BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2557
         (784 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T05821|T05821 hypothetical protein T5K18.160 - Arabidopsis t...   259   5e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023069 Oryza sativa (japonica cultivar-group) chrom...   196   4e-49   
gb:AC078948_1541639 Oryza sativa chromosome 10 BAC OSJNBa0001K12...   196   5e-49   
gb:AE016959_1023071 Oryza sativa (japonica cultivar-group) chrom...   196   5e-49   
gb:ATH316230_1552490 Arabidopsis thaliana mRNA for alcohol oxida...   194   2e-48   
gb:AB015474_1512563 Arabidopsis thaliana genomic DNA, chromosome...   194   2e-48   
gb:AE016959_1023063 Oryza sativa (japonica cultivar-group) chrom...   192   5e-48   
pir|A86171|A86171 hypothetical protein [imported] - Arabidopsis ...   188   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AY085885_1570948 Arabidopsis thaliana clone 19314 mRNA, compl...   186   6e-46   
gb:AY039977_1560481 Arabidopsis thaliana unknown protein (At4g28...   186   6e-46   
pir|T10651|T10651 hypothetical protein T5F17.20 - Arabidopsis th...   186   6e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AP004053_1836984 Oryza sativa (japonica cultivar-group) genom...   181   1e-44   
gb:AP006618_557372 Nocardia farcinica IFM 10152 DNA, complete ge...   112   6e-24   
pir|B75608|B75608 GMC oxidoreductase - Deinococcus radiodurans (...   110   3e-23   Deinococcus radiodurans
gb:AY538780_1612481 Candida tropicalis fatty alcohol oxidase (FA...    98   2e-19   
gb:CR382137_1669722 Debaryomyces hansenii chromosome E of strain...    96   1e-18   
gb:CCL242497_1645827 Candida cloacae mRNA for long chain fatty a...    93   6e-18   
gb:AY538782_1612483 Candida tropicalis fatty alcohol oxidase (FA...    91   3e-17   
gb:CTR242496_1674233 Candida tropicalis mRNA for long chain fatt...    89   7e-17   
gb:AY538781_1612482 Candida tropicalis fatty alcohol oxidase (FA...    88   2e-16   
gb:CCL242498_1645828 Candida cloacae mRNA for long chain fatty a...    87   3e-16   
gb:AP004396_1841143 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AE011196_270280 Leptospira interrogans serovar lai str. 56601...    80   4e-14   
gb:AE016793_334501 Pseudomonas putida KT2440 section 20 of 21 of...    79   1e-13   
gb:AY196214_596382 Streptomyces griseochromogenes blasticidin bi...    76   6e-13   
gb:AP005523_1853417 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:BA000045_742079 Gloeobacter violaceus PCC 7421 DNA, complete ...    72   2e-11   
gb:AP005520_1853357 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AL646081_549274 Ralstonia solanacearum GMI1000 megaplasmid, c...    69   1e-10   
gb:AE000516_20504 Mycobacterium tuberculosis CDC1551, complete g...    69   1e-10   
pir|B83600|B83600 probable oxidoreductase PA0364 [imported] - Ps...    69   1e-10   Pseudomonas aeruginosa
pir|G70744|G70744 hypothetical protein Rv0492c - Mycobacterium t...    69   1e-10   Mycobacterium tuberculosis
sp|Q11157|Y492_MYCTU|Y492_MYCTU Hypothetical GMC-type oxidoreductase Rv0492...    69   1e-10   Mycobacterium tuberculosis
gb:BX248335_757860 Mycobacterium bovis subsp. bovis AF2122/97 co...    67   4e-10   
gb:BX842648_823723 Bdellovibrio bacteriovorus complete genome, s...    64   2e-09   
gb:AE017300_435485 Leptospira interrogans serovar Copenhageni st...    64   3e-09   
gb:AE015533_315297 Shewanella oneidensis MR-1 section 82 of 457 ...    64   3e-09   
gb:AE011571_274413 Leptospira interrogans serovar lai str. 56601...    64   3e-09   
gb:CP000009_863084 Gluconobacter oxydans 621H, complete genome.        64   4e-09   
gb:AE011848_277052 Xanthomonas axonopodis pv. citri str. 306, se...    62   1e-08   
gb:AP005512_1853175 Oryza sativa (japonica cultivar-group) genom...    59   8e-08   
gb:BA000012_671192 Mesorhizobium loti MAFF303099 DNA, complete g...    57   4e-07   
gb:AL646083_549537 Ralstonia solanacearum GMI1000 megaplasmid, c...    57   4e-07   
gb:BA000040_730979 Bradyrhizobium japonicum USDA 110 DNA, comple...    57   5e-07   
gb:AE016918_357450 Chromobacterium violaceum ATCC 12472 section ...    57   5e-07   
gb:BX842653_825469 Bdellovibrio bacteriovorus complete genome, s...    56   9e-07   
gb:AY048670_586720 Streptomyces globisporus enediyne antitumor a...    56   9e-07   
gb:AE016917_357179 Chromobacterium violaceum ATCC 12472 section ...    55   1e-06   
gb:AY117439_589440 Streptomyces carzinostaticus subsp. neocarzin...    55   1e-06   
pir|AE3094|AE3094 oxidoreductase Atu4377 [imported] - Agrobacter...    55   1e-06   Agrobacterium fabrum str. C58
gb:BX571965_790508 Burkholderia pseudomallei strain K96243, chro...    55   2e-06   
pir|AD3084|AD3084 dehydrogenase Atu4296 [imported] - Agrobacteri...    55   2e-06   Agrobacterium fabrum str. C58
pir|H87451|H87451 oxidoreductase, GMC family CC1634 [imported] -...    55   2e-06   Caulobacter vibrioides
pir|JC7628|JC7628 glucoside 3-dehydrogenase (EC 1.1.99.13) - Hal...    55   2e-06   
gb:AJ847918_533757 Bacillus circulans partial butirosin biosynth...    54   3e-06   
gb:AE011555_274234 Leptospira interrogans serovar lai str. 56601...    54   4e-06   
gb:BA000013_672726 Mesorhizobium loti MAFF303099 pMLa DNA, cpmpl...    53   6e-06   
gb:MPU575934_149487 Micromonospora purpurea DOS biosynthetic gen...    52   1e-05   
sp|P55582|Y4NJ_RHISN|Y4NJ_RHISN Hypothetical GMC-type oxidoreductase Y4NJ.>...    52   1e-05   Rhizobium sp.
gb:AE017299_435348 Leptospira interrogans serovar Copenhageni st...    52   2e-05   
gb:AE011555_274233 Leptospira interrogans serovar lai str. 56601...    52   2e-05   
gb:BX569693_776433 Synechococcus sp. WH8102 complete genome; seg...    51   2e-05   
gb:AP006618_558879 Nocardia farcinica IFM 10152 DNA, complete ge...    51   2e-05   
pir|A84260|A84260 hypothetical protein Vng1035c [imported] - Hal...    51   2e-05   Halobacterium salinarum
gb:AE017231_412090 Mycobacterium avium subsp. paratuberculosis s...    51   3e-05   
gb:ANI507836_553451 Arthrobacter nicotinovorans pAO1 plasmid seq...    50   4e-05   
pir|D87452|D87452 oxidoreductase, GMC family CC1638 [imported] -...    50   6e-05   Caulobacter vibrioides
gb:BA000045_741238 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   1e-04   
gb:AY596297_632009 Haloarcula marismortui ATCC 43049 chromosome ...    49   1e-04   
gb:AE017300_435356 Leptospira interrogans serovar Copenhageni st...    49   1e-04   
pir|B38575|B38575 gluconate 2-dehydrogenase (FAD) (EC 1.1.99.3) ...    49   1e-04   Pantoea cypripedii
gb:AE011556_274244 Leptospira interrogans serovar lai str. 56601...    49   1e-04   
gb:AY120852_590152 Synechococcus sp. PCC 7942 PacS, dehydrogenas...    48   2e-04   
gb:AP008231_579724 Synechococcus elongatus PCC 6301 DNA, complet...    48   2e-04   
gb:AE017230_411661 Mycobacterium avium subsp. paratuberculosis s...    48   2e-04   
gb:AE016786_332801 Pseudomonas putida KT2440 section 13 of 21 of...    48   2e-04   
pir|H83362|H83362 gluconate dehydrogenase PA2265 [imported] - Ps...    48   2e-04   Pseudomonas aeruginosa
gb:AY596297_631649 Haloarcula marismortui ATCC 43049 chromosome ...    47   3e-04   
gb:AL646057_545051 Ralstonia solanacearum GMI1000 chromosome, co...    47   4e-04   
gb:AY466441_621205 Saccharopolyspora spinosa NRLL 18395 obscurin...    47   5e-04   
gb:BA000040_735751 Bradyrhizobium japonicum USDA 110 DNA, comple...    46   7e-04   
gb:BX957220_843662 Methanococcus maripaludis S2 complete genome;...    45   0.002   
gb:AE016780_331096 Pseudomonas putida KT2440 section 7 of 21 of ...    45   0.002   
gb:AE014291_309448 Brucella suis 1330 chromosome I, complete seq...    45   0.002   
pir|AD3255|AD3255 l-sorbose dehydrogenase (FAD) (EC 1.1.99.-) [i...    45   0.002   Brucella melitensis
gb:ABO295164_18432 Alcanivorax borkumensis AP1 alk gene cluster ...    44   0.004   
pir|S62689|S52489 choline oxidase (EC 1.1.3.17) - Arthrobacter g...    44   0.004   
gb:AB161046_1528516 Coniophora puteana cdh mRNA for cellobiose d...    43   0.006   
gb:BX908798_830347 Parachlamydia-related symbiont UWE25, complet...    43   0.006   
gb:BA000030_701320 Streptomyces avermitilis MA-4680 genomic DNA,...    43   0.006   
gb:AY744151_644897 Pseudomonas syringae putative reductase/acety...    43   0.006   
gb:AP006618_560748 Nocardia farcinica IFM 10152 DNA, complete ge...    43   0.006   
gb:CP000025_878236 Campylobacter jejuni RM1221, complete genome.       43   0.008   
gb:CP000010_867361 Burkholderia mallei ATCC 23344 chromosome 1, ...    43   0.008   
gb:BX572091_796274 Prochlorococcus marinus MED4 complete genome;...    43   0.008   
gb:BX571965_790000 Burkholderia pseudomallei strain K96243, chro...    43   0.008   
gb:BA000012_668324 Mesorhizobium loti MAFF303099 DNA, complete g...    43   0.008   
gb:AP006618_559009 Nocardia farcinica IFM 10152 DNA, complete ge...    43   0.008   
gb:STE579650_192364 Streptomyces tenebrarius tobramycin biosynth...    43   0.008   
pir|E81385|E81385 probable oxidoreductase chain Cj0415 [imported...    43   0.008   Campylobacter jejuni
gb:CP000011_869152 Burkholderia mallei ATCC 23344 chromosome 2, ...    42   0.010   
gb:BX571966_795552 Burkholderia pseudomallei strain K96243, chro...    42   0.010   
gb:BA000030_699817 Streptomyces avermitilis MA-4680 genomic DNA,...    42   0.010   
gb:AE014292_309973 Brucella suis 1330 chromosome II, complete se...    42   0.013   
gb:CR378670_95585 Photobacterium profundum SS9; segment 8/12.          42   0.013   
pir|H69213|H69213 conserved hypothetical protein MTH853 - Methan...    42   0.013   Methanothermobacter thermautotrophicus str. Delta H
pir|AE3618|AE3618 alcohol dehydrogenase (acceptor) (EC 1.1.99.-)...    42   0.013   Brucella melitensis
gb:BX640434_812083 Bordetella parapertussis strain 12822, comple...    42   0.017   
gb:BX569691_775737 Synechococcus sp. WH8102 complete genome; seg...    42   0.017   
gb:BA000030_702904 Streptomyces avermitilis MA-4680 genomic DNA,...    42   0.017   
gb:BA000012_671193 Mesorhizobium loti MAFF303099 DNA, complete g...    42   0.017   
gb:AY501993_622344 Campylobacter jejuni strain TGH 9011 contig18...    42   0.017   
gb:SCO939121_178501 Streptomyces coelicolor A3(2) complete genom...    42   0.017   
gb:CP000031_84258 Silicibacter pomeroyi DSS-3, complete genome.        42   0.017   
pir|F70736|F70736 probable choD protein - Mycobacterium tubercul...    42   0.017   Mycobacterium tuberculosis
gb:BA000040_733315 Bradyrhizobium japonicum USDA 110 DNA, comple...    41   0.022   
gb:AY589052_630482 Arthrobacter globiformis choline oxidase gene...    41   0.022   
gb:AY304485_607434 Arthrobacter globiformis strain ATCC8010 chol...    41   0.022   
gb:AL646061_545699 Ralstonia solanacearum GMI1000 chromosome, co...    41   0.022   
gb:AF065159_475245 Bradyrhizobium japonicum putative arylsulfata...    41   0.022   
sp|Q11038|YC79_MYCTU|YC79_MYCTU Hypothetical GMC-type oxidoreductase Rv1279...    41   0.022   Mycobacterium tuberculosis
gb:BA000012_669692 Mesorhizobium loti MAFF303099 DNA, complete g...    41   0.029   
gb:AF234246_1779532 Aspergillus niger glucose oxidase (GO2) gene...    40   0.037   
gb:BX571966_794226 Burkholderia pseudomallei strain K96243, chro...    40   0.037   
gb:BA000030_699508 Streptomyces avermitilis MA-4680 genomic DNA,...    40   0.037   
pir|F95901|F95901 probable GMC oxidoreductase protein SMb20496 [...    40   0.037   Sinorhizobium meliloti
gb:AB022907_1194080 Apis mellifera mRNA for glucose oxidase, com...    40   0.049   
gb:BA000012_668452 Mesorhizobium loti MAFF303099 DNA, complete g...    40   0.049   
gb:AY281353_605926 Uncultured Acidobacteria bacterium clone 32d1...    40   0.049   
gb:SME591793_187315 Sinorhizobium meliloti 1021 complete chromos...    40   0.049   
pir|AE3235|AE3235 oxidoreductase, GMC family Atu6063 [imported] ...    40   0.049   Agrobacterium fabrum str. C58
gb:AF081574_1766555 Pycnoporus cinnabarinus cellobiose dehydroge...    40   0.064   
gb:AE008692_240525 Zymomonas mobilis subsp. mobilis ZM4, complet...    40   0.064   
gb:SCO939121_178453 Streptomyces coelicolor A3(2) complete genom...    40   0.064   
gb:CP000009_864075 Gluconobacter oxydans 621H, complete genome.        39   0.083   
gb:AP006618_559008 Nocardia farcinica IFM 10152 DNA, complete ge...    39   0.083   
gb:AE017163_395264 Prochlorococcus marinus subsp. marinus str. C...    39   0.083   
gb:AE014298_1125671 Drosophila melanogaster chromosome X, comple...    39   0.11    
gb:AE014298_1125670 Drosophila melanogaster chromosome X, comple...    39   0.11    
gb:BA000040_736145 Bradyrhizobium japonicum USDA 110 DNA, comple...    39   0.11    
gb:BA000030_704833 Streptomyces avermitilis MA-4680 genomic DNA,...    39   0.11    
gb:AP006618_559181 Nocardia farcinica IFM 10152 DNA, complete ge...    39   0.11    
gb:SME591792_186995 Sinorhizobium meliloti 1021 complete chromos...    39   0.11    
pir|D70641|D70641 hypothetical protein Rv0697 - Mycobacterium tu...    39   0.11    Mycobacterium tuberculosis
sp|P13006|GOX_ASPNG|GOX_ASPNG Glucose oxidase precursor (EC 1.1.3.4) (Gluc...    39   0.11    Aspergillus niger
gb:AF029668_1762416 Trametes versicolor cellobiose dehydrogenase...    39   0.14    
gb:AY187939_1588174 Trametes versicolor cellobiose dehydrogenase...    39   0.14    
gb:AB043883_1520027 Tricholoma matsutake P2O mRNA for pyranose 2...    39   0.14    
gb:BA000012_667981 Mesorhizobium loti MAFF303099 DNA, complete g...    39   0.14    
gb:AE017242_414863 Mycobacterium avium subsp. paratuberculosis s...    39   0.14    
gb:SSP277295_190764 Sphingomonas sp. LB126 fluorene and protocat...    39   0.14    
gb:RMU39940_166497 Sinorhizobium meliloti bet operon, complete s...    39   0.14    
gb:ECU73857_134514 Escherichia coli chromosome minutes 6-8.            39   0.14    
pir|AG3424|AG3424 choline dehydrogenase (EC 1.1.99.1) [imported]...    39   0.14    Brucella melitensis
pir|JC6564|JC6564 cellobiose oxidase (EC 1.1.3.25) precursor - w...    39   0.14    Trametes versicolor
sp|P54223|BETA_RHIME|BETA_RHIME Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    39   0.14    Sinorhizobium meliloti
sp|P17444|BETA_ECOLI|BETA_ECOLI Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    39   0.14    Escherichia coli [E. coli]
sp|Q8G1Z8|BETA_BRUSU|BETA_BRUSU Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    39   0.14    Brucella suis bv. 1
sp|Q8YFY2|BETA_BRUME|BETA_BRUME Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    39   0.14    
gb:AY803992_1628629 Aspergillus niger glucose oxidase gene, part...    38   0.19    
gb:AB119106_1527912 Lyophyllum shimeji lsp2o mRNA for pyranose o...    38   0.19    
gb:AB083245_1524169 Grifola frondosa cdh mRNA for cellobiose deh...    38   0.19    
gb:AY684148_640186 Gluconobacter oxydans gluconate-2-dehydrogena...    38   0.19    
gb:AB070949_9362 Streptomyces avermitilis polyene macrolide bios...    38   0.19    
pir|E87576|E87576 choline dehydrogenase [imported] - Caulobacter...    38   0.19    Caulobacter vibrioides
pir|C97460|C97460 choline dehydrogenase (chd) [imported] - Agrob...    38   0.19    Agrobacterium fabrum str. C58
sp|Q8UH55|BETA_AGRT5|BETA_AGRT5 Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    38   0.19    Agrobacterium tumefaciens
gb:NCB10H4_1688915 Neurospora crassa DNA linkage group V BAC con...    38   0.24    
gb:BX640444_815102 Bordetella bronchiseptica strain RB50, comple...    38   0.24    
gb:BX572603_802957 Rhodopseudomonas palustris CGA009 complete ge...    38   0.24    
gb:BA000037_723121 Vibrio vulnificus YJ016 DNA, chromosome I, co...    38   0.24    
gb:AE016804_336787 Vibrio vulnificus CMCP6 chromosome I section ...    38   0.24    
gb:AE016756_324481 Escherichia coli CFT073 section 2 of 18 of th...    38   0.24    
gb:AE008692_241023 Zymomonas mobilis subsp. mobilis ZM4, complet...    38   0.24    
sp|Q8FKI9|BETA_ECOL6|BETA_ECOL6 Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    38   0.24    
sp|Q8X6C6|BETA_ECO57|BETA_ECO57 Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    38   0.24    Escherichia coli O157:H7
gb:AF535193_1809621 Peniophora sp. SG pyranose oxidase mRNA, com...    37   0.32    
gb:AY291124_1595616 Trametes ochracea strain MB49 pyranose oxida...    37   0.32    
gb:BX936398_835840 Yersinia pseudotuberculosis IP32953 genome, c...    37   0.32    
gb:BX640440_813721 Bordetella bronchiseptica strain RB50, comple...    37   0.32    
gb:AY754342_645249 Pseudomonas sp. 3Y2 type II PHA synthase oper...    37   0.32    
gb:AE017340_457133 Idiomarina loihiensis L2TR, complete genome.        37   0.32    
gb:SSU13981_191079 Streptomyces A19249 cholesterol oxidase (choM...    37   0.32    
gb:D86622_120854 Gluconobacter oxydans DNA for L-sorbosone dehyd...    37   0.32    
gb:CP000031_85137 Silicibacter pomeroyi DSS-3, complete genome.        37   0.32    
gb:AB164642_16027 Streptomyces kanamyceticus kanamycin biosynthe...    37   0.32    
sp|P12676|CHOD_STRS0|CHOD_STRS0 Cholesterol oxidase precursor (EC 1.1.3.6) ...    37   0.32    Streptomyces sp.
gb:ANI294936_1819465 Aspergillus niger ggox gene for glucose oxi...    37   0.41    
gb:AX683901_1473091 Sequence 1 from Patent WO03008588.>gb:AX6839...    37   0.41    
gb:BA000040_730657 Bradyrhizobium japonicum USDA 110 DNA, comple...    37   0.41    
gb:BA000012_666765 Mesorhizobium loti MAFF303099 DNA, complete g...    37   0.41    
gb:AB192961_17317 Gluconobacter frateurii ORF1, sldS, sldL, sldC...    37   0.41    
gb:AB100375_12850 Pseudomonas putida genes for probable acyl-CoA...    37   0.41    
gb:BX572097_798245 Prochlorococcus marinus MIT9313 complete geno...    37   0.54    
pir|AB2003|AB2003 dehydrogenase chain [imported] - Nostoc sp. (s...    37   0.54    Nostoc sp. PCC 7120
pir|S72824|S72824 cholesterol oxidase (EC 1.1.3.6) choD - Mycoba...    37   0.54    Mycobacterium leprae
pir|E86957|E86957 probable cholesterol oxidase [imported] - Myco...    37   0.54    Mycobacterium leprae
sp|Q8ZGW0|BETA_YERPE|BETA_YERPE Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    37   0.54    Yersinia pestis
gb:AY442225_617696 Streptomyces diastaticus polyketide rim gene ...    36   0.70    
gb:AF430844_510073 Burkholderia cepacia glucose dehydrogenase (g...    36   0.70    
gb:AE016781_331379 Pseudomonas putida KT2440 section 8 of 21 of ...    36   0.70    
gb:SME591793_187313 Sinorhizobium meliloti 1021 complete chromos...    36   0.70    
gb:CP000010_866801 Burkholderia mallei ATCC 23344 chromosome 1, ...    36   0.92    
gb:BX572598_801299 Rhodopseudomonas palustris CGA009 complete ge...    36   0.92    
gb:BX571965_789826 Burkholderia pseudomallei strain K96243, chro...    36   0.92    
gb:SNA278573_187721 Streptomyces natalensis pimaricin biosynthet...    36   0.92    
sp|P79076|PROD_CORVE|PROD_CORVE Pyranose oxidase precursor (EC 1.1.3.10) (P...    36   0.92    Trametes versicolor
gb:AF286473_2061554 Mus musculus retinitis pigmentosa GTPase reg...    35   1.2     
gb:AF257654_1781359 Humicola insolens cellobiose dehydrogenase m...    35   1.2     
gb:AF012277_1761187 Penicillium amagasakiense glucose oxidase (G...    35   1.2     
gb:AB039821_6351 Gluconobacter oxydans slds, sldl, sldc genes fo...    35   1.2     
pir|F83181|F83181 probable GMC-type oxidoreductase PA3710 [impor...    35   1.2     Pseudomonas aeruginosa
sp|Q92452|GOX_TALFL|GOX_TALFL Glucose oxidase precursor (EC 1.1.3.4) (Gluc...    35   1.2     Talaromyces flavus
sp|P81156|GOX_PENAG|GOX_PENAG Glucose oxidase (EC 1.1.3.4) (Glucose oxyhyd...    35   1.2     Penicillium amagasakiense
gb:AJ583233_1811339 Penicillium variabile gox gene for glucose o...    35   1.6     
gb:AY522922_1611390 Phanerochaete chrysosporium pyranose 2-oxida...    35   1.6     
gb:AY370876_1603038 Peniophora gigantea pyranose oxidase (poxB) ...    35   1.6     
gb:BX950851_840488 Erwinia carotovora subsp. atroseptica SCRI104...    35   1.6     
gb:BA000030_703954 Streptomyces avermitilis MA-4680 genomic DNA,...    35   1.6     
gb:BA000012_668326 Mesorhizobium loti MAFF303099 DNA, complete g...    35   1.6     
gb:AE014292_310507 Brucella suis 1330 chromosome II, complete se...    35   1.6     
gb:CR378681_98769 Photobacterium profundum SS9 chromosome 2; seg...    35   1.6     
sp|P59097|PROD_TRAHI|PROD_TRAHI Pyranose oxidase precursor (EC 1.1.3.10) (P...    35   1.6     Trametes hirsuta
sp|Q9WWW2|ALKJ_PSEPU|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] (EC 1.1.99...    35   1.6     Pseudomonas putida
gb:AL646074_548273 Ralstonia solanacearum GMI1000 chromosome, co...    35   2.1     
gb:REQ242746_162879 Rhodococcus equi corU1, choE, corD1 and corD...    35   2.1     
pir|E87366|E87366 oxidoreductase, GMC family CC0945 [imported] -...    35   2.1     Caulobacter vibrioides
sp|Q985M5|BETA_RHILO|BETA_RHILO Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    35   2.1     Mesorhizobium loti
sp|Q9L4K0|BETA_HALEL|BETA_HALEL Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    35   2.1     Halomonas elongata
gb:AP003875_1834663 Oryza sativa (japonica cultivar-group) genom...    34   2.7     
gb:PCCELLDEH_1699184 P.chrysosporium mRNA for cellobiose dehydro...    34   2.7     
gb:AY187232_1588142 Athelia rolfsii cellobiose dehydrogenase (CD...    34   2.7     
gb:BA000012_671308 Mesorhizobium loti MAFF303099 DNA, complete g...    34   2.7     
gb:CP000031_85021 Silicibacter pomeroyi DSS-3, complete genome.        34   2.7     
pir|S60676|S60676 cellobiose oxidase (EC 1.1.3.25) precursor - b...    34   2.7     Phanerochaete chrysosporium
pir|E83133|E83133 probable dehydrogenase PA4100 [imported] - Pse...    34   2.7     Pseudomonas aeruginosa
sp|Q01738|CDH_PHACH|CDH_PHACH Cellobiose dehydrogenase precursor (EC 1.1.9...    34   2.7     Phanerochaete chrysosporium
sp|Q9HTJ2|BETA_PSEAE|BETA_PSEAE Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    34   2.7     Pseudomonas aeruginosa
gb:BX572601_802232 Rhodopseudomonas palustris CGA009 complete ge...    34   3.5     
gb:BX248334_757369 Mycobacterium bovis subsp. bovis AF2122/97 co...    34   3.5     
gb:AE016785_332555 Pseudomonas putida KT2440 section 12 of 21 of...    34   3.5     
gb:AE000516_20006 Mycobacterium tuberculosis CDC1551, complete g...    34   3.5     
pir|B70699|B70699 hypothetical protein Rv0012 - Mycobacterium tu...    34   3.5     Mycobacterium tuberculosis
pir|E95358|E95358 probable L-sorbose dehydrogenase, FAD-dependen...    34   3.5     Sinorhizobium meliloti
pir|C75453|C75453 GMC oxidoreductase - Deinococcus radiodurans (...    34   3.5     Deinococcus radiodurans
pir|AB3552|AB3552 alcohol dehydrogenase (acceptor) (EC 1.1.99.-)...    34   3.5     Brucella melitensis
sp|P22637|CHOD_BREST|CHOD_BREST Cholesterol oxidase precursor (EC 1.1.3.6) ...    34   3.5     Brevibacterium sterolicum
gb:AY037858_2290947 Cercopithicine herpesvirus 15 strain LCL8664...    33   4.6     
gb:AY863215_1631069 Trametes pubescens pyranose oxidase (p2o) mR...    33   4.6     
gb:AF385629_1419334 Canis familiaris retinitis pigmentosa GTPase...    33   4.6     
gb:AY061199_1293002 Drosophila melanogaster LD15527 full length ...    33   4.6     
gb:AE014297_1141162 Drosophila melanogaster chromosome 3R, compl...    33   4.6     
gb:BA000012_671557 Mesorhizobium loti MAFF303099 DNA, complete g...    33   4.6     
gb:AB197054_17790 Mesorhizobium loti pno gene for pyridoxine 4-o...    33   4.6     
gb:AF025811_1234148 Drosophila subobscura glucose dehydrogenase ...    33   6.0     
gb:CR543861_102995 Acinetobacter sp. ADP1 complete genome.             33   6.0     
gb:CP000032_88263 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    33   6.0     
gb:AB049341_7335 Microbacterium luteolum gene for pyridoxine 4-o...    33   6.0     
pir|JC7855|JC7855 pyridoxine 4-oxidase (EC 1.1.3.12) - Microbact...    33   6.0     Microbacterium luteolum
pir|E86275|E86275 hypothetical protein F7A19.27 - Arabidopsis th...    33   6.0     Arabidopsis thaliana [mouse-ear cress]
sp|Q8PPG8|BETA_XANAC|BETA_XANAC Choline dehydrogenase (EC 1.1.99.1) (CHD) (...    33   6.0     Xanthomonas citri
sp|Q00593|ALKJ_PSEOL|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] (EC 1.1.99...    33   6.0     Pseudomonas oleovorans
gb:AY219924_1939526 Homo sapiens repetin (RPTN) gene, complete cds.    33   7.8     
gb:AK096436_1914601 Homo sapiens cDNA FLJ39117 fis, clone NTONG2...    33   7.8     
gb:AP003579_1831234 Oryza sativa (japonica cultivar-group) genom...    33   7.8     
gb:AF074951_1766140 Thielavia heterothallica cellobiose dehydrog...    33   7.8     
gb:AY316747_608955 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...    33   7.8     
gb:AY195887_596321 Mycoplasma agalactiae strain variant 627#3 Ma...    33   7.8     
gb:AF248865_492590 Mycoplasma agalactiae conserved hypothetical ...    33   7.8     
gb:AF112467_479969 Mycoplasma agalactiae variable surface lipopr...    33   7.8     
gb:AE014291_309446 Brucella suis 1330 chromosome I, complete seq...    33   7.8     
pir|AH3255|AH3255 l-sorbose dehydrogenase [FAD] (EC 1.1.99.-) [i...    33   7.8     Brucella melitensis


>pir|T05821|T05821 hypothetical protein T5K18.160 - Arabidopsis
            thaliana>gb:ATCHRIV50_1545778 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 50.>gb:ATT5K18_1556186
            Arabidopsis thaliana DNA chromosome 4, BAC clone T5K18
            (ESSA project).
          Length = 678

 Score =  259 bits (661), Expect = 5e-68
 Identities = 129/217 (59%), Positives = 164/217 (75%), Gaps = 1/217 (0%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGA-VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH 607
            YEG IM+AMS+VV+    + YG  VIQTPALHPG+FS ++PW S ++FK RM +++RTAH
Sbjct: 459  YEGGIMTAMSSVVIEETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTAH 518

Query: 606  IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL 427
            IFAL RDKG+G   S T + Y+L+  DEE+L+ GLE++L+ILAAAGAEEIG +H  G +L
Sbjct: 519  IFALLRDKGTGTIDSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHSEGRSL 578

Query: 426  KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEG 247
             V+ AS  E ERFV+EESS+ L+       SAHQMGSCRMG+ P+ S V P GETWEVE 
Sbjct: 579  NVRTASSLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVER 638

Query: 246  LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
            LFV D SV PTALGVNPMVT+ S++YCI  +V++ LK
Sbjct: 639  LFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK 675



>gb:AE016959_1023069 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078948_1541641 Oryza sativa
            chromosome 10 BAC OSJNBa0001K12 genomic sequence,
            complete sequence.>gb:AE017104_1752888 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 58 of 77
            of the complete sequence.
          Length = 637

 Score =  196 bits (498), Expect = 4e-49
 Identities = 101/220 (45%), Positives = 137/220 (62%), Gaps = 5/220 (2%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I+++M  V           +I+TPAL PG FSA++PW SG++ K RM RYARTAH 
Sbjct: 423  YEGGIITSMHRVTDRT-------IIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHA 475

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD+G+G       V +   + D E L+ GL + LRIL AAGA E+G +   GL L+
Sbjct: 476  FALVRDRGAGAVDGEGRVRFSPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRLR 535

Query: 423  VKDASREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETW 259
             K     + E F+ E + +    +P      +  SAHQMGSCRMG  P+   V+  GE+W
Sbjct: 536  CKGVRDADVEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESW 595

Query: 258  EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL 139
            E EGL+V DGS+LPTA+GVNPM+TI S++YC+S  + + L
Sbjct: 596  EAEGLYVCDGSLLPTAVGVNPMITIQSIAYCLSNGIADTL 635



>gb:AC078948_1541639 Oryza sativa chromosome 10 BAC OSJNBa0001K12
            genomic sequence, complete sequence.
          Length = 590

 Score =  196 bits (497), Expect = 5e-49
 Identities = 100/218 (45%), Positives = 137/218 (62%), Gaps = 5/218 (2%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I+++M  V           +I+TPAL PG F+AL+PW SG++ K RM RYARTAH 
Sbjct: 371  YEGGIITSMHRVTERT-------IIETPALGPGAFAALVPWESGRDMKERMRRYARTAHA 423

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD+G+G       V Y   + D E L+ GL + LRIL AAGA E+G +   G  L+
Sbjct: 424  FALVRDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLR 483

Query: 423  VKDASREEFERFVKEESSQSLRKHP-----NLKASAHQMGSCRMGVDPKASVVNPKGETW 259
             K A   + E F+ E + +    H      ++  SAHQMGSCRMG  P+   V+  GE+W
Sbjct: 484  CKGARDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESW 543

Query: 258  EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE 145
            E EGL+V DGS+LPTA+GVNPM+TI S++YC+++ + +
Sbjct: 544  EAEGLYVCDGSLLPTAVGVNPMITIQSIAYCVAKGIAD 581



>gb:AE016959_1023071 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078893_1541565 Oryza sativa
            chromosome 10 BAC OSJNBb0044B19 genomic sequence,
            complete sequence.>gb:AE017104_1752890 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 58 of 77
            of the complete sequence.
          Length = 595

 Score =  196 bits (497), Expect = 5e-49
 Identities = 100/218 (45%), Positives = 137/218 (62%), Gaps = 5/218 (2%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I+++M  V           +I+TPAL PG F+AL+PW SG++ K RM RYARTAH 
Sbjct: 376  YEGGIITSMHRVTERT-------IIETPALGPGAFAALVPWESGRDMKERMRRYARTAHA 428

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD+G+G       V Y   + D E L+ GL + LRIL AAGA E+G +   G  L+
Sbjct: 429  FALVRDRGAGSVDGEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGARLR 488

Query: 423  VKDASREEFERFVKEESSQSLRKHP-----NLKASAHQMGSCRMGVDPKASVVNPKGETW 259
             K A   + E F+ E + +    H      ++  SAHQMGSCRMG  P+   V+  GE+W
Sbjct: 489  CKGARDADVEAFLDEVTVEKGPMHSTTDKWSVLCSAHQMGSCRMGASPRDGAVDVAGESW 548

Query: 258  EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE 145
            E EGL+V DGS+LPTA+GVNPM+TI S++YC+++ + +
Sbjct: 549  EAEGLYVCDGSLLPTAVGVNPMITIQSIAYCVAKGIAD 586



>gb:ATH316230_1552490 Arabidopsis thaliana mRNA for alcohol oxidase
            (fao3 gene).
          Length = 678

 Score =  194 bits (493), Expect = 2e-48
 Identities = 98/221 (44%), Positives = 142/221 (64%), Gaps = 4/221 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I++++S V+     +   A+I+TP L PG FS L PW SG + K RM+RY+RTA +
Sbjct: 456  YEGGIITSVSKVLSE--DSEVRAIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASL 513

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
              + RD+GSGE  +   + Y +DKTD +NL+ GL + LRIL AAGAEE+G +   G  L 
Sbjct: 514  ITIVRDRGSGEVKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLI 573

Query: 423  VKDASREEFERFV----KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             K  +    + F+     EE ++ + +  N+ +SAHQMGSCR+G + K   ++  GE+WE
Sbjct: 574  CKGVNENSIQEFLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWE 633

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
             E LFV D S LP+A+GVNPM+T+MS +YCIS  + + + T
Sbjct: 634  AEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT 674



>gb:AB015474_1512563 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MLM24.>gb:BT002713_1636316 Arabidopsis thaliana
            At3g23410/MLM24_23 gene, complete
            cds.>gb:AF361827_1791418 Arabidopsis thaliana
            AT3g23410/MLM24_23 mRNA, complete cds.
          Length = 746

 Score =  194 bits (493), Expect = 2e-48
 Identities = 98/221 (44%), Positives = 142/221 (64%), Gaps = 4/221 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I++++S V+     +   A+I+TP L PG FS L PW SG + K RM+RY+RTA +
Sbjct: 524  YEGGIITSVSKVLSE--DSEVRAIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASL 581

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
              + RD+GSGE  +   + Y +DKTD +NL+ GL + LRIL AAGAEE+G +   G  L 
Sbjct: 582  ITIVRDRGSGEVKTEGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLI 641

Query: 423  VKDASREEFERFV----KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             K  +    + F+     EE ++ + +  N+ +SAHQMGSCR+G + K   ++  GE+WE
Sbjct: 642  CKGVNENSIQEFLDSVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWE 701

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
             E LFV D S LP+A+GVNPM+T+MS +YCIS  + + + T
Sbjct: 702  AEKLFVCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT 742



>gb:AE016959_1023063 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC078948_1541647 Oryza sativa
            chromosome 10 BAC OSJNBa0001K12 genomic sequence,
            complete sequence.>gb:AE017104_1752882 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 58 of 77
            of the complete sequence.
          Length = 756

 Score =  192 bits (489), Expect = 5e-48
 Identities = 104/220 (47%), Positives = 136/220 (61%), Gaps = 5/220 (2%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I+++M  V           +I+TPAL PG F+A++PW SG++ K RM RYARTAH 
Sbjct: 521  YEGGIITSMHRVTDRT-------IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHA 573

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
              L RD+ +G       V +   + D   L+ GL + LRIL AAGA E+G N   GL L+
Sbjct: 574  VVLVRDRAAGTVGGEGRVRFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLR 633

Query: 423  VKDASREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETW 259
             K A  E+ E F+ E S +    HP      L ASAHQMGSCRMG   K   V+  GE+W
Sbjct: 634  CKGARDEDVEAFLDEVSVEKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESW 693

Query: 258  EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL 139
            E EGL+V DGS+LPTA+GVNPM+TI SV+YC+++ + E L
Sbjct: 694  EAEGLYVCDGSLLPTAVGVNPMITIESVAYCVAKGIAESL 733



>pir|A86171|A86171 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_889419 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC003027_1530939 Arabidopsis thaliana
            chromosome I BAC F21M11 genomic sequence, complete
            sequence.
          Length = 736

 Score =  188 bits (478), Expect = 8e-47
 Identities = 100/220 (45%), Positives = 138/220 (62%), Gaps = 4/220 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +EG I++++   V  ++ T     ++TPA+ PG F+AL PW SG + K RM++YARTAHI
Sbjct: 514  HEGEIVTSLH-YVHPMDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHI 572

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FA+ RD+G GE      V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K
Sbjct: 573  FAMVRDEGVGEVKGDI-VKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMK 631

Query: 423  VKDASREEFERFVKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
                 +++ E F+   ++     S+ KH     +AHQ+G CRMG   K   ++ KGE+WE
Sbjct: 632  CDGIKQKDLEAFLDTVNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWE 691

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
             E L+V D SVLPTALGVNPM+T+ S +YCIS  + E +K
Sbjct: 692  AEDLYVCDASVLPTALGVNPMITVQSTAYCISNRIAELMK 731



>gb:AY085885_1570948 Arabidopsis thaliana clone 19314 mRNA, complete
            sequence.
          Length = 748

 Score =  186 bits (471), Expect = 6e-46
 Identities = 95/220 (43%), Positives = 136/220 (61%), Gaps = 4/220 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I++++    +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+
Sbjct: 526  YEGGIITSVHH--MNDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHL 583

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD GSGE      VTY   K D ENL+ GL + LR+  AAGA E+G     G  +K
Sbjct: 584  FALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMK 643

Query: 423  VKDASREEFERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             +  ++E  E F+ E  +     +  ++     SAHQMGSCRMGV  +   ++  GE+WE
Sbjct: 644  CEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWE 703

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
             EGLFV DGS+LP+A+GVNPM+TI S +YCIS  +++ L+
Sbjct: 704  AEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ 743



>gb:AY039977_1560481 Arabidopsis thaliana unknown protein (At4g28570)
            mRNA, complete cds.
          Length = 748

 Score =  186 bits (471), Expect = 6e-46
 Identities = 95/220 (43%), Positives = 136/220 (61%), Gaps = 4/220 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I++++    +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+
Sbjct: 526  YEGGIITSVHH--MNDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHL 583

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD GSGE      VTY   K D ENL+ GL + LR+  AAGA E+G     G  +K
Sbjct: 584  FALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMK 643

Query: 423  VKDASREEFERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             +  ++E  E F+ E  +     +  ++     SAHQMGSCRMGV  +   ++  GE+WE
Sbjct: 644  CEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWE 703

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
             EGLFV DGS+LP+A+GVNPM+TI S +YCIS  +++ L+
Sbjct: 704  AEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ 743



>pir|T10651|T10651 hypothetical protein T5F17.20 - Arabidopsis
            thaliana>gb:ATCHRIV69_1546737 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No.
            69.>gb:ATH316231_1552491 Arabidopsis thaliana mRNA for
            alcohol oxidase (fao4b gene).>gb:BT001942_1635545
            Arabidopsis thaliana clone C104731 unknown protein
            (At4g28570) mRNA, complete cds.
          Length = 748

 Score =  186 bits (471), Expect = 6e-46
 Identities = 95/220 (43%), Positives = 136/220 (61%), Gaps = 4/220 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I++++    +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+
Sbjct: 526  YEGGIITSVHH--MNDTESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHL 583

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            FAL RD GSGE      VTY   K D ENL+ GL + LR+  AAGA E+G     G  +K
Sbjct: 584  FALVRDLGSGEVMMENEVTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMK 643

Query: 423  VKDASREEFERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             +  ++E  E F+ E  +     +  ++     SAHQMGSCRMGV  +   ++  GE+WE
Sbjct: 644  CEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWE 703

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
             EGLFV DGS+LP+A+GVNPM+TI S +YCIS  +++ L+
Sbjct: 704  AEGLFVCDGSILPSAVGVNPMITIQSTAYCISSKIVDSLQ 743



>gb:AP004053_1836984 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1234_B11.
          Length = 770

 Score =  181 bits (460), Expect = 1e-44
 Identities = 94/219 (42%), Positives = 131/219 (59%), Gaps = 4/219 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            YEG I+++M  V  +  G  + A+++TP +        MPW SG++ K RM R+ART HI
Sbjct: 547  YEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMPWLSGRDSKERMLRFARTVHI 606

Query: 603  FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK 424
            F+L RD+GSG       V Y LD  D E+++ GL + LR+L AAGA E+G +   G  L+
Sbjct: 607  FSLVRDRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRSDGQRLR 666

Query: 423  VKDASREEFERFVK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
             +  + E  E F+         QS  +   L  SAH MGSCRMG       V+ +GE+WE
Sbjct: 667  CEGLTEEALEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDARGESWE 726

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL 139
             E L+V DGSVLPTA+GVNPM+TI SV+YC++  + + L
Sbjct: 727  AERLYVCDGSVLPTAVGVNPMITIQSVAYCLANGIADSL 765



>gb:AP006618_557372 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 664

 Score =  112 bits (281), Expect = 6e-24
 Identities = 68/209 (32%), Positives = 100/209 (47%), Gaps = 4/209 (1%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +EG + + +S    +++G GYG + +T  +HPG+    M W  G E +  M   A TA I
Sbjct: 447  WEGGLQTRISRKHADLDGAGYGVIYETGPMHPGMLVGFMNWRGGAEHRRAMLDLAHTAAI 506

Query: 603  FALARDKGSGEAFSPTS----VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG 436
              + RD+ SG      +    V Y +   D ++L  G+     IL AAGA++I   H  G
Sbjct: 507  GVITRDRDSGRVEVDKAGHPIVHYTISDRDRDHLHTGILGAASILEAAGAKKIFSGHQAG 566

Query: 435  LTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE 256
               +     R     F     +   R      A+ H MGS RMG       ++P G TWE
Sbjct: 567  PVYQ--PGVRGSHAEFAAACQAAGYRPGRCGMAALHIMGSARMGGSRDTCALDPDGATWE 624

Query: 255  VEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
            V  + V D S  PT+ GVNPMV+I +++Y
Sbjct: 625  VPNVVVADASCFPTSSGVNPMVSIEAIAY 653



>pir|B75608|B75608 GMC oxidoreductase - Deinococcus radiodurans
            (strain R1)>gb:AE001862_40060 Deinococcus radiodurans R1
            section 1 of 2 of the complete chromosome
            2.>gb:AE001825_885382 Deinococcus radiodurans R1 complete
            chromosome 2.
          Length = 722

 Score =  110 bits (275), Expect = 3e-23
 Identities = 69/206 (33%), Positives = 110/206 (53%), Gaps = 6/206 (2%)
 Frame = -2

Query: 726  GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV- 550
            G+G +I+     P L ++ +PW  G+  +  MS++ R A   ++ +D+G G+        
Sbjct: 499  GHGFIIEGVQYGPALMASGLPWTGGEAHRDLMSKFHRMATFVSIVQDRGHGQVTVDDEGN 558

Query: 549  ---TYDL-DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-EEFERFV 385
               TY L D  D  N +RG+ + +R+  AAGAEEI       L   V    R ++ E F+
Sbjct: 559  AVHTYALTDDLDARNFRRGVTESIRLHEAAGAEEI-----VALAPGVAPWRRGDDLEAFI 613

Query: 384  KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
             + +   L        SAHQMGS RMG DP+ SV +P G+  +V G+++GD S  PT  G
Sbjct: 614  GQVAQVPLGAGGQTVFSAHQMGSARMGSDPQTSVADPDGQLHDVPGVWIGDTSAFPTCSG 673

Query: 204  VNPMVTIMSVSYCISQSVLEFLKTHD 127
            VNPMV+ M+++   ++ +L  ++  D
Sbjct: 674  VNPMVSCMALASRTAEKLLAAMEGAD 699



>gb:AY538780_1612481 Candida tropicalis fatty alcohol oxidase (FAO1)
            gene, complete cds.
          Length = 704

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 68/233 (29%), Positives = 116/233 (49%), Gaps = 16/233 (6%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +  +IM+A+ +   +++G G+G  I+T    P + ++ +PW    E +  + RY     +
Sbjct: 471  FHNSIMTALCSEAADLDGKGHGCRIETILNAPFIQASFLPWRGSNEARRDLLRYNNMVAM 530

Query: 603  FALARDKGSGEAFS-PTS-----VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG 442
              L+RD  SG   S PT      V YD++K D  ++ + L     +L   GA+ I     
Sbjct: 531  LLLSRDTTSGSVSSHPTKPEALVVEYDVNKFDRNSILQALLVTADLLYIQGAKRILSPQP 590

Query: 441  TGLTLKVKDASREEFERFVKEESSQSLRK---------HPNLKASAHQMGSCRM-GVDPK 292
                + + ++ + + +R +K+E     R          + +   SAHQM SCRM G  PK
Sbjct: 591  W---VPIFESDKPKDKRSIKDEDYVEWRAKVAKIPFDTYGSPYGSAHQMSSCRMSGKGPK 647

Query: 291  ASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
               V+  G  +E   ++V D S+LPTA G NPMVT M+++  ++  + + LKT
Sbjct: 648  YGAVDTDGRLFECSNVYVADASLLPTASGANPMVTTMTLARHVALGLADSLKT 700



>gb:CR382137_1669722 Debaryomyces hansenii chromosome E of strain
            CBS767 of Debaryomyces hansenii.
          Length = 699

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 66/229 (28%), Positives = 112/229 (48%), Gaps = 13/229 (5%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +  +I++ + T V +++G  +GA I+T    P L S  MPW S  + +  + RY   A +
Sbjct: 466  FNESILTTVCTEVDDLDGKAHGAKIETVLHTPLLESVFMPWQSSDKARQDLLRYNHLAAM 525

Query: 603  FALARDKGSG----EAFSPTS--VTYDLDKTDEENLQRGLEKLLRILAAAGAEEI----- 457
              + RDK SG    +A  P S  + Y ++K D   L + +     +L   GA+EI     
Sbjct: 526  LIITRDKSSGTIRADATKPDSLIIDYSINKYDRNALLQAILVSADMLYVEGAKEIIHPQR 585

Query: 456  -GCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRM-GVDPKASV 283
               N  +    + +     ++ ++ +  S   L        SAHQM SCR+ G  PK   
Sbjct: 586  WVPNFQSNKPKEERSVKDRDYVQWRESVSKTKLDTFGCPYGSAHQMSSCRISGKGPKYGA 645

Query: 282  VNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
             + KG  +E + ++V D S +PTA G NPM++ MS++  I+  + + L+
Sbjct: 646  CDNKGRLYECKNVYVADASAMPTASGANPMISTMSIARLIALGISKDLQ 694



>gb:CCL242497_1645827 Candida cloacae mRNA for long chain fatty
            alcohol oxidase 1 (fao1 gene).
          Length = 698

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 66/231 (28%), Positives = 111/231 (48%), Gaps = 20/231 (8%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            Y+  +M+A+   V +++G  +G  I+     P + +   PW SG + +  + +Y +T  +
Sbjct: 465  YKRPLMTAVCNAVDDLDGKAHGTRIEAILHAPYVTAPFYPWQSGAQARKNLLKYKQTVPL 524

Query: 603  FALARDKGSGEAFSPTS------VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG 442
              L+RD  SG             V Y ++K D  ++ +G      IL   GA+EI     
Sbjct: 525  LLLSRDTSSGTVTYDKQKPDVLVVDYTVNKFDRNSILQGFLVASDILYIEGAKEILSPQA 584

Query: 441  TGLTLKVKDASREEFERFVKEESSQSLRK---------HPNLKASAHQMGSCRM-GVDPK 292
               T K   +++ +  R +K+E     R+         + +   SAHQM SCRM G  P 
Sbjct: 585  WVPTFK---SNKPKHARSIKDEDYVKWRETVAKIPFDSYGSPYGSAHQMSSCRMSGKGPG 641

Query: 291  ASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS----VSYCISQSV 151
                + KG  +E   ++V D SV+PTA GVNPM+T M+    V+ C+++ +
Sbjct: 642  YGACDTKGRLFECNNVYVADASVMPTASGVNPMITTMAFARHVALCLAKDL 692



>gb:AY538782_1612483 Candida tropicalis fatty alcohol oxidase (FAO2b)
            gene, complete cds.
          Length = 704

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 62/233 (26%), Positives = 113/233 (48%), Gaps = 16/233 (6%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +  +IM+++   V +++G G+G  I+T    P + ++L+PW    E +  + RY     +
Sbjct: 471  FHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRRDLLRYNNMVAM 530

Query: 603  FALARDKGSGEAFSPTS------VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG 442
              + RD  SG   +         V YD++K D+  + +       +L   GA+ I     
Sbjct: 531  LLITRDTTSGSVSADPKKPDALIVDYDINKFDKNAILQAFLITSDMLYIEGAKRILSPQA 590

Query: 441  TGLTLKVKDASREEFERFVKEESSQSLRK---------HPNLKASAHQMGSCRM-GVDPK 292
                + + ++++ + +R +K++     R          + +   SAHQM +CRM G  PK
Sbjct: 591  W---VPIFESNKPKEQRTIKDKDYVEWRAKAAKIPFDTYGSAYGSAHQMSTCRMSGKGPK 647

Query: 291  ASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
               V+  G  +E   ++V D SVLPTA G NPM++ M+ +  I+  + + LKT
Sbjct: 648  YGAVDTDGRLFECSNVYVADASVLPTASGANPMISTMTFARQIALGLADSLKT 700



>gb:CTR242496_1674233 Candida tropicalis mRNA for long chain fatty
            alcohol oxidase (faot gene).
          Length = 704

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 64/233 (27%), Positives = 109/233 (46%), Gaps = 16/233 (6%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +  +IM+++   V +++G G+G  I+T    P + ++L+PW    E +  + RY     +
Sbjct: 471  FHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRRDLLRYNNMVAM 530

Query: 603  FALARDKGSGEAFSPTS------VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG 442
                RD  SG   +         V YD+ K D+  + +       +L   GA+ I     
Sbjct: 531  LLTTRDTTSGSVSADPKKPEALIVDYDVSKFDKNAILQAFLITSDMLHIEGAKRILSPQA 590

Query: 441  TGLTLKVKDASREEFERFVKEESSQSLR---------KHPNLKASAHQMGSCRM-GVDPK 292
                + + ++S+   ER + ++     R          + +   SAHQM +CRM G  PK
Sbjct: 591  W---VPIFESSKPRDERSIDDKDYVEWRAKAAKIPFDSYGSAYGSAHQMSTCRMSGKGPK 647

Query: 291  ASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
               V+  G  +E   ++V D SVLPTA G NPM+T M+ +  I+  + E LK+
Sbjct: 648  YGAVDTDGRLFECSNVYVADASVLPTASGANPMITTMTFARNIALGLAEDLKS 700



>gb:AY538781_1612482 Candida tropicalis fatty alcohol oxidase (FAO2a)
            gene, complete cds.
          Length = 704

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 61/233 (26%), Positives = 113/233 (48%), Gaps = 16/233 (6%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            +  +IM+++   V +++G G+G  I+T    P + ++L+PW    E +  + RY     +
Sbjct: 471  FHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRRDLLRYNNMVAM 530

Query: 603  FALARDKGSGEAFSPTS------VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG 442
              + RD  SG   +         V Y+++K D+  + +       +L   GA+ I     
Sbjct: 531  LLITRDTTSGSVSADPKKPDALIVDYEINKFDKNAILQAFLITSDMLYIEGAKRILSPQP 590

Query: 441  TGLTLKVKDASREEFERFVKEESSQSLRK---------HPNLKASAHQMGSCRM-GVDPK 292
                + + ++++ + +R +K++     R          + +   SAHQM +CRM G  PK
Sbjct: 591  W---VPIFESNKPKEQRTIKDKDYVEWRAKAAKIPFDTYGSAYGSAHQMSTCRMSGKGPK 647

Query: 291  ASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT 133
               V+  G  +E   ++V D SVLPTA G NPM++ M+ +  I+  + + LKT
Sbjct: 648  YGAVDTDGRLFECSNVYVADASVLPTASGANPMISTMTFARQIALGLADSLKT 700



>gb:CCL242498_1645828 Candida cloacae mRNA for long chain fatty
            alcohol oxidase 2 (fao2 gene).
          Length = 698

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 70/236 (29%), Positives = 108/236 (45%), Gaps = 20/236 (8%)
 Frame = -2

Query: 783  YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
            Y   IM+++   V +++G  +G  I+     P   +   PW SG E +  + RY +T  I
Sbjct: 465  YRKPIMTSICNKVEDLDGKAHGTRIEAMLNAPYGVAPFFPWKSGAESRKDLLRYKQTVPI 524

Query: 603  FALARDKGSGEAFSPTSVTYD------------LDKTDEENLQRGLEKLLRILAAAGAEE 460
              L+RD  SG      SVTYD            L+K D  ++ +G      +L   GA  
Sbjct: 525  LLLSRDTTSG------SVTYDKQKPDALVIDYLLNKFDRNSILQGFLIASDLLYIEGASR 578

Query: 459  IGCNHGTGL----TLKVKDASREEFERFVKEESSQS---LRKHPNLKASAHQMGSCRM-G 304
                +  G     + K K A   E E +V   +  +      + +   SAHQM +CRM G
Sbjct: 579  DHVTYKLGYQWFKSSKPKHARSIEDEDYVNWRAKVAKIPFDSYGSPYGSAHQMSTCRMSG 638

Query: 303  VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
              P     + KG+ +E   ++V D S LPTA G NPMV+ MS +  +S  +++ L+
Sbjct: 639  KGPGYGACDTKGKLFECSNVYVADASTLPTASGANPMVSTMSFARHVSLGIVKELQ 694



>gb:AP004396_1841143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0404D10.
          Length = 167

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 36/81 (44%), Positives = 53/81 (65%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           + S QSL++   L  S H MG CRMG       ++  GE+WE E L+V + SVLPTA+G+
Sbjct: 82  KNSHQSLKETWGLFCSMHHMGCCRMGTTVGNGTIDAHGESWEAEQLYVCNDSVLPTAVGI 141

Query: 201 NPMVTIMSVSYCISQSVLEFL 139
           NPM+T+ SV+YC++  + + L
Sbjct: 142 NPMITVQSVAYCVANGIADSL 162



>gb:AE011196_270280 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 5 of 397 of the complete
           sequence.>gb:AE017287_432283 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 1 of 14 of the complete
           sequence.>gb:AE010300_1003679 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1065294 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 537

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 62/218 (28%), Positives = 105/218 (48%), Gaps = 7/218 (3%)
 Frame = -2

Query: 783 YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI 604
           Y G   SA+     N + TGYG  ++     P L ++L+P+   ++F+ ++ +Y+  +  
Sbjct: 315 YSGPPQSAVIKDGHNQDNTGYGFWLEVAPFRPTLVASLIPFYGSKQFE-QIEKYSNMSAG 373

Query: 603 FALARDKGSGEAFSPTS-------VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNH 445
             L RD   GEA +          V ++L   D +N+ RGL+ L  + AAAGA+E+    
Sbjct: 374 IVLVRDGSDGEANASVKWSLGRRKVYFELTSGDGKNMLRGLKMLAEVQAAAGAKELIFPF 433

Query: 444 GTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGE 265
               T  + D + +      K+ +  SL     +  SAH  GS +    P+   ++   E
Sbjct: 434 TDMETPVLVDRNTKFDWVLEKKFNPGSL-----VVGSAHPHGSIQAANSPEKGAIDLNME 488

Query: 264 TWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
            +  + ++V D SV PT L VNP +T MS+    SQ++
Sbjct: 489 LYGHKNIYVMDASVYPTGLSVNPQITTMSLVLRASQTL 526



>gb:AE016793_334501 Pseudomonas putida KT2440 section 20 of 21 of
           the complete genome.>gb:AE015451_949578 Pseudomonas
           putida KT2440 complete genome.
          Length = 532

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 57/203 (28%), Positives = 91/203 (44%), Gaps = 9/203 (4%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK-------GSGEAFS 562
           G  ++ P LHP L S L+    G E   RM+    T  + AL RD        GS E   
Sbjct: 334 GYKLEVPPLHPALASTLLG-GQGHENAQRMAELPHTHVMLALLRDGFHPESQGGSVELRG 392

Query: 561 PTSVTYDLDKTD--EENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF 388
             S   D   TD   + L+R    +  +  AAGA  +   H          ++    E+ 
Sbjct: 393 DGSPVLDYPVTDYLRDGLRRAYRSMAHVQFAAGATHVTPVHSDA-------SAASSLEQA 445

Query: 387 VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL 208
           +       L        SAH MG C +G DP+ +V +  G   ++E L + DGS+ PT++
Sbjct: 446 LTMIDKLRLEPFRTRLGSAHVMGGCALGEDPRHAVCDSLGRHHQLENLSIHDGSLFPTSI 505

Query: 207 GVNPMVTIMSVSYCISQSVLEFL 139
           G NP +++ ++S  +S++++  L
Sbjct: 506 GANPQLSVYAISARLSEALVSRL 528



>gb:AY196214_596382 Streptomyces griseochromogenes blasticidin
           biosynthetic cluster, partial sequence.
          Length = 610

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 2/190 (1%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP--TSVT 547
           G +I+  A  PG+ S ++P   G E +  +    R A + A+  D+ SG       T V 
Sbjct: 426 GILIEATATPPGMGSFILP-GLGGELRRELESADRLATLGAMIADRPSGSVLGRDRTLVR 484

Query: 546 YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ 367
           YD+D+ D + L R +  +  +L AAGAEE+     TG+    +  S  E +  +   S +
Sbjct: 485 YDVDRRDADRLIRAVRAMGELLFAAGAEEVL----TGIPRTPRVRSLPELDAVLAGTSVR 540

Query: 366 SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT 187
            L       ++ H  G+   G   +   V+P+G    V G+ V D SVLP+   VNP ++
Sbjct: 541 QLHL-----SAYHPTGTVAAGASSQHFPVDPEGRLRGVHGVLVADASVLPSCPQVNPQLS 595

Query: 186 IMSVSYCISQ 157
           IM+ +  I++
Sbjct: 596 IMAAALAIAE 605



>gb:AP005523_1853417 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0488B06.
          Length = 70

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 31/64 (48%), Positives = 46/64 (71%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H MG CRMG       V+  GE+WEVE L+V + SVLPTA+G+NPM+T++S++YC++  +
Sbjct: 2   HHMGCCRMGTAVGNGTVDAHGESWEVEQLYVCNDSVLPTAVGINPMITVLSIAYCVANGI 61

Query: 150 LEFL 139
            + L
Sbjct: 62  ADSL 65



>gb:BA000045_742079 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 535

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 56/170 (32%), Positives = 89/170 (52%)
 Frame = -2

Query: 654 GQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA 475
           G++ +  M  Y  TA I  L      GE   P +  Y L+ +DE + QRGL K  RI  +
Sbjct: 382 GEKLQSHMHGYNHTAGINIL------GECL-PYAHNY-LELSDEPD-QRGLPKP-RIHFS 431

Query: 474 AGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDP 295
            G  E           +++D +     R  +   +Q++      + +AH +G+CRMG DP
Sbjct: 432 NGKNE----------RRLRDHAEALMRRIWEAAGAQAVW---TFERNAHTIGTCRMGADP 478

Query: 294 KASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE 145
           K +VV+P+G  ++V  L++ D SV P+AL VNP +TIM++S   +   +E
Sbjct: 479 KRAVVDPEGRAFDVPNLYIIDNSVFPSALSVNPALTIMALSLRTADRFIE 528



>gb:AP005520_1853357 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0426E02.
          Length = 139

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 31/62 (50%), Positives = 43/62 (69%)
 Frame = -2

Query: 324 MGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE 145
           MG CRMG       V+  GE+WE E L+V + SVLPTA+G+NPM+TI SV+YC++  + +
Sbjct: 1   MGCCRMGTTVGNGTVDAHGESWEAEQLYVCNDSVLPTAVGINPMITIQSVAYCVANGIAD 60

Query: 144 FL 139
            L
Sbjct: 61  SL 62



>gb:AL646081_549274 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 6/11.
          Length = 647

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 45/129 (34%), Positives = 63/129 (48%), Gaps = 4/129 (3%)
 Frame = -2

Query: 552 VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES 373
           V+ D    DE  +         I  AAG + +G N    L    + A +  FE +     
Sbjct: 499 VSLDPTHVDEYGVPVARISRRSISDAAGNKFVGPNEQR-LDAAAQGAMKAVFELYAARRG 557

Query: 372 SQSLRKHPNLKASA----HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
           + +    P     +    HQMG+CRMG DP  SVVN  G   +VE +FV D S +PT LG
Sbjct: 558 ALAAAPKPTQAILSLVGDHQMGTCRMGEDPATSVVNRYGRLHDVENVFVVDSSFMPTGLG 617

Query: 204 VNPMVTIMS 178
           +NPMVT+++
Sbjct: 618 LNPMVTVVA 626



>gb:AE000516_20504 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 480

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 3/194 (1%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS---PTSV 550
           G +I+  +  PG+ S + P   G E    + R  + A   A+  D+G G   S    T V
Sbjct: 290 GVLIEATSTPPGMGSMVFP-GYGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVV 348

Query: 549 TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS 370
            YD+   +   L+  L+ + R+L AAGA E+     TG+       S  E +  ++  + 
Sbjct: 349 RYDIAPGEIAKLRVALQAIGRLLFAAGAVEVL----TGIPGAPPMRSLPELQDVLRRANP 404

Query: 369 QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV 190
           +SL       A+ H  G+   G D +   V+  G    VEG++V D S+LP+   VNP +
Sbjct: 405 RSLHL-----AAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPSCPEVNPQL 459

Query: 189 TIMSVSYCISQSVL 148
           +IM+++  ++   +
Sbjct: 460 SIMAMALAVADQTV 473



>pir|B83600|B83600 probable oxidoreductase PA0364 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004474_54599
           Pseudomonas aeruginosa PAO1, section 35 of 529 of the
           complete genome.>gb:AE004091_968699 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 531

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 54/200 (27%), Positives = 87/200 (43%), Gaps = 9/200 (4%)
 Frame = -2

Query: 711 IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD-------KGSGEAFSPTS 553
           ++ P L P L S L+    G +  +RM +   T  + AL RD       +GS       +
Sbjct: 337 LEVPPLQPSLASVLLG-GFGSDNALRMEQLPHTNMMLALLRDGFHPDSAEGSVGLRGDDT 395

Query: 552 VTYDLDKTDE--ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE 379
              D   TD   + ++R    +  I  AAGA E+   H    + K    +R   +    E
Sbjct: 396 PVLDYRMTDYTWDGIRRAFHTMAEIQFAAGAREVRPVHSDARSAKNLQEARGIIDGLRLE 455

Query: 378 ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
                L        SAH MG C MG DP  +V +  G    +  L + DGS+ PT++G N
Sbjct: 456 IYRTRL-------GSAHVMGGCAMGEDPAVAVADSLGRHHHLRNLSIHDGSLFPTSIGAN 508

Query: 198 PMVTIMSVSYCISQSVLEFL 139
           P +++  ++  ++ ++ E L
Sbjct: 509 PQLSVYGLTAQLASALAERL 528



>pir|G70744|G70744 hypothetical protein Rv0492c - Mycobacterium
            tuberculosis  (strain H37RV)
          Length = 684

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 3/194 (1%)
 Frame = -2

Query: 720  GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS---PTSV 550
            G +I+  +  PG+ S + P   G E    + R  + A   A+  D+G G   S    T V
Sbjct: 494  GVLIEATSTPPGMGSMVFP-GYGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVV 552

Query: 549  TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS 370
             YD+   +   L+  L+ + R+L AAGA E+     TG+       S  E +  ++  + 
Sbjct: 553  RYDIAPGEIAKLRVALQAIGRLLFAAGAVEVL----TGIPGAPPMRSLPELQDVLRRANP 608

Query: 369  QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV 190
            +SL       A+ H  G+   G D +   V+  G    VEG++V D S+LP+   VNP +
Sbjct: 609  RSLHL-----AAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPSCPEVNPQL 663

Query: 189  TIMSVSYCISQSVL 148
            +IM+++  ++   +
Sbjct: 664  SIMAMALAVADQTV 677



>sp|Q11157|Y492_MYCTU Hypothetical GMC-type oxidoreductase
           Rv0492c/MT0511/MT0512.>gb:BX842573_818536 Mycobacterium
           tuberculosis H37Rv complete genome; segment 2/13.
          Length = 629

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 3/194 (1%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS---PTSV 550
           G +I+  +  PG+ S + P   G E    + R  + A   A+  D+G G   S    T V
Sbjct: 439 GVLIEATSTPPGMGSMVFP-GYGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVV 497

Query: 549 TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS 370
            YD+   +   L+  L+ + R+L AAGA E+     TG+       S  E +  ++  + 
Sbjct: 498 RYDIAPGEIAKLRVALQAIGRLLFAAGAVEVL----TGIPGAPPMRSLPELQDVLRRANP 553

Query: 369 QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV 190
           +SL       A+ H  G+   G D +   V+  G    VEG++V D S+LP+   VNP +
Sbjct: 554 RSLHL-----AAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPSCPEVNPQL 608

Query: 189 TIMSVSYCISQSVL 148
           +IM+++  ++   +
Sbjct: 609 SIMAMALAVADQTV 622



>gb:BX248335_757860 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 2/14.
          Length = 629

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 3/194 (1%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS---PTSV 550
           G +I+  +  PG+ S + P   G E    + R  + A   A+  D+G G   S    T V
Sbjct: 439 GVLIEATSTPPGMGSMVFP-GYGAELLRWLDRAPQIATFGAMVADRGVGTVRSVRGETVV 497

Query: 549 TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS 370
            YD+   +   L+  L+ + R+  AAGA E+     TG+       S  E +  ++  + 
Sbjct: 498 RYDIAPGEIAKLRVALQAIGRLFFAAGAVEVL----TGIPGAPPMRSLPELQDVLRRANP 553

Query: 369 QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV 190
           +SL       A+ H  G+   G D +   V+  G    VEG++V D S+LP+   VNP +
Sbjct: 554 RSLHL-----AAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPSCPEVNPQL 608

Query: 189 TIMSVSYCISQSVL 148
           +IM+++  ++   +
Sbjct: 609 SIMAMALAVADQTV 622



>gb:BX842648_823723 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 3/11.
          Length = 562

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 29/68 (42%), Positives = 42/68 (61%)
 Frame = -2

Query: 354 HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV 175
           H N   + H +G C MG  P    VNP GE +  +GL+V DGS+LPT+ G NP +TI +V
Sbjct: 481 HLNKVVAVHPLGGCPMGETPDTGFVNPLGEVYGYKGLYVVDGSILPTSTGPNPSLTIAAV 540

Query: 174 SYCISQSV 151
           +  I++ +
Sbjct: 541 AEYIAEQI 548



>gb:AE017300_435485 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 14 of 14 of the
           complete sequence.>gb:AE016823_1068496 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 518

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 55/200 (27%), Positives = 89/200 (44%), Gaps = 8/200 (4%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG------EAFSP 559
           G +I    L PG  +AL+P   G E +  M +            D  S        A   
Sbjct: 327 GFLIMANQLQPGSLAALIP-GFGVEHREIMKQLPHIGGTIGWIDDVPSELGNISVSASGK 385

Query: 558 TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF--ERFV 385
            ++TY+  K  +E L+  + K  ++  +AGA+ I           + D  R +   E+ +
Sbjct: 386 RTITYNFGKLTKEFLKDCIRKQAQLNFSAGAKWI----------LLPDLKRTKIFSEKEI 435

Query: 384 KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
            + +   L     + A+ H  G CRMG DP  SVV+ +     ++ L+V D SV PT + 
Sbjct: 436 DKINLLELNPASMMMAAPHPAGGCRMGQDPFTSVVDWRHRVHGLKNLYVSDSSVFPTGVS 495

Query: 204 VNPMVTIMSVSYCISQSVLE 145
           V+P  TIM+ S   ++ +LE
Sbjct: 496 VDPSYTIMAFSKQAAKFILE 515



>gb:AE015533_315297 Shewanella oneidensis MR-1 section 82 of 457 of
           the complete genome.>gb:AE014299_950894 Shewanella
           oneidensis MR-1 complete genome.
          Length = 533

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 62/228 (27%), Positives = 102/228 (44%), Gaps = 12/228 (5%)
 Frame = -2

Query: 783 YEGAIMSAMSTVVLNVNGTG--YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTA 610
           + GA  S  S   +  NG     G  ++ P +HP L ++      G      M+++ +  
Sbjct: 310 HSGAPQSIYSDEFVWKNGADGELGYKLEVPPVHPILIAS-KTIGYGVSHAELMAQFNQLQ 368

Query: 609 HIFALARD------KGSGEAFSPTSVTYDLDKTDE--ENLQRGLEKLLRILAAAGAEEI- 457
              AL RD      +G     +PT  + D   TD     ++R    +  +  +AGA ++ 
Sbjct: 369 VTIALIRDGYHPDSQGGQVHLTPTGFSLDYPLTDAFWRAVRRAYASMAELQFSAGALKVL 428

Query: 456 GCNHGTGLTLKVKDASREEFERFVKEESSQ-SLRKHPNLKASAHQMGSCRMGVDPKASVV 280
             + G       K+A         KE  +Q  L     + ASAH MG C +G D K S+V
Sbjct: 429 PISDGMPYLSSWKEA---------KESIAQMDLAPLKTVVASAHVMGGCPLGEDEKLSMV 479

Query: 279 NPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK 136
           N  G++  +  L V DGS+ PT+LG NP ++I  ++   + ++ + LK
Sbjct: 480 NSYGQSHYLNNLSVMDGSIFPTSLGANPQLSIYGITARNATALAQKLK 527



>gb:AE011571_274413 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 380 of 397 of the complete
           sequence.>gb:AE010300_1007812 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 518

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 55/200 (27%), Positives = 89/200 (44%), Gaps = 8/200 (4%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG------EAFSP 559
           G +I    L PG  +AL+P   G E +  M +            D  S        A   
Sbjct: 327 GFLIMANQLQPGSLAALIP-GFGVEHREIMKQLPHIGGTIGWIDDVPSELGNISVSASGK 385

Query: 558 TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF--ERFV 385
            ++TY+  K  +E L+  + K  ++  +AGA+ I           + D  R +   E+ +
Sbjct: 386 RTITYNFGKLTKEFLKDCIRKQAQLNFSAGAKWI----------LLPDLKRTKIFSEKEI 435

Query: 384 KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
            + +   L     + A+ H  G CRMG DP  SVV+ +     ++ L+V D SV PT + 
Sbjct: 436 DKINLLELNPASMMMAAPHPAGGCRMGQDPFTSVVDWRHRVHGLKNLYVSDSSVFPTGVS 495

Query: 204 VNPMVTIMSVSYCISQSVLE 145
           V+P  TIM+ S   ++ +LE
Sbjct: 496 VDPSYTIMAFSKQAAKFILE 515



>gb:CP000009_863084 Gluconobacter oxydans 621H, complete genome.
          Length = 515

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 25/64 (39%), Positives = 46/64 (71%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           +AH +G+CRMG D  ++VVNPKG +++++ L++ D S+ P+A   NP + IM++S   + 
Sbjct: 451 AAHMIGTCRMGTDAGSNVVNPKGRSFDIDNLWISDHSIFPSAAAANPALAIMALSLRTAD 510

Query: 156 SVLE 145
           ++L+
Sbjct: 511 AMLK 514



>gb:AE011848_277052 Xanthomonas axonopodis pv. citri str. 306,
           section 226 of 469 of the complete
           genome.>gb:AE008923_918827 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 508

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 26/55 (47%), Positives = 40/55 (72%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           SAH +G+CRMG +P  +VV+P G T++V  L++ D SV P+AL  NP +T M+++
Sbjct: 444 SAHTLGTCRMGTEPAQAVVDPDGRTFDVPNLYICDNSVFPSALAANPALTQMALA 498



>gb:AP005512_1853175 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0012O03.
          Length = 179

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 29/54 (53%), Positives = 36/54 (66%)
 Frame = -2

Query: 345 LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           L  SAH MG+CRMG       V+ +GE+WE   L+V + SVLPTA+GVN M TI
Sbjct: 28  LFCSAHHMGNCRMGATAGDGAVDARGESWEAGRLYVCNSSVLPTAVGVNAMNTI 81



>gb:BA000012_671192 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 499

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 25/57 (43%), Positives = 39/57 (68%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           K ++HQ G+ R+G DP  SVV+P   + ++  L+V D SVLPT+  VNP +TI +++
Sbjct: 433 KTTSHQCGTARLGSDPNTSVVSPDCRSHDIANLYVTDASVLPTSAAVNPALTIAALA 489



>gb:AL646083_549537 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 8/11.
          Length = 1150

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 7/92 (7%)
 Frame = -2

Query: 426 KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE--- 256
           ++ DA+R     +V       L KH  +  + H +G C MG D    VVN KG+ +    
Sbjct: 462 RLYDATRALGGTYVPNPIWTDLFKHSLI--TVHPLGGCVMGEDAAQGVVNHKGQVFSSAS 519

Query: 255 ----VEGLFVGDGSVLPTALGVNPMVTIMSVS 172
                 GL+V DGSV+PT+L VNP++TI +VS
Sbjct: 520 GSDVYPGLYVTDGSVIPTSLAVNPLLTISAVS 551



>gb:BA000040_730979 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 584

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 27/64 (42%), Positives = 42/64 (65%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H +G+ RMG DP+ SVVN  G + +V+ LF+ DGS+  T+ GVNP  TI +++  I+  +
Sbjct: 516 HLLGTARMGTDPERSVVNEWGRSHDVKNLFIVDGSIFVTSGGVNPTSTIQALALYIADQM 575

Query: 150 LEFL 139
            + L
Sbjct: 576 KQRL 579



>gb:AE016918_357450 Chromobacterium violaceum ATCC 12472 section 9
           of 16 of the complete genome.>gb:AE016825_1042604
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 516

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 53/205 (25%), Positives = 83/205 (40%), Gaps = 13/205 (6%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD-------------KG 580
           G  ++ P +HP L S   P   G E    + +        AL RD             +G
Sbjct: 319 GFKLEVPPMHPLLASVTFP-GFGIEQSQLLQQLPHLHATLALLRDGFHPDSQGGAVKLRG 377

Query: 579 SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE 400
            G   SP ++ Y L+    + ++R    +  +  AAGA  +   H     +     +RE 
Sbjct: 378 DG---SP-ALDYPLNDVVWDGVRRSWLAMAELQFAAGASLVMPLHERAQPMSSWKQTREM 433

Query: 399 FERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL 220
                 +     L        SAH MG   MG DP  SV++  G  W    L V DGS  
Sbjct: 434 IAALPLQALQARL-------VSAHVMGGMAMGDDPARSVLDGWGRHWTWRNLTVVDGSAF 486

Query: 219 PTALGVNPMVTIMSVSYCISQSVLE 145
           PT++G NP ++I + ++  ++ + E
Sbjct: 487 PTSIGANPQLSIYAFAWRAAERLAE 511



>gb:BX842653_825469 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 8/11.
          Length = 582

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWE-----VEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           + H +G C MG    A VVN  G+ +       EGLFV DGS++PTA+GVNP++TI +++
Sbjct: 513 TVHPLGGCSMGDSVTAGVVNHLGQVYHPEGGLYEGLFVMDGSIIPTAVGVNPLLTISALA 572



>gb:AY048670_586720 Streptomyces globisporus enediyne antitumor
           antibiotic C-1027 biosynthetic gene cluster, complete
           sequence.
          Length = 551

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 3/164 (1%)
 Frame = -2

Query: 654 GQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA 475
           G+E K  + ++     IF +  D   G  F P   T +  +  ++ L RG  +       
Sbjct: 360 GKEKKEILKQWTSWLTIFTMIEDDNEG-VFGPPPATGNAHRISQQMLGRGNLRY------ 412

Query: 474 AGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASA---HQMGSCRMG 304
                      T  TL    AS  E +  ++++    +    N    A   H + SCRMG
Sbjct: 413 ---------DPTKNTLGAWAASDAEVKEILEKDGLAKVMPWTNDLVGAYTVHPLSSCRMG 463

Query: 303 VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
            DP  S ++   E  +  G+FV DGS +P AL VNP +TI +++
Sbjct: 464 DDPHTSALDDSNELRDHPGIFVTDGSSVPGALTVNPAMTIAALA 507



>gb:AE016917_357179 Chromobacterium violaceum ATCC 12472 section 8
           of 16 of the complete genome.>gb:AE016825_1042333
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 1151

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 7/80 (8%)
 Frame = -2

Query: 390 FVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE-------VEGLFVGD 232
           +V+      L KH  +  + H +G C MG D +  VVN KG+ +          GL+V D
Sbjct: 474 YVRNPIWTDLFKHSLI--TVHPLGGCVMGEDAEQGVVNHKGQAFSGASGSAVYPGLYVTD 531

Query: 231 GSVLPTALGVNPMVTIMSVS 172
           GSV+PT+L VNP+ TI +VS
Sbjct: 532 GSVIPTSLAVNPLFTISAVS 551



>gb:AY117439_589440 Streptomyces carzinostaticus subsp.
           neocarzinostaticus neocarzinostatin biosynthetic locus,
           complete sequence.
          Length = 552

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 44/164 (26%), Positives = 70/164 (42%), Gaps = 3/164 (1%)
 Frame = -2

Query: 654 GQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA 475
           G   K  + R+     +F++  D   G  F P   T +  +  ++ L RG  +       
Sbjct: 360 GARKKEILKRWTSWLTVFSMIEDDNEG-VFGPPPATGNAHRISQQLLGRGNLRYAP---- 414

Query: 474 AGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASA---HQMGSCRMG 304
                      T  TL    AS  E +  ++++    +    N    A   H + SCRMG
Sbjct: 415 -----------TQNTLNAWAASDAEVKEILEKDGLAQVMPWTNDLVGAYTVHPLASCRMG 463

Query: 303 VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
            DP  S ++ + E     G+FV DGS +P AL VNP +TI +++
Sbjct: 464 DDPHTSALDDRNELRGHPGIFVTDGSAVPGALTVNPALTISALA 507



>pir|AE3094|AE3094 oxidoreductase Atu4377 [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>pir|E98192|E98192
           probable oxidoreductase chain CJ0415 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008247_235004 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 51 of 187 of the
           complete sequence.>gb:AE009366_251198 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 136 of
           187 of the complete sequence.>gb:AE007870_1080117
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1089041 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 561

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 23/53 (43%), Positives = 36/53 (67%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H+MG+ RMG DPK SV+N   + W+   +FV DG+ + +A  VNP +T M+++
Sbjct: 493 HEMGTARMGRDPKTSVLNGNNQVWDAPNVFVTDGACMTSASCVNPSLTYMALT 545



>gb:BX571965_790508 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 532

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 24/55 (43%), Positives = 36/55 (65%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           + H  G+ RMG DP  SVV+    +W++  L++ DGSV PT  GVNP +TI +++
Sbjct: 452 TCHLGGTARMGDDPATSVVDADCRSWDIPNLWICDGSVFPTVGGVNPSLTIQAIA 506



>pir|AD3084|AD3084 dehydrogenase Atu4296 [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>pir|E98202|E98202
           dehydrogenase chain I (AF068066) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008255_235084 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 59 of 187 of the
           complete sequence.>gb:AE009357_251117 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 127 of
           187 of the complete sequence.>gb:AE007870_1080197
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1088960 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 527

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 37/117 (31%), Positives = 58/117 (49%), Gaps = 13/117 (11%)
 Frame = -2

Query: 438 GLTLKVKDASREEFERFVKEESSQSLRKHP---------NLKASAHQMGSCRMGVDPKAS 286
           G  L  +   RE  +RFV+   S  LRK+           ++A +HQ G+ RMG DPK +
Sbjct: 402 GAELIYRPGDREAHQRFVRHMRSL-LRKNGFPVVLGHSFGIEAPSHQCGTVRMGDDPKEA 460

Query: 285 VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI----MSVSYCISQSVLEFLKTHD 127
            +N   +T++   L+V D    P++  +NP +T+    + V   I QS    L+ HD
Sbjct: 461 ALNALCQTYDHPNLYVVDAGFFPSSAALNPALTVAAQALRVGDHIRQSRFSSLRAHD 517



>pir|H87451|H87451 oxidoreductase, GMC family CC1634 [imported] -
           Caulobacter crescentus>gb:AE005839_212775 Caulobacter
           crescentus CB15 section 165 of 359 of the complete
           genome.>gb:AE005673_922674 Caulobacter crescentus CB15
           complete genome.
          Length = 579

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 3/190 (1%)
 Frame = -2

Query: 732 GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS 553
           G G+GA  +     PG      PW  G      M  YA       +  ++   + F   +
Sbjct: 414 GRGFGAARKAALSQPG------PWTMGLSGFGEMLPYADNR----VTLNRDVEDKFGLPT 463

Query: 552 VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES 373
           +T ++   D E   R      R + AA AE                         ++   
Sbjct: 464 LTMNVTMRDNEMAMR------RDMQAAAAE------------------------MLEAAG 493

Query: 372 SQSLRKHPNLKASA---HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
            Q++R H N  A     H+MG+ RMG DPK SV+N   +  E + ++V DG+ + +A  V
Sbjct: 494 FQNVRAHDNGFAPGLGIHEMGTARMGRDPKTSVLNAHNQVHECKNVYVTDGAAMASASCV 553

Query: 201 NPMVTIMSVS 172
           NP +T M+++
Sbjct: 554 NPSLTYMALT 563



>pir|JC7628|JC7628 glucoside 3-dehydrogenase (EC 1.1.99.13) -
           Halomonas sp. alpha-15
          Length = 562

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 25/65 (38%), Positives = 40/65 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H+MG+ RMG DPK SV+N   + W+   +FV DG+ + ++  VNP +T M+++       
Sbjct: 493 HEMGTARMGRDPKTSVLNSHNQVWDAPNVFVTDGACMTSSSCVNPSLTYMALTARAVDYA 552

Query: 150 LEFLK 136
           +E LK
Sbjct: 553 VEELK 557



>gb:AJ847918_533757 Bacillus circulans partial butirosin
           biosynthetic gene cluster.
          Length = 456

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 37/132 (28%), Positives = 56/132 (42%)
 Frame = -2

Query: 546 YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ 367
           Y   + D+  L   +E+   IL A GA+ + CN                           
Sbjct: 353 YQTHEWDKRRLSFMIERAGEILTAMGAKRVQCNPSYYYL--------------------- 391

Query: 366 SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT 187
                     SAH  G+CR G D + SVV+  G    ++ LF  DGS +P A GVNP +T
Sbjct: 392 ---------GSAHLHGTCRAGTDERTSVVDKFGRFHTIDNLFAADGSFMPFAGGVNPTLT 442

Query: 186 IMSVSYCISQSV 151
           I + +  I++++
Sbjct: 443 IQANALRIAENM 454



>gb:AE011555_274234 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 364 of 397 of the complete
           sequence.>gb:AE017299_435349 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 13 of 14 of the complete
           sequence.>gb:AE010300_1007633 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1068360 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 522

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           S H +G C +  +P   VV+  GE +  + LF+ DGSV+P+++G +P++TI +V+   + 
Sbjct: 457 SVHSLGGCILSANPDKGVVSETGEVFGYKNLFIADGSVIPSSIGFHPVMTISAVAEHTAA 516

Query: 156 SV 151
           S+
Sbjct: 517 SI 518



>gb:BA000013_672726 Mesorhizobium loti MAFF303099 pMLa DNA, cpmplete
           genome.
          Length = 507

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 56/198 (28%), Positives = 89/198 (44%), Gaps = 7/198 (3%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA-----FSPT 556
           G  + TPA+  GL S    W +  +  MR  R+  +   + + R +G G        +  
Sbjct: 309 GGSVFTPAIF-GL-SLAEDWTNRGDL-MRNWRFCGS--YYGMIRPRGVGSVRPLPGINEP 363

Query: 555 SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEI--GCNHGTGLTLKVKDASREEFERFVK 382
            V + L   D   L + L +L +++  AGA ++  G +   G T   +          V 
Sbjct: 364 LVGFKLAPDDWIALCQVLTRLGQVMFEAGARKVFPGISGHEGWTSPNQ----------VH 413

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E  ++ L K      S H   SC  G    A  V+  G    VE LFV DGS++P A GV
Sbjct: 414 EYWNKPLPKQATNLMSIHLFSSCPPGEHRDACAVDSYGRVRGVENLFVADGSLIPEAPGV 473

Query: 201 NPMVTIMSVSYCISQSVL 148
           NP +TIM++++  +++ L
Sbjct: 474 NPQMTIMALAFRAAEAAL 491



>gb:MPU575934_149487 Micromonospora purpurea DOS biosynthetic gene
           cluster.>gb:AY524043_625287 Micromonospora echinospora
           ATCC 15835 gentamicin biosynthesis gene cluster,
           complete sequence.
          Length = 507

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 24/55 (43%), Positives = 33/55 (60%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           S H  G+CR G DP+ SV +P G    +  L V DG V+P   GVNP +TI +++
Sbjct: 433 STHLHGTCRAGTDPRTSVTDPDGRVHGLTNLMVVDGGVMPYPGGVNPTLTIQALA 487



>sp|P55582|Y4NJ_RHISN Hypothetical GMC-type oxidoreductase
           Y4NJ.>gb:AE000087_19808 Rhizobium sp. NGR234 plasmid
           pNGR234a, section 24 of 46 of the complete plasmid
           sequence.
          Length = 505

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 55/198 (27%), Positives = 90/198 (45%), Gaps = 7/198 (3%)
 Frame = -2

Query: 720 GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA-----FSPT 556
           G  + TPA+  GL S    W +  +    M  +      + + R +G G        +  
Sbjct: 309 GGSVFTPAVF-GL-SLAEDWTNRGDL---MQAWRLCGSYYGMIRPRGVGSVRPLPGINEP 363

Query: 555 SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEI--GCNHGTGLTLKVKDASREEFERFVK 382
            V++ L   D  +L + L  L + + AAGA ++    +   G T      + +E + F  
Sbjct: 364 LVSFKLAPEDWISLGQVLTLLGQAMFAAGARKVIPSISGHEGWT------NPDEVDEFRN 417

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           +   +   K  NL  + H   +C  G    A  V+  G    VE LFV DGSV+P A GV
Sbjct: 418 KPLPE---KATNLM-TIHLFSTCPPGEHRDACAVDSYGRVRGVENLFVADGSVIPEAPGV 473

Query: 201 NPMVTIMSVSYCISQSVL 148
           NP +TIM++++ I+++ L
Sbjct: 474 NPQMTIMALAFRIAEAAL 491



>gb:AE017299_435348 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 13 of 14 of the
           complete sequence.>gb:AE016823_1068359 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 1135

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 7/62 (11%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWE-------VEGLFVGDGSVLPTALGVNPMVTIMS 178
           S H +G C MG D   S VN   + +          GL++ DGSV+P +LGVNP++TI +
Sbjct: 484 SVHPLGGCPMGDDASTSAVNENCQVYSGKSGKETYNGLYIMDGSVIPRSLGVNPLLTICA 543

Query: 177 VS 172
           +S
Sbjct: 544 IS 545



>gb:AE011555_274233 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 364 of 397 of the complete
           sequence.>gb:AE010300_1007632 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 1135

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 7/62 (11%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWE-------VEGLFVGDGSVLPTALGVNPMVTIMS 178
           S H +G C MG D   S VN   + +          GL++ DGSV+P +LGVNP++TI +
Sbjct: 484 SVHPLGGCPMGDDASTSAVNENCQVYSGKSGKETYNGLYIMDGSVIPRSLGVNPLLTICA 543

Query: 177 VS 172
           +S
Sbjct: 544 IS 545



>gb:BX569693_776433 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 501

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 25/91 (27%), Positives = 52/91 (57%)
 Frame = -2

Query: 423 VKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGL 244
           +K   ++   + V +  + +  + P L    +  GSCRMG DP  SVV+  G++ E+E L
Sbjct: 411 LKGVEKDPITKVVLKAPTHARGEAP-LSVVGYGCGSCRMGDDPANSVVDAHGKSHELENL 469

Query: 243 FVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           ++ D S+ P+   V P +T+++++  +++ +
Sbjct: 470 YLADASIFPSCPSVGPGLTVIALALRLAEKL 500



>gb:AP006618_558879 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 580

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/55 (43%), Positives = 34/55 (61%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           N+ A+AH +G C +G  P++ VV+P    +   GL V DGS +   LGVNP +TI
Sbjct: 464 NIPATAHYIGGCVIGESPRSGVVDPYQRVFGHPGLHVADGSAVTANLGVNPSLTI 518



>pir|A84260|A84260 hypothetical protein Vng1035c [imported] -
           Halobacterium sp. NRC-1>gb:AE005037_62605 Halobacterium
           sp. NRC-1 section 68 of 170 of the complete
           genome.>gb:AE004437_887524 Halobacterium sp. NRC-1
           complete genome.
          Length = 529

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 34/53 (64%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H MG+ RMG DP  SVV+P+  T ++  L V   SV PTA  +NP +TI +++
Sbjct: 466 HHMGTTRMGTDPAESVVDPRLRTHDLSNLSVASSSVFPTAGAMNPTLTIAALA 518



>gb:AE017231_412090 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 5 of 16 of the complete
           genome.>gb:AE016958_1055494 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 566

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 25/54 (46%), Positives = 31/54 (57%)
 Frame = -2

Query: 333 AHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           AH +G  RMG  P  SVV+     W V  L V DGSV PT    NP +TIM+++
Sbjct: 487 AHLIGGARMGTRPDNSVVDSDHRVWGVPNLLVADGSVCPTQGSANPALTIMALA 540



>gb:ANI507836_553451 Arthrobacter nicotinovorans pAO1 plasmid
           sequence.
          Length = 522

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 27/86 (31%), Positives = 44/86 (51%)
 Frame = -2

Query: 429 LKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVE 250
           + +++   E+ E+  K   +    + P +  S H +G+ RM   P   VVN  G+  +V 
Sbjct: 422 IAMRNHGYEQGEKLFKSVGAIRTTRAPGMP-SGHNLGTARMSQKPDEGVVNSFGQAHDVP 480

Query: 249 GLFVGDGSVLPTALGVNPMVTIMSVS 172
            LFV DGS   T    NP +TI+++S
Sbjct: 481 NLFVSDGSQFTTGAAANPTLTIVALS 506



>pir|D87452|D87452 oxidoreductase, GMC family CC1638 [imported] -
           Caulobacter crescentus>gb:AE005839_212779 Caulobacter
           crescentus CB15 section 165 of 359 of the complete
           genome.>gb:AE005673_922678 Caulobacter crescentus CB15
           complete genome.
          Length = 509

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = -2

Query: 339 ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           AS H MG+ RM  DP+  VV+  G   E   L+V   SV PT+  VNP +TI++++
Sbjct: 440 ASRHHMGTTRMHADPRKGVVDADGRLHEANNLYVAGSSVFPTSGIVNPTLTILALT 495



>gb:BA000045_741238 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 521

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 24/61 (39%), Positives = 35/61 (57%)
 Frame = -2

Query: 360 RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM 181
           R    L A  HQ G+CR G +P  SV++       V+ L+V DGS  P++  VNP +TI+
Sbjct: 447 RTQSPLAAVGHQCGTCRFGPNPATSVLDLDCRAHAVDNLYVVDGSFFPSSAAVNPTLTIV 506

Query: 180 S 178
           +
Sbjct: 507 A 507



>gb:AY596297_632009 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 543

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 26/64 (40%), Positives = 37/64 (57%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H MG+ RMG DP  SVV+P+  T +V  L +   SV  TA  +NP +TI +++   +  V
Sbjct: 480 HHMGTTRMGTDPDKSVVDPQLRTHDVANLSIASSSVFVTAGSMNPTLTIAALALKCADHV 539

Query: 150 LEFL 139
            E L
Sbjct: 540 SERL 543



>gb:AE017300_435356 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 14 of 14 of the
           complete sequence.>gb:AE016823_1068367 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 574

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPK----GETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           S H +G C +G     SV +      G+ +  +GL+V DGS+ PTA+G NP +TI ++S 
Sbjct: 500 SVHPLGGCILGNSKTNSVTSADFKTFGQVFSYQGLYVADGSLSPTAIGANPSMTIAALSE 559

Query: 168 CISQSV 151
            +++ +
Sbjct: 560 KVAEGI 565



>pir|B38575|B38575 gluconate 2-dehydrogenase (FAD) (EC 1.1.99.3)
           catalytic chain precursor [validated] - Erwinia
           cypripedii>gb:ECU97665_134970 Erwinia cypripedii
           membrane-bound gluconate dehydrogenase complex, subunit
           III precursor, dehydrogenase subunit precursor and
           cytochrome c precursor, genes, complete cds.
          Length = 615

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 22/64 (34%), Positives = 35/64 (54%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           + H  G   MG DPK S VN   ++W+V  +FV   S  P  LG NP   + +++Y  ++
Sbjct: 540 TTHMSGGAIMGEDPKTSAVNRYLQSWDVPNVFVPGASAFPQGLGYNPTGMVAALTYWSAK 599

Query: 156 SVLE 145
           ++ E
Sbjct: 600 AIRE 603



>gb:AE011556_274244 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 365 of 397 of the complete
           sequence.>gb:AE010300_1007643 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 574

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPK----GETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           S H +G C +G     SV +      G+ +  +GL+V DGS+ PTA+G NP +TI ++S 
Sbjct: 500 SVHPLGGCIIGNSKTNSVTSADFKTFGQVFSYQGLYVADGSLSPTAIGANPSMTIAALSE 559

Query: 168 CISQSV 151
            +++ +
Sbjct: 560 KVAEGI 565



>gb:AY120852_590152 Synechococcus sp. PCC 7942 PacS, dehydrogenase
           subunit-like protein, Dhg2 (dhg2), MalQ, EriC (eriC),
           Syr (syr), TatC (tatC), TrmE (trmE), two-component
           sensor histidine kinase-like protein, putative chloride
           channel protein, PmbA (pmbA), ribosomal protein S1,
           creatininase, AccA (accA), AcdS (acdS), and Gch1 (gch1)
           genes; and unknown genes.
          Length = 528

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 24/74 (32%), Positives = 41/74 (55%)
 Frame = -2

Query: 360 RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM 181
           R    ++   HQ G+CR G DP  SV++   +  +V+ L+V D S   ++  VNP +TI+
Sbjct: 454 RSSSPIQVLGHQCGTCRFGEDPTTSVLDLNCQAHDVDNLYVVDSSFFCSSAAVNPTLTII 513

Query: 180 SVSYCISQSVLEFL 139
           + +  +   +LE L
Sbjct: 514 ANALRVGDHLLERL 527



>gb:AP008231_579724 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 528

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 24/74 (32%), Positives = 41/74 (55%)
 Frame = -2

Query: 360 RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM 181
           R    ++   HQ G+CR G DP  SV++   +  +V+ L+V D S   ++  VNP +TI+
Sbjct: 454 RSSSPIQVLGHQCGTCRFGEDPTTSVLDLNCQAHDVDNLYVVDSSFFCSSAAVNPTLTII 513

Query: 180 SVSYCISQSVLEFL 139
           + +  +   +LE L
Sbjct: 514 ANALRVGDHLLERL 527



>gb:AE017230_411661 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 4 of 16 of the complete
           genome.>gb:AE016958_1055065 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 560

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 24/65 (36%), Positives = 37/65 (56%)
 Frame = -2

Query: 390 FVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA 211
           ++ ++   S+R +   +A  HQ G+ RM   PK  VV+P+ +   V GL+V   SVLPT+
Sbjct: 473 WLTDDVEASVRGYMRRRAGFHQAGTTRMSASPKDGVVDPQLQVHGVRGLYVAATSVLPTS 532

Query: 210 LGVNP 196
              NP
Sbjct: 533 SQANP 537



>gb:AE016786_332801 Pseudomonas putida KT2440 section 13 of 21 of
           the complete genome.>gb:AE015451_947878 Pseudomonas
           putida KT2440 complete genome.
          Length = 594

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           + H  G   MG DPK S +N   ++W+V  +FV   S  P  LG NP   + +++Y  ++
Sbjct: 519 TTHLNGGAIMGTDPKTSALNRYLQSWDVHNVFVPGASAFPQGLGYNPTGLVAALTYWSAR 578

Query: 156 SVLE 145
           ++ E
Sbjct: 579 AIRE 582



>pir|H83362|H83362 gluconate dehydrogenase PA2265 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004652_56501
           Pseudomonas aeruginosa PAO1, section 213 of 529 of the
           complete genome.>gb:AE004091_970601 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 591

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           + H +G   MG DPK SV+N   ++W+V  +FV   S  P   G NP   + +++Y  ++
Sbjct: 516 TTHLLGGAIMGSDPKTSVLNRYLQSWDVHNVFVMGASAFPQGTGYNPTGLVAALAYWSAK 575

Query: 156 SVLE 145
           ++ E
Sbjct: 576 AIRE 579



>gb:AY596297_631649 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 560

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/55 (41%), Positives = 33/55 (60%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           S H MG+ RMG DP  SVVN +  T ++  L++   SV  TA   NP +TI +++
Sbjct: 495 STHHMGTTRMGTDPAESVVNEQCRTHDLANLWIASSSVFTTAGANNPTLTIAALA 549



>gb:AL646057_545051 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 1/19.
          Length = 574

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 38/130 (29%), Positives = 60/130 (46%), Gaps = 8/130 (6%)
 Frame = -2

Query: 537 DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQS-- 364
           D TD   +  GL  +  I A     E+G               RE +   ++ + S    
Sbjct: 431 DPTDMAGMMAGLRAVRSIFAQQPLAELG--------------GRELYSEGIRGDGSDDEA 476

Query: 363 ----LRKHPNLKASAHQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
               +R+H +     H +G+CRMG   DP A+VV+P+     +EGL V DGSV+PT +G 
Sbjct: 477 VRALIRRHAD--TIYHPVGTCRMGGAGDP-AAVVDPELRVRGIEGLRVIDGSVMPTLIGG 533

Query: 201 NPMVTIMSVS 172
           N    ++ ++
Sbjct: 534 NTNAPVIMIA 543



>gb:AY466441_621205 Saccharopolyspora spinosa NRLL 18395 obscurin
           polyketide synthase gene locus, complete sequence.
          Length = 544

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 23/68 (33%), Positives = 37/68 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H MG+ RMG+DP  SV+N      +V  L+V DGS   T+   NP  TI +++   ++ +
Sbjct: 474 HIMGTARMGLDPADSVINEWHRAHDVPNLYVIDGSAFVTSAAANPTATITALTLRATEQL 533

Query: 150 LEFLKTHD 127
           +   K  +
Sbjct: 534 IANRKNQE 541



>gb:BA000040_735751 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 522

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 21/55 (38%), Positives = 34/55 (61%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           S H +G+ RM   P+  VVN  G++ +V+ LFV DGS   +    NP +TI++++
Sbjct: 452 STHNLGTNRMSEKPRDGVVNKFGQSHDVKNLFVSDGSQFTSGAACNPTLTIVALA 506



>gb:BX957220_843662 Methanococcus maripaludis S2 complete genome;
           segment 2/5.
          Length = 386

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 38/140 (27%), Positives = 58/140 (41%)
 Frame = -2

Query: 591 RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA 412
           +D+ +GE F   SV  ++   D  NL  G+ K  + L   G E I               
Sbjct: 279 KDENTGEVFE-NSVKKEMSMNDTRNLCEGVSKASKYLYDLGVENI--------------- 322

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD 232
                              +  +   +H  G+C +G      VV+   ET E+EGL+V D
Sbjct: 323 -------------------YSTVPRGSHPGGTCAVG-----KVVDKNLET-EIEGLYVCD 357

Query: 231 GSVLPTALGVNPMVTIMSVS 172
            SV+P A G  P++ IM++S
Sbjct: 358 ASVIPKAPGAPPILGIMAIS 377



>gb:AE016780_331096 Pseudomonas putida KT2440 section 7 of 21 of the
           complete genome.>gb:AE015451_946173 Pseudomonas putida
           KT2440 complete genome.
          Length = 752

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 2/130 (1%)
 Frame = -2

Query: 552 VTYDL-DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEE 376
           +TY+L D T E   Q  L     I    GA E+     T L  K++  S+  FE   +  
Sbjct: 501 ITYELSDYTKEGFKQARLAATYIITELMGATEL-----TDLNPKLEPGSQTVFEYDGQNY 555

Query: 375 SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF-VGDGSVLPTALGVN 199
           +            + H MG+ RMG D   SVV+    +W+   LF VGDG V PT    N
Sbjct: 556 A---------FYGAGHLMGTYRMGSDRTKSVVDKDQRSWDHPNLFLVGDG-VFPTTGTAN 605

Query: 198 PMVTIMSVSY 169
           P +TI ++++
Sbjct: 606 PTLTITALTF 615



>gb:AE014291_309448 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 494

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 20/64 (31%), Positives = 37/64 (57%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           +  +HQ G+ R+G DP  + ++P    ++   L+V D S LPT+  VNP +TI + +  +
Sbjct: 425 RTPSHQCGTARIGNDPATAPLDPYCRAYDHPNLYVVDASFLPTSAAVNPALTIAAQALRV 484

Query: 162 SQSV 151
           +  +
Sbjct: 485 ADRI 488



>pir|AD3255|AD3255 l-sorbose dehydrogenase (FAD) (EC 1.1.99.-)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009446_251944 Brucella melitensis 16M
           chromosome I, section 3 of 195 of the complete
           sequence.>gb:AE008917_977856 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 494

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 20/64 (31%), Positives = 37/64 (57%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           +  +HQ G+ R+G DP  + ++P    ++   L+V D S LPT+  VNP +TI + +  +
Sbjct: 425 RTPSHQCGTARIGNDPATAPLDPYCRAYDHPNLYVVDASFLPTSAAVNPALTIAAQALRV 484

Query: 162 SQSV 151
           +  +
Sbjct: 485 ADRI 488



>gb:ABO295164_18432 Alcanivorax borkumensis AP1 alk gene cluster
           (alkS, alkB1GHJ) and flanking ORF1 and ORF2 DNA.
          Length = 535

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           N +   H +G+CRMG DP  SVV+P+ +   VEGL V D S++P+ +  N     M ++
Sbjct: 465 NAETIYHPVGTCRMGADPD-SVVDPELKVRGVEGLRVVDASIMPSLVAGNTNAPTMMIA 522



>pir|S62689|S52489 choline oxidase (EC 1.1.3.17) - Arthrobacter
           globiformis>gb:AGCODA_521655 A.globiformis codA gene.
          Length = 547

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 27/70 (38%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
           EE    +RK  N     H +G+ RMG V+ + S ++P+     V GL VGD SV+P  + 
Sbjct: 452 EELQDYIRKTHN--TVYHPVGTVRMGAVEDEMSPLDPELRVKGVTGLRVGDASVMPEHVT 509

Query: 204 VNPMVTIMSV 175
           VNP +T+M +
Sbjct: 510 VNPNITVMMI 519



>gb:AB161046_1528516 Coniophora puteana cdh mRNA for cellobiose
           dehydrogenase, complete cds.
          Length = 774

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 5/97 (5%)
 Frame = -2

Query: 423 VKDASREEFERFVKEESSQSLRKH-----PNLKASAHQMGSCRMGVDPKASVVNPKGETW 259
           V + S+ E    +  +++ +L+++     P    S H +GS ++G DP ++VV+   + +
Sbjct: 672 VSNVSQVEGLTMITPDNTTTLQEYVDSYDPGTMDSNHWVGSAKIGSDPSSAVVDENTKVF 731

Query: 258 EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVL 148
             + LFV D S++P     NP   +MS +   +  +L
Sbjct: 732 NTDNLFVVDASIIPKLPTGNPHGMLMSAAEQAAAKIL 768



>gb:BX908798_830347 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 483

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 14/90 (15%)
 Frame = -2

Query: 399 FERFVKEESSQSLRKHP----NLKASA----------HQMGSCRMGVDPKASVVNPKGET 262
           FE ++K  ++  L+KH     N+KA A          HQ+G+ RM +  +  VV+   + 
Sbjct: 377 FENYLKIFANL-LKKHQVGELNMKADALTMEIFRDASHQLGTTRMALKAQDGVVDSNCQV 435

Query: 261 WEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           + V  LF+   S+ PTA   NP +TI++++
Sbjct: 436 FGVNNLFIAGSSIFPTAGHANPTLTILALA 465



>gb:BA000030_701320 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 516

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = -2

Query: 330 HQMGSCRMGV-DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV 175
           H  G+CRMG    + +VV+PK     ++G+ + D SV PT   VNPM+ ++ V
Sbjct: 452 HPAGTCRMGATSDEHAVVDPKLRIRGLDGIRIADASVFPTMPAVNPMIGVLMV 504



>gb:AY744151_644897 Pseudomonas syringae putative
           reductase/acetyltransferase gene, complete cds.
          Length = 694

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 37/147 (25%), Positives = 67/147 (45%)
 Frame = -2

Query: 585 KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR 406
           + S  A +P   +  L+  D++       ++LR +AA  A    C+H      +V+  S 
Sbjct: 394 RSSDPAVAPVIESRFLEHEDDQRRMIAGMRILREIAAQPALRAYCDHELSPGTEVE--SD 451

Query: 405 EEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS 226
           EE   F + +   S           H +G+CRMG D + +VV+ +     ++GL V D S
Sbjct: 452 EELLEFARTQGDTSY----------HPVGTCRMGKD-ELAVVDHRLRVHGLQGLRVIDAS 500

Query: 225 VLPTALGVNPMVTIMSVSYCISQSVLE 145
           ++PT +  N     + ++   +  VL+
Sbjct: 501 IMPTMVSGNTNAASLMIAEKGADMVLQ 527



>gb:AP006618_560748 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 581

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 21/55 (38%), Positives = 30/55 (54%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           ++  + H +G C +G  P   VV+P    +   GL V DGS +   LGVNP +TI
Sbjct: 457 DIPMTGHFIGGCVIGDSPDTGVVDPYHRMYGYRGLHVIDGSTISANLGVNPSLTI 511



>gb:CP000025_878236 Campylobacter jejuni RM1221, complete genome.
          Length = 573

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           S H  G   MG D + SVVN   + W+ + LFV          G NP  T+ +++Y  ++
Sbjct: 501 STHNTGGTTMGADRETSVVNTYLQHWDADNLFVVGAGNFQHNSGYNPTDTVGALAYRCAE 560

Query: 156 SVLEFLKT 133
            +L++ K+
Sbjct: 561 GILKYHKS 568



>gb:CP000010_867361 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 547

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 22/44 (50%), Positives = 30/44 (68%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMG D +A VV+P+     V+GL V D SV+PT +G N
Sbjct: 468 HPVGTCRMGTDARA-VVDPQLRVKGVDGLRVVDASVMPTLIGGN 510



>gb:BX572091_796274 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 548

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 18/53 (33%), Positives = 31/53 (58%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H++G   MG   + SVVN   + W  + + V DG+  PT+   +P +T+M++S
Sbjct: 486 HEVGGAAMGFSEEESVVNKSNQLWRCKNVLVLDGACWPTSSWQSPTLTMMAIS 538



>gb:BX571965_790000 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 547

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 22/44 (50%), Positives = 30/44 (68%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMG D +A VV+P+     V+GL V D SV+PT +G N
Sbjct: 468 HPVGTCRMGTDARA-VVDPQLRVKGVDGLRVVDASVMPTLIGGN 510



>gb:BA000012_668324 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 499

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 19/64 (29%), Positives = 37/64 (57%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           +  +HQ G+ +MG DP  + ++P   +++   LFV D S LP +  VNP ++I + +  +
Sbjct: 430 RTPSHQCGTVKMGDDPATAPLDPFCRSFDHRNLFVVDASFLPNSAAVNPALSIAAQALRV 489

Query: 162 SQSV 151
           +  +
Sbjct: 490 ADHI 493



>gb:AP006618_559009 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 577

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           N+  +AH +G   +G DP+  V++P    +    L V DG+ +   LGVNP +TI
Sbjct: 457 NIPLTAHFLGGAAIGADPEHGVIDPYHRVYGYPTLSVVDGAAVSANLGVNPSLTI 511



>gb:STE579650_192364 Streptomyces tenebrarius tobramycin
           biosynthetic gene cluster, strain ATCC 17920.
          Length = 508

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 21/62 (33%), Positives = 35/62 (56%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           SAH  G+ R G DP+ SV +P G     + ++  DG+  P A   NP +TI + ++ I+ 
Sbjct: 446 SAHLHGTLRSGRDPRTSVTDPFGRLHGYDNVWAVDGATFPFAGNPNPTLTIQANAHRIAS 505

Query: 156 SV 151
           ++
Sbjct: 506 AI 507



>pir|E81385|E81385 probable oxidoreductase chain Cj0415 [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X2_846820 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 2/6.
          Length = 573

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 21/68 (30%), Positives = 35/68 (51%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           S H  G   MG D + SVVN   + W+ + LFV          G NP  T+ +++Y  ++
Sbjct: 501 STHNTGGTTMGADRETSVVNTYLQHWDADNLFVVGAGNFQHNSGYNPTDTVGALAYRCAE 560

Query: 156 SVLEFLKT 133
            +L++ K+
Sbjct: 561 GILKYHKS 568



>gb:CP000011_869152 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 552

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           N+  +AH MG   M  D +  V + +   +    ++V DGSVL   LGVNP +TI +++
Sbjct: 469 NVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALA 527



>gb:BX571966_795552 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 552

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           N+  +AH MG   M  D +  V + +   +    ++V DGSVL   LGVNP +TI +++
Sbjct: 469 NVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPSLTITALA 527



>gb:BA000030_699817 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 545

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = -2

Query: 363 LRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           L K   + A+AHQ G+ R G DP  S ++   +  +++ L+V D S  P+   VNP +T 
Sbjct: 470 LHKGMPIGATAHQAGTVRFGRDPADSALDVNCKAHDLDNLYVVDTSFFPSIGAVNPSLTA 529

Query: 183 MSVSYCISQSVLEFLK 136
           ++ +  +   + E L+
Sbjct: 530 IANALRVGDHLAERLR 545



>gb:AE014292_309973 Brucella suis 1330 chromosome II, complete
           sequence.
          Length = 544

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 25/62 (40%), Positives = 34/62 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  G+CRMGVDP A VV+P      + GL V D SV+P  +  N    +M ++   +  V
Sbjct: 475 HAAGTCRMGVDPLA-VVDPSLCVHGIAGLRVIDASVMPEMVSGNTQAAVMMLAAKAADIV 533

Query: 150 LE 145
           LE
Sbjct: 534 LE 535



>gb:CR378670_95585 Photobacterium profundum SS9; segment 8/12.
          Length = 545

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 24/69 (34%), Positives = 41/69 (59%)
 Frame = -2

Query: 405 EEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS 226
           EE E F++ ++          ++  H +G+C+MGVD +A VV+P  +   ++GL V D S
Sbjct: 453 EELEAFIRRKA----------ESIYHPVGTCKMGVDDQA-VVDPALKVIGLKGLRVVDAS 501

Query: 225 VLPTALGVN 199
           ++PT +G N
Sbjct: 502 IMPTLIGGN 510



>pir|H69213|H69213 conserved hypothetical protein MTH853 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000862_28547 Methanobacterium
           thermoautotrophicum from bases 774674 to 785809 (section
           68 of 148) of the complete genome.>gb:AE000666_925629
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 391

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 25/65 (38%), Positives = 39/65 (60%)
 Frame = -2

Query: 333 AHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           AH  G+  +G      VV+   ET  +EGLFV D SVLP A G  P++TIM+++  +++ 
Sbjct: 333 AHPGGTASLG-----EVVDENLET-SIEGLFVADASVLPAAPGAPPILTIMALARRLARH 386

Query: 153 VLEFL 139
           ++  L
Sbjct: 387 IVSVL 391



>pir|AE3618|AE3618 alcohol dehydrogenase (acceptor) (EC 1.1.99.-)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009721_254849 Brucella melitensis 16M
           chromosome II, section 83 of 107 of the complete
           sequence.>gb:AE008918_980761 Brucella melitensis 16M
           chromosome II, complete sequence.
          Length = 581

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 25/62 (40%), Positives = 34/62 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  G+CRMGVDP A VV+P      + GL V D SV+P  +  N    +M ++   +  V
Sbjct: 512 HAAGTCRMGVDPLA-VVDPSLCVHGIAGLRVIDASVMPEMVSGNTQAAVMMLAAKAADIV 570

Query: 150 LE 145
           LE
Sbjct: 571 LE 572



>gb:BX640434_812083 Bordetella parapertussis strain 12822, complete
           genome; segment 12/14.>gb:BX640450_816964 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           14/16.
          Length = 533

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/71 (36%), Positives = 37/71 (52%)
 Frame = -2

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD 232
           + E+  RFV+E  +             H +G+CRMG D +ASVV+P      V+GL V D
Sbjct: 453 TEEDMVRFVRESGTTIF----------HPVGTCRMGGD-EASVVDPSLRVRGVQGLRVAD 501

Query: 231 GSVLPTALGVN 199
            S++P  L  N
Sbjct: 502 ASIMPLLLSGN 512



>gb:BX569691_775737 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 547

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H++G   MG DP   VV+     W    + V DG+  PT+   +P +T+M+++
Sbjct: 482 HEVGGAAMGADPSQGVVDVFNRLWAASNVLVVDGACWPTSAWQSPTLTMMAIT 534



>gb:BA000030_702904 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 601

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           +AH +G C +G  P + V++P    +   G+ V DG+ +   LGVNP +TI
Sbjct: 489 TAHFLGGCPIGDSPASGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTI 539



>gb:BA000012_671193 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 548

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 22/48 (45%), Positives = 28/48 (58%)
 Frame = -2

Query: 339 ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP 196
           A+ H  G+CRMG D  A VV P      ++GL V D SV+PT +  NP
Sbjct: 483 AALHPAGTCRMGQDEMA-VVGPDLRVRGIDGLRVADASVMPTLISGNP 529



>gb:AY501993_622344 Campylobacter jejuni strain TGH 9011 contig186
           Tgh134 gene, partial cds.
          Length = 137

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           S H  G   MG D + SV+N   + W+ + LFV          G NP  T+ +++Y  ++
Sbjct: 65  STHNTGGTTMGADRETSVLNTYLQHWDADNLFVVGAGNFQHNSGYNPTDTVGALAYRCAE 124

Query: 156 SVLEFLKT 133
            +L++ K+
Sbjct: 125 GILKYHKS 132



>gb:SCO939121_178501 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 510

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)
 Frame = -2

Query: 330 HQMGSCRMGV-DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV 175
           H  G+CRMG    + +VV+P+     + GL + D SV PT   VNPM+ ++ V
Sbjct: 445 HPAGTCRMGAATDEQAVVDPELRVRGLTGLRIADASVFPTMPAVNPMIGVLMV 497



>gb:CP000031_84258 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 537

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/63 (41%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASA--HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL 208
           E     L +H   +A    H +G+CRMG D  A VV+P+     VEGL V D SV+P  +
Sbjct: 454 EPDDAGLEQHIRARADTIYHPVGTCRMGRDEMA-VVDPQLRVHGVEGLRVVDASVMPRLI 512

Query: 207 GVN 199
           G N
Sbjct: 513 GGN 515



>pir|F70736|F70736 probable choD protein - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_23626
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:MTGUACHO_151057 M.tuberculosis guaA/B & choD
           genes.>gb:BX248346_760799 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           13/14.>gb:BX842583_821516 Mycobacterium tuberculosis
           H37Rv complete genome; segment 12/13.
          Length = 578

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           N+  +AH +G   +G DP+  V++P    +    L+V DG+ +   LGVNP ++I
Sbjct: 464 NIPLTAHFLGGAVIGDDPEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSI 518



>gb:BA000040_733315 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 514

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = -2

Query: 330 HQMGSCRM-GVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           H  GSCRM GV+    VVNP G    + GL V D S++P+    N   T + +   I++ 
Sbjct: 452 HAAGSCRMSGVNDADGVVNPDGTVKGIAGLRVADASIMPSDCRANTHFTTVVIGEAIARM 511

Query: 153 VL 148
           ++
Sbjct: 512 MM 513



>gb:AY589052_630482 Arthrobacter globiformis choline oxidase gene,
           complete cds.
          Length = 546

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
           EE    +RK  N     H +G+ RMG V+ + S ++P+     V GL V D SV+P  + 
Sbjct: 451 EELQDYIRKTHN--TVYHPVGTVRMGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVT 508

Query: 204 VNPMVTIMSV 175
           VNP +T+M +
Sbjct: 509 VNPNITVMMI 518



>gb:AY304485_607434 Arthrobacter globiformis strain ATCC8010 choline
           oxidase (codA) gene, complete cds.
          Length = 546

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLPTALG 205
           EE    +RK  N     H +G+ RMG V+ + S ++P+     V GL V D SV+P  + 
Sbjct: 451 EELQDYIRKTHN--TVYHPVGTVRMGAVEDEMSPLDPELRVKGVTGLRVADASVMPEHVT 508

Query: 204 VNPMVTIMSV 175
           VNP +T+M +
Sbjct: 509 VNPNITVMMI 518



>gb:AL646061_545699 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 5/19.
          Length = 539

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 23/87 (26%), Positives = 43/87 (49%)
 Frame = -2

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD 232
           +RE +    +      ++ H +   + H  G+  MG DPK SVV+    T++   LF+  
Sbjct: 449 TREVYATAARVLGGTDVQFHDDFAPNNHITGATIMGSDPKDSVVDKDCRTFDHPNLFISS 508

Query: 231 GSVLPTALGVNPMVTIMSVSYCISQSV 151
            + +PT   VN  +TI +++  I+  +
Sbjct: 509 SATMPTVGTVNVTLTIAALALRIADQL 535



>gb:AF065159_475245 Bradyrhizobium japonicum putative arylsulfatase
           (arsA), putative soluble lytic transglycosylase
           precursor (sltA), dihydrodipicolinate synthase (dapA),
           MscL (mscL), SmpB (smpB), BcpB (bcpB), RnpO (rnpO),
           RelA/SpoT homolog (relA), PdxJ (pdxJ), and acyl carrier
           protein synthase AcpS (acpS) genes, complete cds;
           prokaryotic type I signal peptidase SipF (sipF) gene,
           sipF-sipS allele, complete cds; RNase III (rnc),
           GTP-binding protein Era (era), hypothetical protein,
           recO-like protein, topoisomerase II (gyrA), putative ABC
           transporter, putative GMC-oxidoreductase, hypothetical
           protein, putative cytochrome C binding protein (cyc4),
           putative polytopic integral membrane protein, superoxide
           dismutase SodM-like protein, putative inner membrane
           protein, AttM-like protein (attM), adenylate
           cyclases-like protein, and putative inner membrane
           protein (spcT) genes, complete cds; and unknown genes.
          Length = 556

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = -2

Query: 330 HQMGSCRM-GVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           H  GSCRM GV+    V+NP G    + GL V D S++P+    N   T + +   I++ 
Sbjct: 455 HAAGSCRMSGVNDAHGVLNPDGTVKGIAGLRVADASIMPSDCRANTHFTTVVIGEAIARM 514

Query: 153 VLEFLKT 133
           ++  + T
Sbjct: 515 MMRVVVT 521



>sp|Q11038|YC79_MYCTU Hypothetical GMC-type oxidoreductase
           Rv1279/MT1316/Mb1310.>pir|G70755|G70755 probable choline
           dehydrogenase - Mycobacterium tuberculosis  (strain
           H37RV)>gb:AE000516_21350 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248338_758666
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 5/14.>gb:BX842576_819341 Mycobacterium
           tuberculosis H37Rv complete genome; segment 5/13.
          Length = 528

 Score = 41.2 bits (95), Expect = 0.022
 Identities = 21/41 (51%), Positives = 29/41 (70%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL 208
           H MG+CRMG D +ASVV+P+     V+GL V D SV+P+ +
Sbjct: 468 HPMGTCRMGSD-EASVVDPQLRVRGVDGLRVADASVMPSTV 507



>gb:BA000012_669692 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 479

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = -2

Query: 339 ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           A  H MG  RMG+D   SVV+   +   ++ L+VG  SV  T+   NP  TI +++
Sbjct: 411 AGHHHMGGTRMGIDMTRSVVDANCKVHGMDNLYVGGSSVFCTSGQANPTTTITALA 466



>gb:AF234246_1779532 Aspergillus niger glucose oxidase (GO2) gene,
           complete cds.
          Length = 605

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 21/68 (30%), Positives = 36/68 (52%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           + + + H +G+C M      SVV+     + V GL V DGS+ PT +  + M    +++ 
Sbjct: 532 HFRPNYHDVGTCSMMPKEMGSVVDNAARVYGVRGLRVIDGSIPPTQMSSHVMTVFYAMAL 591

Query: 168 CISQSVLE 145
            IS ++LE
Sbjct: 592 KISDAILE 599



>gb:BX571966_794226 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_868491
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 537

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 22/60 (36%), Positives = 33/60 (55%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  GS  MG DP+ SVV+    T++   LFV   + +PT   VN  +TI +++  IS  +
Sbjct: 474 HITGSTIMGADPRDSVVDKDCRTFDHPNLFVSSSATMPTVGTVNVTLTIAALALRISDQL 533



>gb:BA000030_699508 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 514

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKA-SVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM 181
           H  G+CRMG D    +V++P+     V G+ V D S+ PT   +NPM+T++
Sbjct: 444 HPAGTCRMGADDDPLAVLDPQLRVRGVSGVRVVDASLFPTMPTINPMLTVL 494



>pir|F95901|F95901 probable GMC oxidoreductase protein SMb20496
           [imported] - Sinorhizobium meliloti (strain 1021)
           magaplasmid pSymB>gb:RME591985_165126 Sinorhizobium
           meliloti 1021 complete pSymB.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.037
 Identities = 19/61 (31%), Positives = 38/61 (62%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H +G+C+MG DP A VV+P  +   ++GL V D S++P+ +  N    ++ ++   ++++
Sbjct: 475 HPVGTCKMGTDPMA-VVDPSLKVHGLDGLRVVDASIMPSIVSGNTNSPVIMIAEKAAEAI 533

Query: 150 L 148
           L
Sbjct: 534 L 534



>gb:AB022907_1194080 Apis mellifera mRNA for glucose oxidase,
           complete cds.
          Length = 615

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMG--VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV 175
           N +A  HQ G+ +MG   DP A VV+P+ +   + GL V D SV P  +  NP+ ++  V
Sbjct: 538 NTRAENHQTGTAKMGPSYDPMA-VVSPRLKVHGIRGLRVADASVQPQVISGNPVASVNMV 596



>gb:BA000012_668452 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 535

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 25/61 (40%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -2

Query: 375 SSQSLRKHPNLKASA--HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           S   L  H   +A    H  G+C+MGVD  A VV+P+     +E L V D SV+PT +G 
Sbjct: 456 SDADLMSHIRARADTIYHPAGTCKMGVDELA-VVDPQLRVHGLEALRVVDASVMPTLIGG 514

Query: 201 N 199
           N
Sbjct: 515 N 515



>gb:AY281353_605926 Uncultured Acidobacteria bacterium clone 32d1
           genomic sequence.
          Length = 530

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 24/77 (31%), Positives = 36/77 (46%)
 Frame = -2

Query: 402 EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV 223
           +F R  +E +++ L    +     H  G CRMG D   SV +  G T + + LFV     
Sbjct: 443 QFNRLARENNARILSTSESNYLD-HPAGGCRMGTDASTSVCDSFGRTHDHQNLFVVGAPT 501

Query: 222 LPTALGVNPMVTIMSVS 172
           LPT    N  +T  +V+
Sbjct: 502 LPTGGCTNGTLTFAAVT 518



>gb:SME591793_187315 Sinorhizobium meliloti 1021 complete
           chromosome; segment 12/12.
          Length = 502

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 18/66 (27%), Positives = 37/66 (56%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           +  +HQ G+ R+G DP  + ++     ++   LFV D   LPT+  VNP +T+ + +  +
Sbjct: 432 RTPSHQCGTVRIGNDPGQAPLDVYCRAFDHPNLFVVDAGFLPTSAAVNPALTVAAQALRV 491

Query: 162 SQSVLE 145
           +  +++
Sbjct: 492 ADHIVK 497



>pir|AE3235|AE3235 oxidoreductase, GMC family Atu6063 [imported] -
           Agrobacterium tumefaciens (strain C58, Dupont) plasmid
           Ti>gb:AE007933_231663 Agrobacterium tumefaciens str. C58
           plasmid Ti, section 11 of 20 of the complete
           sequence.>gb:AE009425_251783 Agrobacterium tumefaciens
           str. C58 Ti plasmid, section 8 of 21 of the complete
           sequence.>gb:AE007871_1084252 Agrobacterium tumefaciens
           str. C58 plasmid Ti, complete
           genome.>gb:AE008690_1089626 Agrobacterium tumefaciens
           str. C58 Ti plasmid, complete sequence.
          Length = 541

 Score = 40.0 bits (92), Expect = 0.049
 Identities = 21/41 (51%), Positives = 28/41 (68%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT 214
           S H +G+C+MG D  ASVV+P+     V+GL V D SV+PT
Sbjct: 475 SYHPIGTCKMGTD-SASVVDPRLRVIGVDGLRVVDASVMPT 514



>gb:AF081574_1766555 Pycnoporus cinnabarinus cellobiose
           dehydrogenase (cdh) gene, cdh-1 allele, complete cds.
          Length = 769

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 26/101 (25%), Positives = 48/101 (47%)
 Frame = -2

Query: 450 NHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPK 271
           N+  GLTL   D + +  E++V           P    S H +G+ ++G  P  +VV+  
Sbjct: 671 NNVPGLTLITPDHT-QTLEQYVAAYD-------PATMCSNHWVGAAKIGSSPSTAVVDEN 722

Query: 270 GETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVL 148
            + +  + LF+ D S++P+    NP   +MS +   +  +L
Sbjct: 723 TKVFNTDNLFIVDASIIPSLPVGNPHGALMSAAEQAAAKIL 763



>gb:AE008692_240525 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 528

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 25/94 (26%), Positives = 45/94 (47%)
 Frame = -2

Query: 432 TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV 253
           T   KD    ++ R     +   + +    +   H MGS  MG +P  SVVN +  +++ 
Sbjct: 431 TEAAKDIIMRDYRRIAAGMNGSIVNEVSEWQNHDHIMGSVIMGKNPADSVVNGECRSFDH 490

Query: 252 EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
             LF+    V+P A  VNP +T ++++  I+  +
Sbjct: 491 HNLFLATTGVIPAAGVVNPTLTGVALAIRIADII 524



>gb:SCO939121_178453 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 602

 Score = 39.7 bits (91), Expect = 0.064
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           +AH +G C +G   +  V++P    +   G+ V DG+ +   LGVNP +TI
Sbjct: 490 TAHFLGGCPIGASRETGVIDPYHRLYGHPGISVVDGAAVSANLGVNPSLTI 540



>gb:CP000009_864075 Gluconobacter oxydans 621H, complete genome.
          Length = 445

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 28/102 (27%), Positives = 43/102 (42%)
 Frame = -2

Query: 456 GCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVN 277
           GC H  GL           F+  +        +  P      H  GS  MGVDPK SVV+
Sbjct: 348 GCEHTRGL-----------FKNLIGLMHGTDEQWTPGYFPQDHPSGSTIMGVDPKDSVVD 396

Query: 276 PKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
               T + E LF+   SV  T    N  +T+ +++  ++ ++
Sbjct: 397 GHCRTHDHENLFIASSSVFSTVGTGNITLTVAALALRVADTL 438



>gb:AP006618_559008 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 523

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 20/38 (52%), Positives = 25/38 (65%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           H +G+CRMG DP  SVV+P+     V GL V D SV+P
Sbjct: 462 HPVGTCRMGTDP-VSVVDPQLRVRGVAGLRVADASVMP 498



>gb:AE017163_395264 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 3 of 6 of the complete
           genome.>gb:AE017126_1030933 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 546

 Score = 39.3 bits (90), Expect = 0.083
 Identities = 22/76 (28%), Positives = 40/76 (52%), Gaps = 3/76 (3%)
 Frame = -2

Query: 390 FVKEESSQSLRKH---PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL 220
           F+KE S ++L      P      H++G   MG   + SV++     W+ + + V DGS  
Sbjct: 459 FLKEISQKALALQDSPPPPGYYVHEVGGAPMGTRQENSVLDKWNRLWQCKNILVVDGSCW 518

Query: 219 PTALGVNPMVTIMSVS 172
           PT+   +P +T+M+++
Sbjct: 519 PTSSWQSPTLTMMAIT 534



>gb:AE014298_1125671 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003497_1212680 Drosophila melanogaster
           chromosome X, section 49 of 74 of the complete
           sequence.>gb:AY122229_1301591 Drosophila melanogaster
           RE28171 full insert cDNA.
          Length = 613

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -2

Query: 330 HQMGSCRMGVD-PKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           H  G+CRMG      +VV+P+   + V G+ V D S++PT +  NP   ++++    S  
Sbjct: 540 HPAGTCRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDL 599

Query: 153 VLE 145
           + E
Sbjct: 600 IKE 602



>gb:AE014298_1125670 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003497_1212679 Drosophila melanogaster
           chromosome X, section 49 of 74 of the complete sequence.
          Length = 865

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = -2

Query: 330 HQMGSCRMGVD-PKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           H  G+CRMG      +VV+P+   + V G+ V D S++PT +  NP   ++++    S  
Sbjct: 792 HPAGTCRMGPSWDVTAVVDPRLRVYGVSGVRVVDASIMPTIVNGNPNAPVIAIGEKASDL 851

Query: 153 VLE 145
           + E
Sbjct: 852 IKE 854



>gb:BA000040_736145 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 540

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+C+MG D  A VV+P+ +   VE + V D S++PT +G N
Sbjct: 475 HPVGTCKMGTDAMA-VVDPQLKVHGVEAMRVVDASIMPTLIGGN 517



>gb:BA000030_704833 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 516

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASV-VNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV 175
           H   + +MG D  AS  ++ +     VEGL V DGSV+P  + VNP +T M +
Sbjct: 452 HPSCTVKMGADDDASAPLDARLRVKGVEGLRVADGSVMPELISVNPCITTMMI 504



>gb:AP006618_559181 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 514

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           HQ+G+CRMG D  A+VV+P+     V+GL V D S++P
Sbjct: 442 HQVGTCRMGAD-DAAVVDPRLRVRGVDGLRVVDASIMP 478



>gb:SME591792_186995 Sinorhizobium meliloti 1021 complete
           chromosome; segment 11/12.
          Length = 531

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 19/44 (43%), Positives = 27/44 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMG DP  SVV+P+     + GL + D S++PT    N
Sbjct: 468 HPVGTCRMGSDPD-SVVDPELRLRGIAGLRIADASIMPTITSGN 510



>pir|D70641|D70641 hypothetical protein Rv0697 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_20724
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248336_758073 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           3/14.>gb:BX842574_818748 Mycobacterium tuberculosis
           H37Rv complete genome; segment 3/13.
          Length = 479

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = -2

Query: 336 SAHQMGSCRMGVD--PKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           S H  GS  MG D  P+A VV+P+     +E L+V DGSVLP+     P  TI+ + +  
Sbjct: 416 SQHLCGSAPMGTDDDPRA-VVDPRCRVRGIENLWVIDGSVLPSITSRGPHATIVMLGHRA 474

Query: 162 SQSV 151
           ++ V
Sbjct: 475 AEFV 478



>sp|P13006|GOX_ASPNG Glucose oxidase precursor (EC 1.1.3.4) (Glucose
           oxyhydrase) (GOD) (Beta-D-glucose:oxygen
           1-oxido-reductase).>pir|A35459|A35459 glucose oxidase
           (EC 1.1.3.4) precursor [validated] - Aspergillus
           niger>gb:AX069381_1460550 Sequence 45 from Patent
           WO0102600.>gb:ASNGLUOA_1542212 A.niger glucose oxidase
           mRNA, complete cds.>gb:ANGOX_1819420 Aspergillus niger
           gox gene for glucose oxidase (EC
           1.1.3.4).>gb:EVE305345_2152485 Expression vector
           pEUKA4-gox1.
          Length = 605

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 20/68 (29%), Positives = 36/68 (52%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           + + + H +G+C M       VV+     + V+GL V DGS+ PT +  + M    +++ 
Sbjct: 532 HFRPNYHGVGTCSMMPKEMGGVVDNAARVYGVQGLRVIDGSIPPTQMSSHVMTVFYAMAL 591

Query: 168 CISQSVLE 145
            IS ++LE
Sbjct: 592 KISDAILE 599



>gb:AF029668_1762416 Trametes versicolor cellobiose dehydrogenase
           (cdh) gene, complete cds.
          Length = 768

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H +G+ +MG     +VV+   + +  + LF+ D S++P+    NP   +MS +
Sbjct: 695 PATMCSNHWVGAAKMGTSSSTAVVDENAKVFNTDNLFIVDASIIPSLPIGNPQGVLMSAA 754



>gb:AY187939_1588174 Trametes versicolor cellobiose dehydrogenase
           (cdh) mRNA, complete cds.
          Length = 768

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H +G+ +MG     +VV+   + +  + LF+ D S++P+    NP   +MS +
Sbjct: 695 PATMCSNHWVGAAKMGTSSSTAVVDENAKVFNTDNLFIVDASIIPSLPIGNPQGVLMSAA 754



>gb:AB043883_1520027 Tricholoma matsutake P2O mRNA for pyranose
           2-oxidase, complete cds.
          Length = 564

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 18/64 (28%), Positives = 34/64 (53%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  G+ R+G D + SV +P  +    + L+VG    +P A   NP  T ++ +   +++V
Sbjct: 498 HITGTTRIGTDDQTSVADPTSKVHNFDNLWVGGNGCIPDATACNPTRTSVAYALKGAEAV 557

Query: 150 LEFL 139
           + +L
Sbjct: 558 VSYL 561



>gb:BA000012_667981 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 538

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H + +CRMG DP  + V+P+ +   +EGL V D S+ P  +  N     +   +  ++ V
Sbjct: 474 HPVSTCRMGPDPTRAAVDPRLKVHGLEGLRVIDASIFPDNITGNTNAASVMTGWKGAELV 533

Query: 150 LE 145
           LE
Sbjct: 534 LE 535



>gb:AE017242_414863 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 16 of 16 of the complete
           genome.>gb:AE016958_1058267 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 479

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 2/64 (3%)
 Frame = -2

Query: 336 SAHQMGSCRMGVD--PKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           S H  G+  MGVD  P+A VV+P+     ++ L+V DGSVLP      P  TI+ + +  
Sbjct: 416 SQHLCGTAPMGVDGDPRA-VVDPRCRVRGIDNLWVIDGSVLPAITSRGPHATIVMIGHRA 474

Query: 162 SQSV 151
           ++ V
Sbjct: 475 AEFV 478



>gb:SSP277295_190764 Sphingomonas sp. LB126 fluorene and
           protocatechuic acid degradation operon and insertion
           sequence ISSsp126.
          Length = 533

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 20/61 (32%), Positives = 32/61 (52%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H +G+C MG D  A VV+P+     ++GL V D S++P  +G N     + +    S  +
Sbjct: 470 HPVGTCTMGTDAHA-VVDPQLRVRGIDGLRVADASIMPFLVGANTNAAAVMIGEKASDLI 528

Query: 150 L 148
           L
Sbjct: 529 L 529



>gb:RMU39940_166497 Sinorhizobium meliloti bet operon, complete
           sequence.
          Length = 548

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGV-DPKASVVNPKGETWEVEGLFVGDGSVLP 217
           EE    LR+H  L+++ H  G+C+MG  D   +VV+P+     V+GL V D S+ P
Sbjct: 449 EEIDGFLREH--LESAYHPCGTCKMGAKDDPMAVVDPETRVIGVDGLRVADSSIFP 502



>gb:ECU73857_134514 Escherichia coli chromosome minutes 6-8.
          Length = 528

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E+  + +R H   + + H  G+C+MG D + SVV+ +G    +EGL V D S++P  +  
Sbjct: 430 EQLDEFVRNHA--ETAFHPCGTCKMGYD-EMSVVDGEGRVHGLEGLRVVDASIMPQIITG 486

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + +   I+  +
Sbjct: 487 NLNATTIMIGEKIADMI 503



>pir|AG3424|AG3424 choline dehydrogenase (EC 1.1.99.1) [imported] -
           Brucella melitensis (strain 16M)>gb:AE009575_253299
           Brucella melitensis 16M chromosome I, section 132 of 195
           of the complete sequence.>gb:AE008917_979211 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 137

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           +E    +R+H  ++++ H  G+C+MG VD   +VV+P+     VEGL V D S+ P
Sbjct: 38  DEIDNFIREH--VESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFP 91



>pir|JC6564|JC6564 cellobiose oxidase (EC 1.1.3.25) precursor -
           white-rot fungus (Trametes versicolor)
          Length = 768

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H +G+ +MG     +VV+   + +  + LF+ D S++P+    NP   +MS +
Sbjct: 695 PATMCSNHWVGAAKMGTSSSTAVVDENAKVFNTDNLFIVDASIIPSLPIGNPQGVLMSAA 754



>sp|P54223|BETA_RHIME Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>gb:SME591785_184965 Sinorhizobium meliloti 1021
           complete chromosome; segment 4/12.
          Length = 549

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGV-DPKASVVNPKGETWEVEGLFVGDGSVLP 217
           EE    LR+H  L+++ H  G+C+MG  D   +VV+P+     V+GL V D S+ P
Sbjct: 450 EEIDGFLREH--LESAYHPCGTCKMGAKDDPMAVVDPETRVIGVDGLRVADSSIFP 503



>sp|P17444|BETA_ECOLI Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>pir|S15182|S10901 choline dehydrogenase (EC
           1.1.99.1) betA - Escherichia coli  (strain
           K-12)>gb:ECBET_125129 Escherichia coli betT, betI, betB
           and betA genes.>gb:ECOBETA_128177 E.coli choline
           dehydrogenase (betA) gene, complete
           cds.>gb:U00096_199409 Escherichia coli K-12 MG1655
           complete genome.
          Length = 556

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E+  + +R H   + + H  G+C+MG D + SVV+ +G    +EGL V D S++P  +  
Sbjct: 458 EQLDEFVRNHA--ETAFHPCGTCKMGYD-EMSVVDGEGRVHGLEGLRVVDASIMPQIITG 514

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + +   I+  +
Sbjct: 515 NLNATTIMIGEKIADMI 531



>sp|Q8G1Z8|BETA_BRUSU Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>gb:AE014291_307996 Brucella suis 1330 chromosome
           I, complete sequence.
          Length = 549

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           +E    +R+H  ++++ H  G+C+MG VD   +VV+P+     VEGL V D S+ P
Sbjct: 450 DEIDNFIREH--VESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFP 503



>sp|Q8YFY2|BETA_BRUME Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).
          Length = 549

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 1/56 (1%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           +E    +R+H  ++++ H  G+C+MG VD   +VV+P+     VEGL V D S+ P
Sbjct: 450 DEIDNFIREH--VESAFHPCGTCKMGAVDDPMAVVDPECRVIGVEGLRVADSSIFP 503



>gb:AY803992_1628629 Aspergillus niger glucose oxidase gene, partial
           cds.
          Length = 581

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 20/67 (29%), Positives = 35/67 (52%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           N + + H +G+C M       VV+     + V+GL V DGS+ PT +  + M    +++ 
Sbjct: 508 NFRPNYHGVGTCSMMPKEMGGVVDNAARVYGVQGLRVIDGSIPPTQMSSHVMTVFYAMAL 567

Query: 168 CISQSVL 148
            I+ +VL
Sbjct: 568 KIADAVL 574



>gb:AB119106_1527912 Lyophyllum shimeji lsp2o mRNA for pyranose
           oxidase, complete cds.
          Length = 618

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 18/65 (27%), Positives = 31/65 (47%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  G+ R+G D   +V +     W+   L+V     + T  G NP +T M  +   ++S+
Sbjct: 540 HLAGTTRIGFDKATTVADNNSLVWDFANLYVAGNGTIRTGFGENPTLTSMCHAIKSARSI 599

Query: 150 LEFLK 136
           +  LK
Sbjct: 600 INTLK 604



>gb:AB083245_1524169 Grifola frondosa cdh mRNA for cellobiose
           dehydrogenase, complete cds.
          Length = 768

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H +GS +MG +   +VV+   + +    LFV D S++P     NP   +MS +
Sbjct: 695 PGTMCSNHWVGSNKMGTNSSTAVVDENAKVFNTNNLFVVDASIIPALPVGNPHGMLMSAA 754



>gb:AY684148_640186 Gluconobacter oxydans gluconate-2-dehydrogenase
           subunit (ga2DH) gene, complete cds.>gb:CP000009_863236
           Gluconobacter oxydans 621H, complete genome.
          Length = 592

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 16/56 (28%), Positives = 30/56 (53%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           + H  G   MG +P+ S +N   ++W+V  +FV   +  P  +G NP   + +++Y
Sbjct: 517 TTHLGGGAIMGDNPQTSALNRYLQSWDVSNVFVIGSNAFPQGMGYNPTGMVAALAY 572



>gb:AB070949_9362 Streptomyces avermitilis polyene macrolide
           biosynthetic gene cluster.>gb:BA000030_698292
           Streptomyces avermitilis MA-4680 genomic DNA, complete
           genome.
          Length = 547

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G C +G        +  G     + L+V DGS++P ++GVNP VTI +++
Sbjct: 485 HPLGGCVLG-----KATDDYGRVTGYKNLYVTDGSLIPGSIGVNPFVTIAALA 532



>pir|E87576|E87576 choline dehydrogenase [imported] - Caulobacter
           crescentus>gb:AE005932_213772 Caulobacter crescentus
           CB15 section 258 of 359 of the complete
           genome.>gb:AE005673_923671 Caulobacter crescentus CB15
           complete genome.
          Length = 555

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 2/46 (4%)
 Frame = -2

Query: 330 HQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMGV  DP A VV+ +     V+GL V D SV+PT +G N
Sbjct: 472 HPVGTCRMGVAGDPMA-VVDDQLRVQGVQGLRVIDASVMPTLIGGN 516



>pir|C97460|C97460 choline dehydrogenase (chd) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008016_232576 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 74 of 254 of the
           complete sequence.>gb:AE007869_1082245 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 583

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLP 217
           E+    LR+H  L+++ H  G+CRMG   DP A VV+P+     VEGL V D S+ P
Sbjct: 484 EQIDAFLREH--LESAYHPCGTCRMGDRNDPMA-VVDPECRVIGVEGLRVADSSIFP 537



>sp|Q8UH55|BETA_AGRT5 Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>pir|AF2678|AF2678 choline dehydrogenase betA
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009050_247871 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 76 of 256 of the
           complete sequence.>gb:AE008688_1085714 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 549

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 2/57 (3%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLP 217
           E+    LR+H  L+++ H  G+CRMG   DP A VV+P+     VEGL V D S+ P
Sbjct: 450 EQIDAFLREH--LESAYHPCGTCRMGDRNDPMA-VVDPECRVIGVEGLRVADSSIFP 503



>gb:NCB10H4_1688915 Neurospora crassa DNA linkage group V BAC contig
           B10H4.
          Length = 1365

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 14/80 (17%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDP--KASVVNPKGETWEV------EGLFVGDGSVLPTALGVNPM 193
           N + + H +G   M  D   +  V N  GE +        +GL V D +V+PTALG NP 
Sbjct: 615 NQQITVHPIGGACMARDNTGRTGVTNHVGEVFTGLGSETHDGLIVTDAAVIPTALGTNPF 674

Query: 192 VTIMSV------SYCISQSV 151
            TI ++      +YC  Q +
Sbjct: 675 ATIAALAERSVEAYCQRQGL 694



>gb:BX640444_815102 Bordetella bronchiseptica strain RB50, complete
           genome; segment 8/16.
          Length = 545

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 21/44 (47%), Positives = 27/44 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H  GSCRMG DP ASVV+P+     V+ L + D SV+P  +  N
Sbjct: 478 HASGSCRMGGDP-ASVVDPELRVRGVDRLRLIDASVMPAMVSAN 520



>gb:BX572603_802957 Rhodopseudomonas palustris CGA009 complete
           genome; segment 11/16.
          Length = 582

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 18/57 (31%), Positives = 32/57 (56%)
 Frame = -2

Query: 333 AHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           AH MG+ RM    ++ VV+ + +   V  L++   S+ PT+   NP  T+M V++ +
Sbjct: 517 AHSMGTTRMSASARSGVVDEQCQVHGVRDLYIAGSSIFPTSGHANP--TLMIVAFAV 571



>gb:BA000037_723121 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 546

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = -2

Query: 330 HQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV-TIMSVSYCIS 160
           H +G+C+MGV  DP A VV+ +     + GL V D S++PT +G N    TIM     I+
Sbjct: 468 HPVGTCKMGVASDPLA-VVDHQLRVHGLAGLRVVDASIMPTLIGANTNAPTIM-----IA 521

Query: 159 QSVLEFLKTH 130
           + + + +K H
Sbjct: 522 EKIADAIKAH 531



>gb:AE016804_336787 Vibrio vulnificus CMCP6 chromosome I section 8
           of 11 of the complete sequence.>gb:AE016795_1046511
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 497

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 3/70 (4%)
 Frame = -2

Query: 330 HQMGSCRMGV--DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV-TIMSVSYCIS 160
           H +G+C+MGV  DP A VV+ +     + GL V D S++PT +G N    TIM     I+
Sbjct: 419 HPVGTCKMGVASDPLA-VVDHQLRVHGLAGLRVVDASIMPTLIGANTNAPTIM-----IA 472

Query: 159 QSVLEFLKTH 130
           + + + +K H
Sbjct: 473 EKIADAIKAH 482



>gb:AE016756_324481 Escherichia coli CFT073 section 2 of 18 of the
           complete genome.>gb:AE014075_955065 Escherichia coli
           CFT073 complete genome.
          Length = 571

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E+  + +R H   + + H  G+C+MG D  A VV+ +G    +EGL V D S++P  +  
Sbjct: 473 EQLDEFVRNHA--ETAFHPCGTCKMGYDEMA-VVDGEGRVHGLEGLRVVDASIMPQIITG 529

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + +   I+  +
Sbjct: 530 NLNATTIMIGEKIADMI 546



>gb:AE008692_241023 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 545

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 25/94 (26%), Positives = 42/94 (44%)
 Frame = -2

Query: 432 TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV 253
           T++  D SR+ F   +        R  P      H  GS  MG DPK SVV+    T + 
Sbjct: 445 TVRSCDHSRKVFREIMGLMKGSDPRWTPGYFPQDHPAGSTIMGHDPKDSVVDGYNRTHDH 504

Query: 252 EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           E LF+    V  +    N  +T+ +++  ++ ++
Sbjct: 505 ENLFIASSGVFASMGTGNITLTVAALALRVADTL 538



>sp|Q8FKI9|BETA_ECOL6 Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).
          Length = 556

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 23/77 (29%), Positives = 40/77 (51%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E+  + +R H   + + H  G+C+MG D  A VV+ +G    +EGL V D S++P  +  
Sbjct: 458 EQLDEFVRNHA--ETAFHPCGTCKMGYDEMA-VVDGEGRVHGLEGLRVVDASIMPQIITG 514

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + +   I+  +
Sbjct: 515 NLNATTIMIGEKIADMI 531



>sp|Q8X6C6|BETA_ECO57 Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>pir|A85524|A85524 choline dehydrogenase, a
           flavoprotein [imported] - Escherichia coli (strain
           O157:H7, substrain EDL933)>pir|E90673|E90673 choline
           dehydrogenase [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>gb:AE005174_64586
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:BA000007_658369 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 562

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           E+  + +R H   + + H  G+C+MG D + SVV+ +G    +EGL V D S++P  +  
Sbjct: 458 EQLDEFVRNHA--ETAFHPCGTCKMGYD-EMSVVDGEGRVHGLEGLRVVDASIMPQIITG 514

Query: 201 NPMVTIMSV 175
           N   T + +
Sbjct: 515 NLNATTIMI 523



>gb:AF535193_1809621 Peniophora sp. SG pyranose oxidase mRNA,
           complete cds.
          Length = 623

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D K     VN     +  + LF+G    +PTA G NP +T MS++
Sbjct: 548 HLGGTHRMGFDEKEDNCCVNTDSRVFGFKNLFLGGCGNIPTAYGANPTLTAMSLA 602



>gb:AY291124_1595616 Trametes ochracea strain MB49 pyranose oxidase
           (p2o) mRNA, complete cds.
          Length = 623

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D K     VN     +  + LF+G    +PTA G NP +T MS++
Sbjct: 548 HLGGTHRMGFDEKEDNCCVNTDSRVFGFKNLFLGGCGNIPTAYGANPTLTAMSLA 602



>gb:BX936398_835840 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 567

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 25/87 (28%), Positives = 45/87 (51%)
 Frame = -2

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD 232
           S +E + F++E +  +   HP+         SC+MG D K +VV+ +G    V+GL V D
Sbjct: 456 SDDELDAFIREHAETAY--HPSC--------SCKMG-DDKMAVVDGQGRVHGVQGLRVVD 504

Query: 231 GSVLPTALGVNPMVTIMSVSYCISQSV 151
            S++P  +  N   T + ++  I+  +
Sbjct: 505 ASIMPQIITGNLNATTIMIAEKIADRI 531



>gb:BX640440_813721 Bordetella bronchiseptica strain RB50, complete
           genome; segment 4/16.
          Length = 536

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 20/53 (37%), Positives = 30/53 (56%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G+CRMG D   SVV+P      ++GL V D SV P  +  N  +  ++V+
Sbjct: 475 HPLGTCRMGTDGM-SVVDPAFRVHGLQGLRVADASVAPFQVSSNTNIPTIAVA 526



>gb:AY754342_645249 Pseudomonas sp. 3Y2 type II PHA synthase operon
           1, partial sequence.
          Length = 168

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKA-SVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +GSCRMG D    +VV+ +     VEGL + D S++PT  G N
Sbjct: 101 HPVGSCRMGPDSDPLAVVDARLRVRGVEGLRIADASIMPTIPGGN 145



>gb:AE017340_457133 Idiomarina loihiensis L2TR, complete genome.
          Length = 508

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 9/161 (5%)
 Frame = -2

Query: 627 RYARTAHIFALARDKGSGEAFSPTS------VTYDL--DKTDEENLQRGLEKLLRILAAA 472
           ++  T H+  L  +       +P        +TY    +K+D++ L  G+ K L IL   
Sbjct: 348 KHGFTCHVCLLRPESRGAVHLNPEDPMAKPQITYGFLSEKSDQKALLNGIRKALEILKQP 407

Query: 471 GAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGV-DP 295
              +    H  G+       S  E    +K  S   L  HP         G+C+MG  + 
Sbjct: 408 ALAK----HNGGIMFPNPCLSDAELLEQIK--SKTGLIYHP--------AGTCKMGPKND 453

Query: 294 KASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
             +VV+P+ +   VE L V D S++PT +  N     ++++
Sbjct: 454 TGAVVDPELKVIGVEKLRVIDASIMPTVISGNTNAPTIAIA 494



>gb:SSU13981_191079 Streptomyces A19249 cholesterol oxidase (choM)
           gene, complete cds.>gb:AX069371_1460546 Sequence 35 from
           Patent WO0102600.
          Length = 547

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G C +G        +  G     + L+V DGS++P ++GVNP VTI +++
Sbjct: 485 HPLGGCVLG-----KATDNYGRVSGYKNLYVTDGSLIPGSIGVNPFVTITALA 532



>gb:D86622_120854 Gluconobacter oxydans DNA for L-sorbosone
           dehydrogenase, L-sorbose dehydrogenase, complete cds.
          Length = 531

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           + S H   +C+MG D   SVV+P+ +   +EG+ + D SV+P+ LG N     + +S
Sbjct: 465 RTSYHPTCTCKMGRDDM-SVVDPRLKVHGLEGIRICDSSVMPSLLGSNTNAATIMIS 520



>gb:CP000031_85137 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 552

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 27/89 (30%), Positives = 40/89 (44%), Gaps = 1/89 (1%)
 Frame = -2

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVG 235
           S EE   F+ E +          +++ H  GSCRMG    + +VV+ +G    VEGL V 
Sbjct: 451 SDEELNAFIAEHA----------ESAYHPCGSCRMGRASDRNAVVDGQGRVIGVEGLRVA 500

Query: 234 DGSVLPTALGVNPMVTIMSVSYCISQSVL 148
           D S+ P     N     + V   +S  +L
Sbjct: 501 DSSIFPQITNGNLNAPSIMVGEKMSDHIL 529



>gb:AB164642_16027 Streptomyces kanamyceticus kanamycin biosynthetic
           gene cluster, complete cds.>gb:AJ582817_525927
           Streptomyces kanamyceticus kanamycin biosynthetic gene
           cluster, strain ATCC12853.
          Length = 508

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 18/53 (33%), Positives = 27/53 (50%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS 178
           S H  G+ R G DP  SV +  G   + + ++  DG+  P A   NP +TI +
Sbjct: 446 STHLHGTLRAGDDPATSVTDRTGRLHDYDNVWSADGATFPFAGNFNPTLTIQA 498



>sp|P12676|CHOD_STRS0 Cholesterol oxidase precursor (EC 1.1.3.6)
           (CHOD).>pir|A32260|A32260 cholesterol oxidase (EC
           1.1.3.6) precursor [validated] - Streptomyces
           sp.>gb:STMCHOPA_192780 Streptomyces sp.
           cytochrome-P450-like protein (choP) gene and cholesterol
           oxidase (choA) gene, complete cds.
          Length = 546

 Score = 37.4 bits (85), Expect = 0.32
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G C +G        +  G     + L+V DGS++P ++GVNP VTI +++
Sbjct: 484 HPLGGCVLG-----KATDDYGRVAGYKNLYVTDGSLIPGSVGVNPFVTITALA 531



>gb:ANI294936_1819465 Aspergillus niger ggox gene for glucose
           oxidase.
          Length = 604

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 23/90 (25%), Positives = 42/90 (46%)
 Frame = -2

Query: 417 DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV 238
           DAS  ++  ++K           N + + H +G+C M       VV+     + V+ L V
Sbjct: 518 DASLSDWAEYIKY----------NFRPNYHGVGTCSMMKKELGGVVDSSARVYGVDSLRV 567

Query: 237 GDGSVLPTALGVNPMVTIMSVSYCISQSVL 148
            DGS+ PT +  + M    +++  IS ++L
Sbjct: 568 IDGSIPPTQVSSHVMTVFYAMALKISAAIL 597



>gb:AX683901_1473091 Sequence 1 from Patent
           WO03008588.>gb:AX683905_1473094 Sequence 5 from Patent
           WO03008588.
          Length = 609

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 10/90 (11%)
 Frame = -2

Query: 438 GLTLKVKDASREEFERFVKEESS--QSLRKHPNLKASAHQMG--------SCRMGVDPKA 289
           G+ L V   SR    ++V++ +   +S+      +A A + G        +C+MG D   
Sbjct: 424 GVRLSVDIFSRPSLSKYVRKVAGFDRSITTRSGFEAYAREYGRTSYHPTCTCKMGRDAM- 482

Query: 288 SVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           SVV+P+     +EG+ + D SV+P+ +G N
Sbjct: 483 SVVDPQLRVHGLEGIRICDSSVMPSIIGSN 512



>gb:BA000040_730657 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 541

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 23/62 (37%), Positives = 34/62 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H   +CRMG D  A VV+ + +   +EGL V DGSV+P  +  N    I+ ++   S  +
Sbjct: 478 HPTSTCRMGNDALA-VVDQRLKVRGLEGLRVVDGSVMPDLVSGNTNAPIIMIAEKASDMI 536

Query: 150 LE 145
           LE
Sbjct: 537 LE 538



>gb:BA000012_666765 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 537

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 18/44 (40%), Positives = 29/44 (65%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+C+MGVD + +VV+P+     V+GL V D S++P  +  N
Sbjct: 463 HPVGTCKMGVD-ETAVVDPELRVRGVDGLRVIDSSIMPVLISGN 505



>gb:AB192961_17317 Gluconobacter frateurii ORF1, sldS, sldL, sldC,
           ORF2 genes for AraC-like transcriptional regulator,
           small, large, cytochrome subunits of sorbitol
           dehydrogenase, transposase-like protein, partial and
           complete cds.
          Length = 545

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = -2

Query: 432 TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV 253
           T+K  D ++E F+  +   S    +         H  GS  MG DP  SVV+ +  T + 
Sbjct: 445 TVKSCDHTKELFKELMALMSGTDPQWTKGYFPQCHPSGSTIMGTDPTNSVVDGECRTHDH 504

Query: 252 EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           E LFV   +V  +    N  +TI +++  ++ S+
Sbjct: 505 ENLFVASSAVFSSVGTGNITLTIAALALRVAASL 538



>gb:AB100375_12850 Pseudomonas putida genes for probable acyl-CoA
           synthetase, probable esterase, probable alcohol
           dehydrogenase, probable aldehyde dehydrogenase, partial
           and complete cds.
          Length = 526

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+C+MG D  A VV+ +     +EGL V D S++PT +G N
Sbjct: 465 HPIGTCKMGQDEMA-VVDSQLRVHGIEGLRVVDASIMPTLVGGN 507



>gb:BX572097_798245 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 551

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H++G   MG     SVV+     W    + V DG+  PT+   +P +T+M+++
Sbjct: 486 HEVGGAAMGESEDCSVVDRWNRLWRCPNVLVVDGACWPTSAWQSPTLTMMAIT 538



>pir|AB2003|AB2003 dehydrogenase chain [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_682565 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 619

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 20/72 (27%), Positives = 38/72 (52%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI 163
           K   H  G+  MG  P  SVV+    +W+ + LF+     +PT    N  +TI ++S+  
Sbjct: 534 KGGNHFSGTHIMGTTPLNSVVDSYLRSWDHKNLFLVGAGSMPTIGSSNTTLTIAALSFRT 593

Query: 162 SQSVLEFLKTHD 127
           ++ +L+ L +++
Sbjct: 594 AEHMLQELNSYN 605



>pir|S72824|S72824 cholesterol oxidase (EC 1.1.3.6) choD -
           Mycobacterium leprae>gb:U00015_198854 Mycobacterium
           leprae cosmid B1620.
          Length = 585

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           N+  +AH +G   +G + +  V++P    +    L+V DG+ +   LGVNP ++I
Sbjct: 480 NIPLTAHFLGGAVIGDNAEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSI 534



>pir|E86957|E86957 probable cholesterol oxidase [imported] -
           Mycobacterium leprae>gb:MLEPRTN2_146189 Mycobacterium
           leprae strain TN complete genome; segment 2/10.
          Length = 569

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           N+  +AH +G   +G + +  V++P    +    L+V DG+ +   LGVNP ++I
Sbjct: 464 NIPLTAHFLGGAVIGDNAEHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSI 518



>sp|Q8ZGW0|BETA_YERPE Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>pir|AC0143|AC0143 choline dehydrogenase (EC
           1.1.99.1) [imported] - Yersinia pestis (strain
           CO92)>gb:AE017130_386822 Yersinia pestis biovar
           Medievalis str. 91001 section 4 of 16 of the complete
           genome.>gb:AJ414146_522999 Yersinia pestis strain CO92
           complete genome; segment 6/20.>gb:AE017042_1143388
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 567

 Score = 36.6 bits (83), Expect = 0.54
 Identities = 23/77 (29%), Positives = 41/77 (53%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           +E    +R+H   + + H   SC+MG D K +VV+ +G    V+GL V D S++P  +  
Sbjct: 458 DELDAFIREHA--ETAYHPSCSCKMG-DDKMAVVDGQGRVHGVQGLRVVDASIMPQIITG 514

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + ++  I+  +
Sbjct: 515 NLNATTIMIAEKIADRI 531



>gb:AY442225_617696 Streptomyces diastaticus polyketide rim gene
           cluster, partial sequence.
          Length = 549

 Score = 36.2 bits (82), Expect = 0.70
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           S H +G C +G        +  G     + L+V DG+++P ++GVNP VTI +++
Sbjct: 485 SYHPLGGCVLG-----KATDLYGRVAGYQNLYVMDGALVPGSIGVNPFVTITALA 534



>gb:AF430844_510073 Burkholderia cepacia glucose dehydrogenase
           (gdhAlpha) gene, complete cds.
          Length = 539

 Score = 36.2 bits (82), Expect = 0.70
 Identities = 19/60 (31%), Positives = 33/60 (55%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  GS  MG D + SVV+    T++   LF+   + +PT   VN  +TI +++  +S ++
Sbjct: 476 HITGSTIMGADARDSVVDKDCRTFDHPNLFISSSATMPTVGTVNVTLTIAALALRMSDTL 535



>gb:AE016781_331379 Pseudomonas putida KT2440 section 8 of 21 of the
           complete genome.>gb:AE015451_946456 Pseudomonas putida
           KT2440 complete genome.
          Length = 550

 Score = 36.2 bits (82), Expect = 0.70
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = -2

Query: 402 EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV 223
           E   ++++E + S+          H +GSC+MG+D  A VV+ + +   ++GL V D S+
Sbjct: 457 EIADYIRQEGASSMM---------HWVGSCKMGIDSMA-VVDERLKVRGLQGLRVVDASI 506

Query: 222 LPTALGVN 199
           +PT    N
Sbjct: 507 MPTITSGN 514



>gb:SME591793_187313 Sinorhizobium meliloti 1021 complete
           chromosome; segment 12/12.
          Length = 551

 Score = 36.2 bits (82), Expect = 0.70
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           N K   H +G+C+MG D  A+VV+ + +   +EGL V D SV+P     N
Sbjct: 460 NAKTDHHPVGTCKMGTD-AAAVVDLELKVRGIEGLRVCDSSVMPRVPSCN 508



>gb:CP000010_866801 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 549

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = -2

Query: 417 DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV 238
           D  R + + +V+  +          K   H  G+CRMG DP  SVV+ +     V GL +
Sbjct: 445 DGGRVDLDAYVRSHA----------KTVYHPSGTCRMGGDPD-SVVDAQLRVRGVGGLRI 493

Query: 237 GDGSVLPTALGVNPMV-TIMSVSYC 166
            D SV+P+ +  N    TIM    C
Sbjct: 494 CDASVMPSLVSGNTNAPTIMIAERC 518



>gb:BX572598_801299 Rhodopseudomonas palustris CGA009 complete
           genome; segment 6/16.
          Length = 534

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+C+MG D  A VV+P+     +  L + D SV+PT +G N
Sbjct: 469 HPVGTCKMGSDATA-VVDPRLNVHGIGALRIVDASVMPTLIGGN 511



>gb:BX571965_789826 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 556

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = -2

Query: 417 DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV 238
           D  R + + +V+  +          K   H  G+CRMG DP  SVV+ +     V GL +
Sbjct: 452 DGGRVDLDAYVRSHA----------KTVYHPSGTCRMGGDPD-SVVDAQLRVRGVGGLRI 500

Query: 237 GDGSVLPTALGVNPMV-TIMSVSYC 166
            D SV+P+ +  N    TIM    C
Sbjct: 501 CDASVMPSLVSGNTNAPTIMIAERC 525



>gb:SNA278573_187721 Streptomyces natalensis pimaricin biosynthetic
           gene cluster.>gb:AX067998_1460469 Sequence 5 from Patent
           WO0077222.
          Length = 549

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 17/53 (32%), Positives = 29/53 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G C +G        +  G       L+V DG+++P ++GVNP VTI +++
Sbjct: 487 HPLGGCVLG-----KATDGYGRVAGYHNLYVTDGALIPGSIGVNPFVTITALA 534



>sp|P79076|PROD_CORVE Pyranose oxidase precursor (EC 1.1.3.10)
           (PROD) (Glucose 2-oxidase).>gb:D73369_1674748 Coriolus
           versicolor mRNA for pyranose oxidase, complete cds.
          Length = 623

 Score = 35.8 bits (81), Expect = 0.92
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D +     VN     +  + LF+G    +PTA G NP +T MS++
Sbjct: 548 HLGGTHRMGFDEQEDKCCVNTDSRVFGFKNLFLGGCGNIPTAYGANPTLTAMSLA 602



>gb:AF286473_2061554 Mus musculus retinitis pigmentosa GTPase
           regulator (Rpgr) gene, partial cds.
          Length = 538

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 23/69 (33%), Positives = 28/69 (40%)
 Frame = -1

Query: 523 GESPERAREAVEDTGGRRGRGDWMQSRHRTNPQGEGCEQGRV*EVCEGREFTESKKTPES 344
           GE      E  E  G   G G+W         +GEG E+G   E  EG E  E ++  E 
Sbjct: 340 GEEEGEGEEEGEGEGEEEGEGEW-----EGEEEGEGEEEGEGEEEGEGEEEGEGEEEGEG 394

Query: 343 ESFGAPDGE 317
           E  G  D E
Sbjct: 395 EEEGGEDDE 403



>gb:AF257654_1781359 Humicola insolens cellobiose dehydrogenase
           mRNA, complete cds.
          Length = 785

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 4/86 (4%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPK----ASVVNPKGETWEVEGLFVGDGSVLPT 214
           EE   SL    + + S H MG+ ++G D       SVV+   + +  + LFV D S+ P 
Sbjct: 700 EEYVDSLLVSASARRSNHWMGTAKLGTDDGRYGGTSVVDLDTKVYGTDNLFVVDASIFPG 759

Query: 213 ALGVNPMVTIMSVSYCISQSVLEFLK 136
               NP   I+  +   ++ +L+  K
Sbjct: 760 MSTGNPSAMIVIAAEQAAERILKLRK 785



>gb:AF012277_1761187 Penicillium amagasakiense glucose oxidase (GOX)
           gene, complete cds.
          Length = 605

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 4/127 (3%)
 Frame = -2

Query: 513 QRGLEKLLRILAAAGAEEIGCNHGTGLTLK----VKDASREEFERFVKEESSQSLRKHPN 346
           Q    KL R L + GA +    +  G TL     V++A+  ++  +V +          N
Sbjct: 486 QAAASKLARDLTSQGAMK---EYFAGETLPGYNLVQNATLSQWSDYVLQ----------N 532

Query: 345 LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYC 166
            + + H + SC M       VV+   + +  +GL V DGS+ PT +  + M     ++  
Sbjct: 533 FRPNWHAVSSCSMMSRELGGVVDATAKVYGTQGLRVIDGSIPPTQVSSHVMTIFYGMALK 592

Query: 165 ISQSVLE 145
           ++ ++L+
Sbjct: 593 VADAILD 599



>gb:AB039821_6351 Gluconobacter oxydans slds, sldl, sldc genes for
           sorbitol dehydrogenase small subunit, solbitol
           dehydrogenase large subunit, sorbitol dehydrogenase
           cytochrome c subunit, complete cds.
          Length = 545

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = -2

Query: 432 TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV 253
           T+K  D ++E F+  +   S    +         H  GS  MG DP  SVV+ +  T + 
Sbjct: 445 TVKSCDHTKELFKELMALMSGTDPQWTKGYFPQCHPSGSTIMGTDPTNSVVDGECRTHDH 504

Query: 252 EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           E LFV   +V  +    N  +TI +++  ++ S+
Sbjct: 505 ENLFVARSAVFSSVGTGNITLTIGALALRVAASL 538



>pir|F83181|F83181 probable GMC-type oxidoreductase PA3710
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004790_57945 Pseudomonas aeruginosa PAO1,
           section 351 of 529 of the complete
           genome.>gb:AE004091_972045 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 557

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H  G+CRMG  P+A VV+ +     + GL + D S++P+    N    ++ ++   +Q +
Sbjct: 472 HPAGTCRMGQGPQA-VVDAQLRVHGIPGLRIADASIMPSLTSGNTCSPVLVIAEKAAQMI 530

Query: 150 L 148
           L
Sbjct: 531 L 531



>sp|Q92452|GOX_TALFL Glucose oxidase precursor (EC 1.1.3.4) (Glucose
           oxyhydrase) (GOD) (Beta-D-glucose:oxygen
           1-oxido-reductase).>gb:TFU56240_1725007 Talaromyces
           flavus secreted glucose oxidase gene, complete cds.
          Length = 605

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 4/127 (3%)
 Frame = -2

Query: 513 QRGLEKLLRILAAAGAEEIGCNHGTGLTLK----VKDASREEFERFVKEESSQSLRKHPN 346
           Q    KL R L + GA +    +  G TL     V++A+  ++  +V +          N
Sbjct: 486 QAAASKLARDLTSQGAMK---EYFAGETLPGYNLVENATLSQWSDYVLQ----------N 532

Query: 345 LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYC 166
            + + H + SC M       VV+   + +  +GL V DGS+ PT +  + M     ++  
Sbjct: 533 FRPNWHAVSSCSMMSRELGGVVDATAKVYGTQGLRVIDGSIPPTQVSSHVMTIFYGMALK 592

Query: 165 ISQSVLE 145
           ++ ++L+
Sbjct: 593 VADAILD 599



>sp|P81156|GOX_PENAG Glucose oxidase (EC 1.1.3.4) (Glucose
           oxyhydrase) (GOD) (Beta-D- glucose:oxygen
           1-oxido-reductase).
          Length = 587

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 4/127 (3%)
 Frame = -2

Query: 513 QRGLEKLLRILAAAGAEEIGCNHGTGLTLK----VKDASREEFERFVKEESSQSLRKHPN 346
           Q    KL R L + GA +    +  G TL     V++A+  ++  +V +          N
Sbjct: 468 QAAASKLARDLTSQGAMK---EYFAGETLPGYNLVQNATLSQWSDYVLQ----------N 514

Query: 345 LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYC 166
            + + H + SC M       VV+   + +  +GL V DGS+ PT +  + M     ++  
Sbjct: 515 FRPNWHAVSSCSMMSRELGGVVDATAKVYGTQGLRVIDGSIPPTQVSSHVMTIFYGMALK 574

Query: 165 ISQSVLE 145
           ++ ++L+
Sbjct: 575 VADAILD 581



>gb:AJ583233_1811339 Penicillium variabile gox gene for glucose
           oxidase.
          Length = 605

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 17/67 (25%), Positives = 33/67 (49%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY 169
           N + + H + SC M       VV+   + +  +GL V DGS+ PT +  + M     ++ 
Sbjct: 532 NFRPNWHAVSSCSMMAKELGGVVDATAKVYGTQGLRVVDGSIPPTQVSSHVMTIFYGMAL 591

Query: 168 CISQSVL 148
            ++ ++L
Sbjct: 592 KVADAIL 598



>gb:AY522922_1611390 Phanerochaete chrysosporium pyranose 2-oxidase
           (pox) mRNA, complete cds.
          Length = 621

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS 154
           H  G+ R G+D + +V N   +      L+VG   V+ T    NP  T+ S+ Y I  S
Sbjct: 553 HLAGTTRCGLDTQKTVGNTHCKVHNFNNLYVGGNGVIETGFAANP--TLTSICYAIRAS 609



>gb:AY370876_1603038 Peniophora gigantea pyranose oxidase (poxB)
           mRNA, complete cds.
          Length = 622

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D KA    V+     +  + LF+G    +PTA   NP +T MS++
Sbjct: 546 HLGGTHRMGFDEKADKCCVDTDSRVFGFKNLFLGGCGNIPTAYAANPTLTAMSLA 600



>gb:BX950851_840488 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 559

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 24/77 (31%), Positives = 40/77 (51%)
 Frame = -2

Query: 381 EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV 202
           EE  + +R H   + + H   SC+MG D   SVV+ +G    +EGL V D S++P  +  
Sbjct: 456 EELDEFIRTHA--ETAFHPSCSCKMGEDDM-SVVDGQGCVHGMEGLRVVDASIMPQIITG 512

Query: 201 NPMVTIMSVSYCISQSV 151
           N   T + ++  I+  +
Sbjct: 513 NLNATTIMIAEKIADRI 529



>gb:BA000030_703954 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 544

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 18/53 (33%), Positives = 29/53 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H +G C +G        +  G       L+V DGS++P ++GVNP VTI +++
Sbjct: 483 HPLGGCVLGKS-----TDNYGRVKGYSKLYVTDGSLVPGSIGVNPFVTITALA 530



>gb:BA000012_668326 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 542

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/42 (47%), Positives = 24/42 (57%)
 Frame = -2

Query: 342 KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP 217
           K   H +G+CRMG D  A VV P      +EGL V D SV+P
Sbjct: 463 KTDHHPVGTCRMGHDEMA-VVTPDLRLRGIEGLRVCDASVMP 503



>gb:AE014292_310507 Brucella suis 1330 chromosome II, complete
           sequence.
          Length = 532

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H +G+CRMG D +A +V+P+     + GL V D S++P     N     + ++   +Q +
Sbjct: 469 HPVGTCRMGQDAEA-IVDPRLRFNGIAGLRVADASIMPAITSGNTNSPTLMIAEKAAQMI 527

Query: 150 L 148
           +
Sbjct: 528 I 528



>gb:CR378681_98769 Photobacterium profundum SS9 chromosome 2;
           segment 7/7.
          Length = 433

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/62 (32%), Positives = 39/62 (62%)
 Frame = -2

Query: 336 SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ 157
           +AHQ GS ++G      VV+   ++ +++GL+V D SV+P A G+ P  T++ ++  +++
Sbjct: 371 AAHQGGSAKIG-----EVVDENLQS-DIQGLYVCDASVIPEAWGLPPTYTLICLAKRLAK 424

Query: 156 SV 151
            V
Sbjct: 425 HV 426



>sp|P59097|PROD_TRAHI Pyranose oxidase precursor (EC 1.1.3.10)
           (PROD) (Glucose 2-oxidase).
          Length = 622

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D KA    V+     +  + LF+G    +PTA   NP +T MS++
Sbjct: 546 HLGGTHRMGFDEKADKCCVDTDSRVFGFKNLFLGGCGNIPTAYAANPTLTAMSLA 600



>sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] (EC
           1.1.99.-).>gb:PPU233397_159565 Pseudomonas putida P1
           alkane degradation genes (alkBFGHJKL and alkST) and
           flanking DNA.
          Length = 552

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMG DP ASVV+P  +   +  + V D S++P  +  N
Sbjct: 469 HPVGTCRMGKDP-ASVVDPCLQVRGLRNIRVVDASIMPNLVAGN 511



>gb:AL646074_548273 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 18/19.
          Length = 544

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = -2

Query: 330 HQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +G+CRMG  D   +VV+ +     +EGL V D SV+PT    N
Sbjct: 469 HPVGTCRMGRADDAGAVVDAQLRVRGIEGLRVVDASVMPTITSGN 513



>gb:REQ242746_162879 Rhodococcus equi corU1, choE, corD1 and corD2
           genes.
          Length = 552

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = -2

Query: 270 GETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           G   E  GL+V DGS++P  +GVNP VTI +++
Sbjct: 507 GRLPEYPGLYVVDGSLVPGNVGVNPFVTITALA 539



>pir|E87366|E87366 oxidoreductase, GMC family CC0945 [imported] -
           Caulobacter crescentus>gb:AE005771_212092 Caulobacter
           crescentus CB15 section 97 of 359 of the complete
           genome.>gb:AE005673_921991 Caulobacter crescentus CB15
           complete genome.
          Length = 555

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           H +GSC+MG  P A VV+ +     VEGL V D S++P  +  N
Sbjct: 487 HPVGSCQMGTGPMA-VVDAQLRVRGVEGLRVVDASIMPRLISGN 529



>sp|Q985M5|BETA_RHILO Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>gb:BA000012_671965 Mesorhizobium loti MAFF303099
           DNA, complete genome.
          Length = 550

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 342 KASAHQMGSCRMG-VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           +++ H  G+C+MG  D   SVV+P+     V+GL V D S+ P     N
Sbjct: 462 ESAYHPCGTCKMGRADDVTSVVDPECRVIGVDGLRVADSSIFPRVTNGN 510



>sp|Q9L4K0|BETA_HALEL Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>gb:HEL238780_136884 Halomonas elongata betI, betB
           and betA genes and partial ORF1.
          Length = 558

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -2

Query: 411 SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD 232
           S EE + FVK+ +          + + H  GSCRMG +   +V + +G    +EGL V D
Sbjct: 458 SDEELDNFVKQHA----------ETAYHPCGSCRMG-EGDMAVTDAQGRVHGLEGLRVVD 506

Query: 231 GSVLP 217
            S+ P
Sbjct: 507 ASLFP 511



>gb:AP003875_1834663 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1119_C05.>gb:AP004565_1841685 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0486F07.
          Length = 292

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 22/68 (32%), Positives = 34/68 (50%)
 Frame = +1

Query: 136 LKKLKYRLGNAIRNRHNGDHWVHP*SRRKNTPISNKQPFHLPCLSLWVHH*SLRINSHSA 315
           L+ +    GNAIR+   GDH V      ++  I++ Q   LP L++ V        +H A
Sbjct: 218 LQGVSNAFGNAIRHGLYGDHGVDAHCGGQHAVIAHIQLLRLPALAMGVDGAVAHRGAHPA 277

Query: 316 APHLVRRS 339
           A H+V R+
Sbjct: 278 ATHVVHRA 285



>gb:PCCELLDEH_1699184 P.chrysosporium mRNA for cellobiose
           dehydrogenase.
          Length = 772

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 18/68 (26%), Positives = 33/68 (48%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H + S  +G  P+++VV+   + +    LF+ D  ++P     NP  T+MS +
Sbjct: 699 PATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAA 758

Query: 171 YCISQSVL 148
              +  +L
Sbjct: 759 EQAAAKIL 766



>gb:AY187232_1588142 Athelia rolfsii cellobiose dehydrogenase (CDH)
           mRNA, CDH-1 allele, complete cds.
          Length = 771

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 29/123 (23%), Positives = 54/123 (43%)
 Frame = -2

Query: 540 LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSL 361
           +D  DE+ L + LE L+  + +            GLT+ + D +      +VK     S+
Sbjct: 653 VDPVDEKVLTQSLEDLVSNMKSV----------PGLTMIMPD-NTTSIADYVKNYDRASM 701

Query: 360 RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM 181
                   S H +GS ++  +    VV+   + +  + LF+ D S++P+    NP   +M
Sbjct: 702 N-------SNHWVGSNKIASNATEGVVDEHTKVFRTDNLFIVDASIIPSLPMGNPQGALM 754

Query: 180 SVS 172
           S +
Sbjct: 755 SAA 757



>gb:BA000012_671308 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 543

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 20/53 (37%), Positives = 30/53 (56%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+CRMG D  ASVV+P+     V+ L V D SV+P  +  N    ++ ++
Sbjct: 475 HPAGTCRMGADA-ASVVDPQLRVRGVDRLRVVDASVMPDLVCGNINAAVIMIA 526



>gb:CP000031_85021 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 534

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%)
 Frame = -2

Query: 363 LRKHPNLKASA-HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT 187
           LR+  N+  +  H +G+C+MG DP A VV P      + GL V D S++P  +  N    
Sbjct: 461 LREAGNIATTIFHPVGTCKMGNDPMA-VVAPDLRVHGLAGLRVVDASIMPKIVSGNTASP 519

Query: 186 IMSVS 172
           ++ ++
Sbjct: 520 VIMIA 524



>pir|S60676|S60676 cellobiose oxidase (EC 1.1.3.25) precursor -
           basidiomycete  (Phanerochaete chrysosporium)
          Length = 770

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 18/68 (26%), Positives = 33/68 (48%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H + S  +G  P+++VV+   + +    LF+ D  ++P     NP  T+MS +
Sbjct: 697 PATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAA 756

Query: 171 YCISQSVL 148
              +  +L
Sbjct: 757 EQAAAKIL 764



>pir|E83133|E83133 probable dehydrogenase PA4100 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004826_58335
           Pseudomonas aeruginosa PAO1, section 387 of 529 of the
           complete genome.>gb:AE004091_972435 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 559

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = -2

Query: 348 NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           NL    H +G+C+MG D + +VV+ +     ++GL V D S++PT +  N
Sbjct: 473 NLGTVFHPVGTCKMGHD-QLAVVDDQLRVHGLQGLRVADASIMPTLITGN 521



>sp|Q01738|CDH_PHACH Cellobiose dehydrogenase precursor (EC
           1.1.99.18) (CDH) (Cellobiose- quinone
           oxidoreductase).>gb:PCU46081_1699457 Phanerochaete
           chrysosporium cellobiose dehydrogenase (CDH) mRNA,
           complete cds.>gb:PCU50409_1699472 Phanerochaete
           chrysosporium cellobiose dehydrogenase (cdh-1) gene,
           complete cds.>gb:PCU65888_1699493 Phanerochaete
           chrysosporium cellobiose dehydrogenase (cdh-2) gene,
           complete cds.
          Length = 773

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 18/68 (26%), Positives = 33/68 (48%)
 Frame = -2

Query: 351 PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           P    S H + S  +G  P+++VV+   + +    LF+ D  ++P     NP  T+MS +
Sbjct: 700 PATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAA 759

Query: 171 YCISQSVL 148
              +  +L
Sbjct: 760 EQAAAKIL 767



>sp|Q9HTJ2|BETA_PSEAE Choline dehydrogenase (EC 1.1.99.1) (CHD)
           (CDH).>pir|B82975|B82975 choline dehydrogenase PA5372
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004949_59604 Pseudomonas aeruginosa PAO1,
           section 510 of 529 of the complete
           genome.>gb:AE004091_973704 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 561

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 23/76 (30%), Positives = 39/76 (51%)
 Frame = -2

Query: 378 ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           E  + +R H   + + H   SC+MG D  A VV+ +G    +EGL V D S++P  +  N
Sbjct: 461 ELDEFIRNHA--ETAFHPSCSCKMGSDDMA-VVDGQGRVHGMEGLRVVDASIMPLIITGN 517

Query: 198 PMVTIMSVSYCISQSV 151
              T + ++  I+  +
Sbjct: 518 LNATTIMMAEKIADRI 533



>gb:BX572601_802232 Rhodopseudomonas palustris CGA009 complete
           genome; segment 9/16.
          Length = 534

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 30/107 (28%), Positives = 44/107 (41%), Gaps = 10/107 (9%)
 Frame = -2

Query: 438 GLTLKVKDASREEFERFVKEE--------SSQSLRKHPNLKASA--HQMGSCRMGVDPKA 289
           GL L    A+ +    F+ EE        S  +L  H   K     H  G+C +G     
Sbjct: 428 GLRLARTIANEQPLADFIVEEYLPGAGATSDDALAAHARQKGQTLFHPAGTCAIG----- 482

Query: 288 SVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVL 148
            V++P+     +EGL V D SV+PT +  N     + +    S  VL
Sbjct: 483 PVLDPQLRVHGIEGLRVADCSVMPTLVSGNTNAPAVMIGEKASDLVL 529



>gb:BX248334_757369 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 1/14.
          Length = 262

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 41/174 (23%), Positives = 67/174 (38%), Gaps = 21/174 (12%)
 Frame = -2

Query: 642 KMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA-AGA 466
           ++R S   R   +   A+   +  A    ++T  +D     ++   L  + R  A  AG 
Sbjct: 50  EIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSAELAGV 109

Query: 465 EEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHP-----------NLKASAHQMG 319
             +   HG GL + ++DA R+   RF ++ S   L  H            N  A A QM 
Sbjct: 110 AAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGAEAIQMQ 169

Query: 318 SCRMGVDPKASVVNPKGETWEVEG---------LFVGDGSVLPTALGVNPMVTI 184
             R+      S+    G T  + G           +GD + +  AL   P+VT+
Sbjct: 170 DQRIIA---MSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTL 220



>gb:AE016785_332555 Pseudomonas putida KT2440 section 12 of 21 of
           the complete genome.>gb:AE015451_947632 Pseudomonas
           putida KT2440 complete genome.
          Length = 488

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = -2

Query: 378 ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN 199
           ++S  LR  P+    AH MG+ RM   P+  VV+   + +  E L+V   S+       N
Sbjct: 405 DTSIPLRMAPH----AHHMGTTRMAASPQFGVVDANCKVFGTENLYVAGSSIFAKGGASN 460

Query: 198 PMVTIM 181
           P + ++
Sbjct: 461 PTMPLL 466



>gb:AE000516_20006 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 262

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 41/174 (23%), Positives = 67/174 (38%), Gaps = 21/174 (12%)
 Frame = -2

Query: 642 KMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA-AGA 466
           ++R S   R   +   A+   +  A    ++T  +D     ++   L  + R  A  AG 
Sbjct: 50  EIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSAKLAGV 109

Query: 465 EEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHP-----------NLKASAHQMG 319
             +   HG GL + ++DA R+   RF ++ S   L  H            N  A A QM 
Sbjct: 110 AAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGAEAIQMQ 169

Query: 318 SCRMGVDPKASVVNPKGETWEVEG---------LFVGDGSVLPTALGVNPMVTI 184
             R+      S+    G T  + G           +GD + +  AL   P+VT+
Sbjct: 170 DQRIIA---MSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTL 220



>pir|B70699|B70699 hypothetical protein Rv0012 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:BX842572_818050
           Mycobacterium tuberculosis H37Rv complete genome;
           segment 1/13.
          Length = 262

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 41/174 (23%), Positives = 67/174 (38%), Gaps = 21/174 (12%)
 Frame = -2

Query: 642 KMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA-AGA 466
           ++R S   R   +   A+   +  A    ++T  +D     ++   L  + R  A  AG 
Sbjct: 50  EIRRSDAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSAKLAGV 109

Query: 465 EEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHP-----------NLKASAHQMG 319
             +   HG GL + ++DA R+   RF ++ S   L  H            N  A A QM 
Sbjct: 110 AAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGAEAIQMQ 169

Query: 318 SCRMGVDPKASVVNPKGETWEVEG---------LFVGDGSVLPTALGVNPMVTI 184
             R+      S+    G T  + G           +GD + +  AL   P+VT+
Sbjct: 170 DQRIIA---MSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTL 220



>pir|E95358|E95358 probable L-sorbose dehydrogenase, FAD-dependent
           (EC 1.1.99.-) [imported] - Sinorhizobium meliloti
           (strain 1021) magaplasmid pSymA>gb:AE007264_224733
           Sinorhizobium meliloti 1021 plasmid pSymA section 70 of
           121 of the complete plasmid
           sequence.>gb:AE006469_1102501 Sinorhizobium meliloti
           1021 plasmid pSymA, complete sequence.
          Length = 531

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 8/65 (12%)
 Frame = -2

Query: 369 QSLRKHPNLKASAHQMG--------SCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT 214
           +S+R   + +A A Q G        +C+MG D   SVV+P+     ++G+ + D SV+P+
Sbjct: 448 ESVRTQADFEAYARQYGRTSYHPTCTCKMGRDDM-SVVDPQLRVHGLDGIRICDSSVMPS 506

Query: 213 ALGVN 199
            +G N
Sbjct: 507 LVGSN 511



>pir|C75453|C75453 GMC oxidoreductase - Deinococcus radiodurans
           (strain R1)>gb:AE001949_41239 Deinococcus radiodurans R1
           section 86 of 229 of the complete chromosome
           1.>gb:AE000513_882134 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 529

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT 214
           H +G+CRMG D  A VV        V+GL++ D SV+PT
Sbjct: 464 HPVGTCRMGHDDFA-VVGDDLRVRGVDGLWIADASVMPT 501



>pir|AB3552|AB3552 alcohol dehydrogenase (acceptor) (EC 1.1.99.-)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009671_254318 Brucella melitensis 16M
           chromosome II, section 33 of 107 of the complete
           sequence.>gb:AE008918_980230 Brucella melitensis 16M
           chromosome II, complete sequence.
          Length = 532

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 18/61 (29%), Positives = 33/61 (54%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV 151
           H +G+CRMG D +A +V+P+     + GL V D S++P     N     + ++   +Q +
Sbjct: 469 HPVGTCRMGQDAEA-IVDPRLRFNGIAGLRVVDASIMPAITSGNTNSPTLMIAEKAAQMI 527

Query: 150 L 148
           +
Sbjct: 528 I 528



>sp|P22637|CHOD_BREST Cholesterol oxidase precursor (EC 1.1.3.6)
           (CHOD).>pir|JQ1193|JQ1193 cholesterol oxidase (EC
           1.1.3.6) precursor - Brevibacterium sterolicum (ATCC
           21387)>gb:BRLCHOB_749953 Brevibacterium sterolicum choB
           gene for cholesterol oxidase, complete cds.
          Length = 552

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 16/29 (55%), Positives = 20/29 (68%)
 Frame = -2

Query: 270 GETWEVEGLFVGDGSVLPTALGVNPMVTI 184
           G   E  GL+V DGS++P  +GVNP VTI
Sbjct: 507 GRLPEYPGLYVVDGSLVPGNVGVNPFVTI 535



>gb:AY037858_2290947 Cercopithicine herpesvirus 15 strain LCL8664,
            complete genome.
          Length = 3105

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 24/62 (38%), Positives = 31/62 (50%)
 Frame = -2

Query: 630  SRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGC 451
            S YA    + ALARD G GE  S   +TY L ++  E  +RG        AA GA+ +G 
Sbjct: 2161 SFYAGLGLVSALARDGGLGELLSDAVLTYRLVRSPAER-KRGSSS----TAATGAQNVGD 2215

Query: 450  NH 445
             H
Sbjct: 2216 AH 2217



>gb:AY863215_1631069 Trametes pubescens pyranose oxidase (p2o) mRNA,
           complete cds.
          Length = 622

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = -2

Query: 330 HQMGSCRMGVDPKAS--VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS 172
           H  G+ RMG D +     V+     +    LF+G    +PTA G NP +T MS++
Sbjct: 548 HLGGTHRMGFDEQEDNCCVDTDSRVFGFNNLFLGGCGNIPTAYGANPTLTAMSLA 602



>gb:AF385629_1419334 Canis familiaris retinitis pigmentosa GTPase
           regulator (RPGR) gene, exon ORF15 and partial cds.
          Length = 572

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 31/97 (31%), Positives = 42/97 (43%), Gaps = 1/97 (1%)
 Frame = -1

Query: 535 QNRRGESPERAREAVEDT-GGRRGRGDWMQSRHRTNPQGEGCEQGRV*EVCEGREFTESK 359
           +   GE  ER  E  E+  GG  G G+  +       +GEG E+G   EV E     E +
Sbjct: 348 EEEEGEEEERENEREEEEEGGEAGEGEEEEEGEAGQEEGEG-EEGEE-EVGEEEGEGEEE 405

Query: 358 KTPESESFGAPDGELQNGS*S*GFSGEPKGRDMGGGR 248
           +  E E  G  +GE + G       GE +GR   G R
Sbjct: 406 EEGEEEE-GEEEGEEEEG------EGEEEGRGREGER 435


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 782,663,251
Number of Sequences: 1806583
Number of extensions: 16564756
Number of successful extensions: 46357
Number of sequences better than 10.0: 272
Number of HSP's better than 10.0 without gapping: 44197
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46210
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 49889049162
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)