pir|S06877|SYISC3
           naringenin-chalcone synthase (EC 2.3.1.74) 3 - white
           mustard>gb:SASCHS3_1704769 Mustard mRNA for chalcone
           synthase (SCHS3).
          Length = 395

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAG----GDRL-WQ 444
           +LD+++  +GL+   M  +R  L  +GN SS+ + + L  +  K K  G    G+ L W 
Sbjct: 315 ILDDVEKKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRRKSKEDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>sp|Q01286|CHS1_PEA Chalcone synthase 1 (EC 2.3.1.74)
           (Naregenin-chalcone synthase 1).>pir|S33610|S33610
           naringenin-chalcone synthase (EC 2.3.1.74) 1 - garden
           pea>gb:PEACHS1_1699647 Pisum sativum PsCHS1 gene for
           chalcone synthase, complete cds.>gb:PSPCHS1_1702327
           P.sativum PSCHS1 mRNA for chalcone synthase.
          Length = 389

 Score = 37.4 bits (85), Expect = 0.50
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +     +LD+++  +GL+   M  +R  L  +GN SS+ + + L  +
Sbjct: 292 ISDYNSIF--WIAHPGGPAILDQVEQKLGLKPEKMRATREVLSEYGNMSSACVLFILDQM 349

Query: 485 EAKGKVAG----GDRL-WQIVFGSG 426
             K    G    G+ L W ++FG G
Sbjct: 350 RKKSTQDGLNTTGEGLEWGVLFGFG 374



>gb:SHU27488_2451523 Suid herpesvirus 1 glycoprotein gX mRNA,
           partial cds.
          Length = 103

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 25/73 (34%), Positives = 30/73 (41%), Gaps = 10/73 (13%)
 Frame = -1

Query: 685 PPRSGRTYRTTSWPSTTFASTRPA--RWFWTSCRPTW--------A*GTATWSPAAPRYT 536
           PP   R  R TS P +T AS  PA   W  +SC   W           TATW P  P   
Sbjct: 19  PPPPRRACRATSAPRSTSASPSPAWSSWASSSCASIWRSSGPGPGTTATATWPPPDPAPP 78

Query: 535 ASATLPAAAYGTS 497
            S  +P  ++  S
Sbjct: 79  DSPAIPPLSHRVS 91



>gb:AF232689_2218901 Rat cytomegalovirus Maastricht, complete
           genome.
          Length = 629

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 30/104 (28%), Positives = 46/104 (44%), Gaps = 3/104 (2%)
 Frame = -1

Query: 697 TCLAPPR---SGRTYRTTSWPSTTFASTRPARWFWTSCRPTWA*GTATWSPAAPRYTASA 527
           T  APPR     R   +++ P T  +++ PA W  T+         + W+  +   T++A
Sbjct: 401 TDAAPPRRPAGPRGASSSTAPGTGRSASPPACWTATA---------SCWTSPSSGPTSTA 451

Query: 526 TLPAAAYGTSWRTWRPRGRWPAATASGRSCSGPVSNATAPCGGP 395
           T    A GT        GR  AAT+ G + S   ++   PCG P
Sbjct: 452 TRTRTAGGT--------GRATAATSDGTAASSRTTSPARPCGSP 487



>gb:AJ619910_1812275 Arabidopsis thaliana partial chs gene for
           chalcone synthase, exons 1-2, ecotype Ll-0.
          Length = 390

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 314 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 373

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 374 VLFGFG 379



>gb:AJ619907_1812272 Arabidopsis thaliana partial chs gene for
           chalcone synthase, exons 1-2, ecotype
           Mrk-0.>gb:AJ619908_1812273 Arabidopsis thaliana partial
           chs gene for chalcone synthase, exons 1-2, ecotype
           Kas-1.>gb:AJ619909_1812274 Arabidopsis thaliana partial
           chs gene for chalcone synthase, exons 1-2, ecotype
           Ler.>gb:AJ619911_1812276 Arabidopsis thaliana partial
           chs gene for chalcone synthase, exons 1-2, ecotype
           Col-0.>gb:AJ619912_1812277 Arabidopsis thaliana partial
           chs gene for chalcone synthase, exons 1-2, ecotype
           Lip-0.>gb:AJ867820_1815065 Arabidopsis thaliana partial
           chs gene for chalcone synthase, promoter and exons 1-2,
           ecotype Oy-0.>gb:AJ867821_1815066 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Ei-2.>gb:AJ867822_1815067 Arabidopsis
           thaliana partial chs gene for chalcone synthase,
           promoter and exons 1-2, ecotype
           Da1-12.>gb:AJ867823_1815068 Arabidopsis thaliana partial
           chs gene for chalcone synthase, promoter and exons 1-2,
           ecotype Pi-0.>gb:AJ867824_1815069 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Cvi-0.>gb:AJ867825_1815070
           Arabidopsis thaliana partial chs gene for chalcone
           synthase, promoter and exons 1-2, ecotype
           Can-0.>gb:AJ867826_1815071 Arabidopsis thaliana partial
           chs gene for chalcone synthase, promoter and exons 1-2,
           ecotype Tsu-1.>gb:AJ867827_1815072 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Ka-0.>gb:AJ867828_1815073 Arabidopsis
           thaliana partial chs gene for chalcone synthase,
           promoter and exons 1-2, ecotype
           Lz-0.>gb:AJ867829_1815074 Arabidopsis thaliana partial
           chs gene for chalcone synthase, promoter and exons 1-2,
           ecotype Ler-0.>gb:AJ867830_1815075 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Sorbo.>gb:AJ867831_1815076
           Arabidopsis thaliana partial chs gene for chalcone
           synthase, promoter and exons 1-2, ecotype
           Shakhdara.>gb:AJ867832_1815077 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Kas-1.>gb:AJ867833_1815078
           Arabidopsis thaliana partial chs gene for chalcone
           synthase, promoter and exons 1-2, ecotype
           Mrk-0.>gb:AJ867834_1815079 Arabidopsis thaliana partial
           chs gene for chalcone synthase, promoter and exons 1-2,
           ecotype Gue-0.>gb:AJ867835_1815080 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Ws-0.>gb:AJ867836_1815081 Arabidopsis
           thaliana partial chs gene for chalcone synthase,
           promoter and exons 1-2, ecotype
           Petergof.>gb:AJ867837_1815082 Arabidopsis thaliana
           partial chs gene for chalcone synthase, promoter and
           exons 1-2, ecotype Lip-0.>gb:AJ867838_1815083
           Arabidopsis thaliana partial chs gene for chalcone
           synthase, promoter and exons 1-2, ecotype Rsch-0.
          Length = 390

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 314 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 373

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 374 VLFGFG 379



>gb:AJ619896_1812261 Arabidopsis halleri partial chs gene for
           chalcone synthase, exons 1-2, chsCH-1a
           allele.>gb:AJ619897_1812262 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-1b
           allele.>gb:AJ619898_1812263 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-2a
           allele.>gb:AJ619899_1812264 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-2b
           allele.>gb:AJ619900_1812265 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, isolate
           CH-3.>gb:AJ619901_1812266 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-4a
           allele.>gb:AJ619902_1812267 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-4b
           allele.>gb:AJ619903_1812268 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-6a
           allele.>gb:AJ619904_1812269 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, chsCH-6b
           allele.>gb:AJ619905_1812270 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, isolate
           CH-5.>gb:AJ619906_1812271 Arabidopsis halleri partial
           chs gene for chalcone synthase, exons 1-2, isolate CH-7.
          Length = 391

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AHGSG11_1811128 A.hypogaea resveratrol synthase gene (clone
           pGSG11).
          Length = 266

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +   + +LD+++  + L+   M+ +R  L  +GN SS+ +++ +  +
Sbjct: 169 ISDYNSIF--WIAHLGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLM 226

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 227 RKKSLETGLKTTGEGLDWGVLFGFG 251



>gb:AF400566_1796034 Rubus idaeus chalcone synthase 11 (CHS11) mRNA,
           complete cds.
          Length = 391

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++  +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF400565_1796033 Rubus idaeus chalcone synthase 5 (CHS5) mRNA,
           complete cds.
          Length = 391

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++  +GL+   +E +R  L  +GN SS+ + + L  +  K      K  G    W 
Sbjct: 309 ILDQVETKLGLKPEKLEATRHILSEYGNMSSACVLFILDEVRRKSATNGLKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF292368_1783768 Rubus idaeus aromatic polyketide synthase
           (PKS2) gene, complete cds.
          Length = 391

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKG-----KVAGGDRLWQ 444
           +LD+++A +GL+   +E +R  L  +GN SS+ +   L  +  K      K  G    W 
Sbjct: 309 ILDQVEAKLGLKPEKLEATRNILSEYGNMSSACVLLILDEVRRKSVANGHKTTGEGLEWG 368

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 369 VLFGFG 374



>gb:AF169799_1774228 Lilium hybrid cv. 'Acapulco' chalcone synthase
           (CHS2) mRNA, complete cds.
          Length = 412

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLE----AKGKVAGGDRL-WQ 444
           +LD+++  + L+   M+ +R  L  +GN SS+ + + L  +     A+GK   G+ L W 
Sbjct: 329 ILDQVEERLALKKEKMKATRHVLSEYGNMSSACVLFILDEMRKNSAAEGKATTGEGLEWG 388

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 389 VLFGFG 394



>gb:AF144533_1771938 Arabidopsis korshinskyi chalcone synthase (chs)
           gene, complete cds.
          Length = 395

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVELKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112105_1769077 Arabis procurrens chalcone synthase gene,
           complete cds.
          Length = 396

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL+   M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 316 ILDQVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFNLDEMRKKSVEDGAATTGEGLEWG 375

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 376 VLFGFG 381



>gb:AF112096_1769068 Arabis hirsuta chalcone synthase gene, complete
           cds.
          Length = 396

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LDE++  +GL+   M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 316 ILDEVEIKLGLKAEKMRATRHVLSEYGNMSSACVLFILDEMRKKSVEDGAATTGEGLEWG 375

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 376 VLFGFG 381



>gb:AF112095_1769067 Arabidopsis halleri chalcone synthase gene,
           complete cds.
          Length = 396

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 316 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 375

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 376 VLFGFG 381



>gb:AF112093_1769065 Arabidopsis griffithiana isolate AgrifB
           chalcone synthase gene, complete cds.
          Length = 395

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112092_1769064 Arabidopsis griffithiana isolate AgrifA
           chalcone synthase gene, complete cds.
          Length = 395

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AF112091_1769063 Arabis glabra chalcone synthase gene, complete
           cds.
          Length = 395

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRYVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:S80554_1704595 (tt4(85))=chalcone synthase [Arabidopsis,
           Lansberg erecta, tt4, Genomic Mutant, 1443 nt].
          Length = 395

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 315 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 374

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 375 VLFGFG 380



>gb:AY670215_1620890 Vitis vinifera clone 361643_S5 stilbene
           synthase mRNA, partial cds.
          Length = 151

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 6/76 (7%)
 Frame = -3

Query: 635 FCIYAPS-KVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GK 471
           F I  PS   +LD ++A +GL    ++ +R  L  +GN SS+ + + L  +  K    GK
Sbjct: 58  FWIAHPSGPAILDAVEAKVGLDKQKLKATRHILSEYGNMSSACVLFILDEMRKKSLKEGK 117

Query: 470 VAGGDRL-WQIVFGSG 426
              G+ L W ++FG G
Sbjct: 118 TTTGEGLDWGVLFGFG 133



>gb:AY670151_1620826 Vitis vinifera clone 357854_S2 stilbene
           synthase mRNA, partial cds.>gb:AY670188_1620863 Vitis
           vinifera clone 361608_S1 stilbene synthase mRNA, partial
           cds.>gb:AY670193_1620868 Vitis vinifera clone 361616_S1
           stilbene synthase mRNA, partial cds.>gb:AY670222_1620897
           Vitis vinifera clone 361651_S1 stilbene synthase mRNA,
           partial cds.>gb:AY670237_1620912 Vitis vinifera clone
           361673_S1 stilbene synthase mRNA, partial
           cds.>gb:AY670303_1620978 Vitis vinifera clone 361765_S2
           stilbene synthase mRNA, partial cds.
          Length = 151

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD ++A +GL    ++ +R  L  +GN SS+ + + L  +  K    GK+  G+ L W 
Sbjct: 68  ILDAVEAKLGLDKQKLKATRHILSEYGNMSSACVLFILDEMRKKSLKEGKMTTGEGLDWG 127

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 128 VLFGFG 133



>gb:AY309966_1598096 Gypsophila paniculata chalcone synthase (chs)
           mRNA, partial cds.
          Length = 334

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++A +GL++  +  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 252 ILDQVEAKLGLKEDKLTATRNVLSDYGNMSSACVLFILDEMRNKSLRDGAATTGEGLDWG 311

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 312 VLFGFG 317



>gb:AY087778_1572805 Arabidopsis thaliana clone 38370 mRNA, complete
           sequence.
          Length = 393

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = -3

Query: 608 VLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAK----GKVAGGDRL-WQ 444
           +LD+++  +GL++  M  +R  L  +GN SS+ + + L  +  K    G    G+ L W 
Sbjct: 313 ILDQVEIKLGLKEEKMRATRHVLSEYGNMSSACVLFILDEMRRKSAKDGVATTGEGLEWG 372

Query: 443 IVFGSG 426
           ++FG G
Sbjct: 373 VLFGFG 378



>gb:AE013598_294579 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 356

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 26/74 (35%), Positives = 34/74 (45%)
 Frame = -3

Query: 620 PSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQI 441
           P +  L  ++A     D  ME    T+ R GNTSS+S+   L      G+V  G  L   
Sbjct: 282 PHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVRSGRVQRGQLLLLE 341

Query: 440 VFGSGFKCNSAVWR 399
            FG GF   SA+ R
Sbjct: 342 AFGGGFAWGSALLR 355



>pir|S00334|S00334 resveratrol synthase (EC 2.3.1.-) (clone
           pGSG10/pGSG11) - peanut>gb:A00769_1446476 A.hypogaea
           gene for stilbene synthase.
          Length = 389

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +   + +LD+++  + L+   M+ +R  L  +GN SS+ +++ +  +
Sbjct: 292 ISDYNSIF--WIAHLGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RKKSLETGLKTTGEGLDWGVLFGFG 374



>pir|T17474|T17474 chalcone synthase homolog PCZA361.6 -
           Amycolatopsis orientalis>gb:AOPCZA361_553723
           Amycolatopsis orientalis cosmid PCZA361.
          Length = 372

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 20/71 (28%), Positives = 33/71 (46%)
 Frame = -3

Query: 638 HFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGG 459
           H+ +++  K V+D +  N+GL   D+  +   L  +GN SS S  +    L  +G    G
Sbjct: 292 HWLVHSGGKKVVDAVVVNLGLSRHDVRHTTGVLRDYGNLSSGSFLFSYERLAEEGVARPG 351

Query: 458 DRLWQIVFGSG 426
           D    +  G G
Sbjct: 352 DYGVLMTMGPG 362



>sp|P20178|THS1_ARAHY Stilbene synthase 1 (EC 2.3.1.95) (Resveratrol
           synthase 1) (RS1) (Trihydroxystilbene synthase 1).
          Length = 389

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 5/85 (5%)
 Frame = -3

Query: 665 IPDYKLAFDHFCIYAPSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYL 486
           I DY   F  +  +   + +LD+++  + L+   M+ +R  L  +GN SS+ +++ +  +
Sbjct: 292 ISDYNSIF--WIAHLGGRAILDQVEQKVNLKPEKMKATRDVLSNYGNMSSACVFFIMDLM 349

Query: 485 EAKG-----KVAGGDRLWQIVFGSG 426
             K      K  G    W ++FG G
Sbjct: 350 RKKSLETGLKTTGEGLDWGVLFGFG 374



>sp|Q8PBV1|FABH_XANCP 3-oxoacyl-[acyl-carrier-protein] synthase III
           (EC 2.3.1.41) (Beta- ketoacyl-ACP synthase III) (KAS
           III).>gb:AE012198_280272 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 106 of 460 of the
           complete genome.>gb:AE008922_913554 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 325

 Score = 37.0 bits (84), Expect = 0.65
 Identities = 26/74 (35%), Positives = 34/74 (45%)
 Frame = -3

Query: 620 PSKVVLDELQANMGLRDGDMEPSRATLHRFGNTSSSSIWYELAYLEAKGKVAGGDRLWQI 441
           P +  L  ++A     D  ME    T+ R GNTSS+S+   L      G+V  G  L   
Sbjct: 251 PHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVRSGRVQRGQLLLLE 310

Query: 440 VFGSGFKCNSAVWR 399
            FG GF   SA+ R
Sbjct: 311 AFGGGFTWGSALLR 324


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,126,335,117
Number of Sequences: 1806583
Number of extensions: 25362897
Number of successful extensions: 87240
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 80127
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 86744
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 78340922000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)