BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2528
         (655 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT002356_1635959 Arabidopsis thaliana clone C104996 putative ...   206   3e-52   
pir|T49050|T49050 protein kinase C inhibitor-like protein - Arab...   200   2e-50   Arabidopsis thaliana [mouse-ear cress]
pir|S45368|S45368 protein kinase C inhibitor - maize                  193   2e-48   Zea mays [maize]
sp|P42856|ZB14_MAIZE|ZB14_MAIZE 14 kDa zinc-binding protein (Protein kinase...   191   7e-48   Zea mays [maize]
sp|P42855|ZB14_BRAJU|ZB14_BRAJU 14 kDa zinc-binding protein (Protein kinase...   187   1e-46   Brassica juncea [brown mustard]
gb:BT005107_1638053 Arabidopsis thaliana clone U50317 putative p...   165   5e-40   
pir|C86437|C86437 F28K20.9 protein - Arabidopsis thaliana>gb:AE0...   154   1e-36   Arabidopsis thaliana [mouse-ear cress]
pir|AH2316|AH2316 protein kinase C inhibitor [imported] - Nostoc...   147   1e-34   Nostoc sp. PCC 7120
gb:AY860950_1354217 Bombyx mori protein kinase c inhibitor mRNA,...   140   1e-32   
gb:BC081526_2562356 Danio rerio zgc:103764, mRNA (cDNA clone MGC...   140   2e-32   
gb:AP008231_579860 Synechococcus elongatus PCC 6301 DNA, complet...   140   2e-32   
gb:AE013061_288644 Thermoanaerobacter tengcongensis MB4, section...   140   2e-32   
gb:BC068885_2555382 Xenopus laevis hypothetical protein MGC82426...   138   7e-32   
gb:BA000039_726781 Thermosynechococcus elongatus BP-1 DNA, compl...   137   2e-31   
gb:AB033882_2461543 Coturnix coturnix japonica mRNA for protein ...   137   2e-31   
gb:AB026675_2461161 Gallus gallus chPKCI mRNA for protein kinase...   136   3e-31   
gb:AF539981_2500161 Taeniopygia guttata PKCI-Z-related protein m...   135   5e-31   
sp|P32084|YHIT_SYNP7|YHIT_SYNP7 Hypothetical 12.4 kDa HIT-like protein in P...   135   5e-31   Synechococcus sp.
gb:AF085236_1881729 Homo sapiens protein kinase C inhibitor-2 mR...   135   6e-31   
gb:AX530394_1469963 Sequence 7 from Patent WO0240674.>gb:AX53039...   135   6e-31   
gb:AF366940_1418953 Bos taurus histidine triad protein 3 mRNA, c...   135   6e-31   
gb:RRU09407_2138266 Rattus norvegicus putative protein kinase C ...   134   1e-30   
gb:BTU09405_1437449 Bos taurus putative protein kinase C inhibit...   134   1e-30   
sp|P16436|HNT1_BOVIN|HNT1_BOVIN Histidine triad nucleotide-binding protein ...   134   1e-30   Bos taurus [bovine]
gb:BC087609_2565390 Xenopus tropicalis hypothetical LOC496618, m...   134   1e-30   
sp|P53795|YHIT_CAEEL|YHIT_CAEEL Hypothetical HIT-like protein F21C3.3.>pir|...   134   1e-30   Caenorhabditis elegans [roundworm]
gb:OCHINT_1442178 Oryctolagus cuniculus mRNA for histidine triad...   134   2e-30   
sp|P80912|HNT1_RABIT|HNT1_RABIT Histidine triad nucleotide-binding protein ...   134   2e-30   Oryctolagus cuniculus [domestic rabbit]
gb:BA000045_741004 Gloeobacter violaceus PCC 7421 DNA, complete ...   133   3e-30   
gb:AK004497_1152376 Mus musculus 18-day embryo whole body cDNA, ...   132   5e-30   
gb:CR857292_1181536 Pongo pygmaeus mRNA; cDNA DKFZp469O2221 (fro...   130   1e-29   
gb:AK002965_1151567 Mus musculus adult male brain cDNA, RIKEN fu...   130   1e-29   
sp|P70349|HNT1_MOUSE|HNT1_MOUSE Histidine triad nucleotide-binding protein ...   130   1e-29   Mus musculus [mouse]
gb:BC078475_2561016 Xenopus laevis MGC85233 protein, mRNA (cDNA ...   130   2e-29   
gb:AJ821828_1814268 Guillardia theta partial mRNA for putative p...   130   3e-29   
gb:AX888112_1483565 Sequence 3975 from Patent EP1033401.>gb:BC00...   130   3e-29   
gb:AY142815_591998 Heliobacillus mobilis Hit family protein gene...   130   3e-29   
sp|P49773|HNT1_HUMAN|HNT1_HUMAN Histidine triad nucleotide-binding protein ...   130   3e-29   Homo sapiens [man]
gb:BX294150_770414 Pirellula sp. strain 1 complete genome; segme...   129   4e-29   
gb:AK026557_1910655 Homo sapiens cDNA: FLJ22904 fis, clone KAT05...   128   7e-29   
gb:PFMAL8P1_1192164 Plasmodium falciparum 3D7 chromosome 8, *** ...   128   1e-28   
sp|P73481|YHIT_SYNY3|YHIT_SYNY3 Hypothetical HIT-like protein slr1234.>pir|...   125   8e-28   Synechocystis sp.
gb:AE017296_434493 Leptospira interrogans serovar Copenhageni st...   124   1e-27   
gb:AE011324_271673 Leptospira interrogans serovar lai str. 56601...   124   1e-27   
gb:AE016775_329872 Pseudomonas putida KT2440 section 2 of 21 of ...   124   2e-27   
gb:AE014134_1127225 Drosophila melanogaster chromosome 2L, compl...   123   2e-27   
gb:AE014134_1127224 Drosophila melanogaster chromosome 2L, compl...   123   2e-27   
gb:CR628336_112930 Legionella pneumophila str. Paris complete ge...   123   3e-27   
sp|O66536|YHIT_AQUAE|YHIT_AQUAE Hypothetical HIT-like protein AQ_141.>pir|E...   122   4e-27   Aquifex aeolicus
gb:BX572099_798938 Prochlorococcus marinus MIT9313 complete geno...   122   5e-27   
gb:CR628337_115887 Legionella pneumophila str. Lens complete gen...   122   5e-27   
gb:AE016858_350054 Pseudomonas syringae pv. tomato str. DC3000 s...   122   7e-27   
sp|P36950|YCFF_ECOLI|YCFF_ECOLI HIT-like protein ycfF.>pir|A99814|A99814 hy...   121   1e-26   Escherichia coli [E. coli]
gb:AE017153_392505 Haemophilus ducreyi strain 35000HP section 3 ...   120   3e-26   
gb:BA000031_706424 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   119   3e-26   
gb:BA000016_675064 Clostridium perfringens str. 13 DNA, complete...   119   3e-26   
pir|AF0643|AF0643 probable protein kinase C inhibitor STY1245 [i...   119   4e-26   Salmonella enterica subsp. enterica serovar Typhi
gb:BX571868_787682 Photorhabdus luminescens subsp. laumondii TTO...   118   8e-26   
gb:AE016827_342027 Mannheimia succiniciproducens MBEL55E, comple...   118   1e-25   
gb:AE016759_325398 Escherichia coli CFT073 section 5 of 18 of th...   118   1e-25   
gb:BX569689_775230 Synechococcus sp. WH8102 complete genome; seg...   117   2e-25   
gb:AE017340_456477 Idiomarina loihiensis L2TR, complete genome.       117   2e-25   
gb:AE017161_394538 Prochlorococcus marinus subsp. marinus str. C...   117   2e-25   
gb:BX950851_840550 Erwinia carotovora subsp. atroseptica SCRI104...   116   3e-25   
pir|G64162|G64162 histidine triad protein homolog HI0961 - Haemo...   116   3e-25   Haemophilus influenzae
sp|P44956|YCFF_HAEIN|YCFF_HAEIN HIT-like protein HI0961.                         116   3e-25   Haemophilus influenzae
gb:CP000020_871310 Vibrio fischeri ES114 chromosome I, complete ...   116   4e-25   
pir|AF0196|AF0196 conserved hypothetical protein YPO1611 [import...   116   4e-25   Yersinia pestis
gb:CR378670_95764 Photobacterium profundum SS9; segment 8/12.         115   8e-25   
pir|G82143|G82143 Hit family protein VC1897 [imported] - Vibrio ...   115   8e-25   Vibrio cholerae
gb:AE015943_321091 Clostridium tetani E88, section 8 of 10 of th...   114   2e-24   
gb:AE010489_263673 Fusobacterium nucleatum subsp. nucleatum ATCC...   114   2e-24   
gb:AE016803_336709 Vibrio vulnificus CMCP6 chromosome I section ...   112   5e-24   
gb:AE006042_214961 Pasteurella multocida subsp. multocida str. P...   112   5e-24   
pir|G97058|G97058 HIT family hydrolase [imported] - Clostridium ...   112   7e-24   Clostridium acetobutylicum
gb:CP000027_79460 Dehalococcoides ethenogenes 195, complete genome.   111   9e-24   
gb:AE017180_399720 Geobacter sulfurreducens PCA, complete genome.     111   1e-23   
gb:AE012786_285548 Chlorobium tepidum TLS section 7 of 194 of th...   110   2e-23   
gb:CR522870_99730 Desulfotalea psychrophila LSv54 chromosome.         110   2e-23   
gb:AE015711_317090 Shewanella oneidensis MR-1 section 260 of 457...   108   8e-23   
gb:BA000021_686843 Wigglesworthia glossinidia endosymbiont of Gl...   108   1e-22   
gb:AE012197_280260 Xanthomonas campestris pv. campestris str. AT...   107   1e-22   
gb:AP006840_567702 Symbiobacterium thermophilum DNA, complete ge...   107   2e-22   
gb:AE011740_276056 Xanthomonas axonopodis pv. citri str. 306, se...   107   2e-22   
gb:AY657706_2146716 Synthetic construct Peudomonas aeruginosa cl...   107   2e-22   
gb:AE013598_294768 Xanthomonas oryzae pv. oryzae KACC10331, comp...   107   2e-22   
pir|F83564|F83564 probable HIT family protein PA0656 [imported] ...   107   2e-22   Pseudomonas aeruginosa
gb:AE012557_284464 Xylella fastidiosa Temecula1, section 5 of 9 ...   106   3e-22   
pir|E82635|E82635 conserved hypothetical protein XF1810 [importe...   106   4e-22   Xylella fastidiosa
gb:BX572090_795693 Prochlorococcus marinus MED4 complete genome;...   105   5e-22   
sp|Q89AG5|YHIT_BUCBP|YHIT_BUCBP Hypothetical HIT-like protein.>gb:AE014017_...   102   6e-21   
gb:AY312991_608475 Alvinella pompejana epibiont 7G3 fosmid clone...   102   7e-21   
pir|G97753|G97753 protein kinase C inhibitor 1 [imported] - Rick...   101   1e-20   Rickettsia conorii
gb:AE016962_368020 Coxiella burnetii strain RSA 493, section 3 o...   101   1e-20   
sp|O07817|HITA_NEIGO|HITA_NEIGO HITA protein.>gb:AE004969_59968 Neisseria g...   100   3e-20   Neisseria gonorrhoeae
gb:BX321858_772968 Nitrosomonas europaea ATCC 19718, complete ge...   100   4e-20   
gb:AE017144_389782 Helicobacter hepaticus ATCC 51449 section 1 o...   100   4e-20   
gb:AB029922_1194754 Dictyostelium discoideum DD-1 mRNA, complete...    99   8e-20   
pir|F81925|F81925 probable nucleotide-binding protein NMA0806 [i...    99   8e-20   Neisseria meningitidis serogroup A
gb:AE017282_428084 Methylococcus capsulatus str. Bath, complete ...    98   1e-19   
pir|F81181|F81181 hitA protein NMB0602 [imported] - Neisseria me...    98   1e-19   Neisseria meningitidis serogroup B
sp|P57438|YHIT_BUCAI|YHIT_BUCAI Hypothetical hit-like protein BU357.>pir|E8...    97   2e-19   
gb:AE017197_402292 Rickettsia typhi str. Wilmington complete gen...    97   2e-19   
sp|Q9ZDL1|YHIT_RICPR|YHIT_RICPR Hypothetical HIT-like protein RP317.>pir|G7...    97   2e-19   Rickettsia prowazekii
gb:SCO939113_176222 Streptomyces coelicolor A3(2) complete genom...    97   3e-19   
gb:CR767821_116617 Ehrlichia ruminantium strain Welgevonden, com...    97   3e-19   
gb:AY872045_2150209 Synthetic construct hypothetical protein (FT...    96   4e-19   
gb:AJ749949_531756 Francisella tularensis subsp. tularensis comp...    96   4e-19   
gb:BA000030_703462 Streptomyces avermitilis MA-4680 genomic DNA,...    96   5e-19   
gb:BX248585_764008 Blochmannia floridanus complete genome; segme...    96   7e-19   
gb:AE016912_355583 Chromobacterium violaceum ATCC 12472 section ...    96   7e-19   
gb:BX908798_830139 Parachlamydia-related symbiont UWE25, complet...    93   3e-18   
sp|Q8K9I9|YHIT_BUCAP|YHIT_BUCAP Hypothetical hit-like protein BUsg345.>gb:A...    93   3e-18   
gb:BX571660_778637 Wolinella succinogenes, complete genome; segm...    92   6e-18   
pir|G75374|G75374 Hit family protein - Deinococcus radiodurans (...    92   1e-17   Deinococcus radiodurans
gb:CP000009_862509 Gluconobacter oxydans 621H, complete genome.        90   3e-17   
gb:CP000030_83399 Anaplasma marginale str. St. Maries, complete ...    90   4e-17   
pir|B81363|B81363 HIT-family protein Cj0898 [imported] - Campylo...    89   5e-17   Campylobacter jejuni RM1221
gb:AP003247_1826219 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:CR555306_106096 Azoarcus sp. EbN1 complete genome.                  89   8e-17   
gb:BX640436_812506 Bordetella parapertussis strain 12822, comple...    87   2e-16   
gb:TTH302653_198475 Thermus thermophilus hint gene for histidine...    87   3e-16   
gb:AE016822_340501 Leifsonia xyli subsp. xyli str. CTCB07, compl...    86   4e-16   
gb:BX640422_808160 Bordetella pertussis strain Tohama I, complet...    86   6e-16   
gb:AP008226_579074 Thermus thermophilus HB8 genomic DNA, complet...    86   6e-16   
gb:BX571965_792927 Burkholderia pseudomallei strain K96243, chro...    84   2e-15   
gb:AE008692_241236 Zymomonas mobilis subsp. mobilis ZM4, complet...    84   2e-15   
sp|Q9PK09|Y664_CHLMU|Y664_CHLMU Hypothetical HIT-like protein TC0664.>gb:AE...    83   5e-15   Chlamydia muridarum [agent of mouse pneumonitis]
gb:AE017321_441873 Wolbachia endosymbiont strain TRS of Brugia m...    82   6e-15   
sp|O84390|YHIT_CHLTR|YHIT_CHLTR Hypothetical HIT-like protein CT385.>pir|E7...    80   2e-14   Chlamydia trachomatis
sp|P26724|YHIT_AZOBR|YHIT_AZOBR Hypothetical 13.2 kDa HIT-like protein in h...    79   9e-14   Azospirillum brasilense
gb:AE014295_311251 Bifidobacterium longum NCC2705, complete genome.    77   3e-13   
gb:AE017260_418831 Wolbachia endosymbiont of Drosophila melanoga...    76   4e-13   
pir|H90512|H90512 hit-like protein (cell cycle regulation) [impo...    76   4e-13   Mycoplasma pulmonis
gb:AE016994_374321 Chlamydophila caviae GPIC section 1 of 4 of t...    75   7e-13   
sp|Q23921|PKIA_DICDI|PKIA_DICDI Protein pkiA.>gb:DDU61986_1377368 Dictyoste...    74   2e-12   Dictyostelium discoideum
gb:AE016851_348806 Tropheryma whipplei str. Twist, section 2 of ...    74   2e-12   
sp|P56147|YHIT_HELPY|YHIT_HELPY Hypothetical HIT-like protein HP0404/JHP097...    74   2e-12   Helicobacter pylori
gb:BX251411_764684 Tropheryma whipplei TW08/27, complete genome;...    74   3e-12   
gb:AE002186_43752 Chlamydophila pneumoniae AR39, section 21 of 9...    74   3e-12   
gb:BA000043_737234 Geobacillus kaustophilus HTA426 DNA, complete...    73   4e-12   
gb:AE017199_403338 Nanoarchaeum equitans Kin4-M, complete genome.      73   4e-12   
gb:AE017308_437711 Mycoplasma mobile 163K complete genome.             73   5e-12   
pir|B64408|B64408 histidine triad (HIT) protein MJ0866 - Methano...    73   5e-12   Methanocaldococcus jannaschii
sp|Q58276|Y866_METJA|Y866_METJA Hypothetical HIT-like protein MJ0866.>gb:U6...    73   5e-12   Methanocaldococcus jannaschii
sp|Q9Z863|YHIT_CHLPN|YHIT_CHLPN HIT-like protein CPn0488/CP0266/CPj0488/CpB...    72   6e-12   Chlamydia pneumoniae
gb:CR543861_104197 Acinetobacter sp. ADP1 complete genome.             72   8e-12   
gb:MHP60F_144073 M.hominis gene for membrane protein P80 (ORF1),...    72   1e-11   
pir|AI2744|AI2744 HIT family protein [imported] - Agrobacterium ...    71   2e-11   Agrobacterium fabrum str. C58
gb:AE017355_462281 Bacillus thuringiensis serovar konkukian str....    70   2e-11   
gb:AE017268_422380 Bacillus cereus ATCC 10987, section 5 of 18 o...    70   2e-11   
gb:AE017001_375992 Bacillus cereus ATCC 14579 section 4 of 18 of...    70   2e-11   
pir|F86874|F86874 hypothetical protein yuhI [imported] - Lactoco...    69   5e-11   Lactococcus lactis subsp. lactis
gb:BX957219_843584 Methanococcus maripaludis S2 complete genome;...    69   7e-11   
gb:AP006618_556954 Nocardia farcinica IFM 10152 DNA, complete ge...    69   7e-11   
gb:AE017332_445623 Mycoplasma hyopneumoniae 232, complete genome.      69   9e-11   
gb:SAG766844_169885 Streptococcus agalactiae NEM316 complete gen...    69   9e-11   
gb:CP000024_877388 Streptococcus thermophilus CNRZ1066, complete...    68   2e-10   
pir|E83798|E83798 Hit-like protein involved in cell-cycle regula...    68   2e-10   Bacillus halodurans
pir|E87555|E87555 HIT family protein [imported] - Caulobacter cr...    67   2e-10   Caulobacter vibrioides
pir|E89970|E89970 hypothetical protein hit [imported] - Staphylo...    67   2e-10   Staphylococcus aureus subsp. aureus Mu50
gb:BA000026_693701 Mycoplasma penetrans HF-2 DNA, complete genome.     67   3e-10   
gb:CP000023_875461 Streptococcus thermophilus LMG 18311, complet...    67   3e-10   
gb:AE017027_381274 Bacillus anthracis str. Ames section 4 of 18 ...    67   3e-10   
gb:AP006618_557406 Nocardia farcinica IFM 10152 DNA, complete ge...    66   5e-10   
gb:BX897699_827242 Bartonella henselae strain Houston-1, complet...    66   6e-10   
sp|P32083|YHIT_MYCHR|YHIT_MYCHR Hypothetical 13.1 kDa HIT-like protein in P...    66   6e-10   Mycoplasma hyorhinis
gb:AY657240_2146250 Synthetic construct Peudomonas aeruginosa cl...    65   1e-09   
gb:BA000012_666495 Mesorhizobium loti MAFF303099 DNA, complete g...    65   1e-09   
gb:AP006628_567065 Onion yellows phytoplasma OY-M DNA, complete ...    65   1e-09   
pir|H83234|H83234 probable HIT family protein PA3295 [imported] ...    65   1e-09   Pseudomonas aeruginosa
gb:AE014888_312839 Streptococcus mutans UA159 section 36 of 185 ...    65   1e-09   
gb:CP000029_81970 Staphylococcus epidermidis RP62A, complete gen...    65   1e-09   
gb:AE010743_266186 Methanosarcina acetivorans str. C2A, section ...    64   3e-09   
gb:CR382126_1658604 Kluyveromyces lactis strain NRRL Y-1140 chro...    63   4e-09   
gb:BA000023_692124 Sulfolobus tokodaii str. 7 DNA, complete genome.    63   4e-09   
pir|D75073|D75073 hit-like protein PAB0657 - Pyrococcus abyssi (...    63   4e-09   Pyrococcus abyssi
pir|AC1722|AC1722 histidine triad (HIT) protein homolog lin2319 ...    63   4e-09   Listeria innocua
gb:CR380956_1652394 Candida glabrata strain CBS138 chromosome J ...    63   5e-09   
gb:SME591787_185508 Sinorhizobium meliloti 1021 complete chromos...    63   5e-09   
gb:AF539982_2500162 Taeniopygia guttata ASW-related protein (ASW...    62   7e-09   
gb:CP000013_869611 Borrelia garinii PBi, complete genome.              62   9e-09   
gb:AE017333_446953 Bacillus licheniformis DSM 13, complete genom...    62   9e-09   
gb:AE013433_292288 Methanosarcina mazei strain Goe1, section 215...    62   9e-09   
gb:CP000031_85426 Silicibacter pomeroyi DSS-3, complete genome.        62   9e-09   
pir|AH1351|AH1351 histidine triad (HIT) protein homolog lmo2216 ...    62   9e-09   Listeria monocytogenes
pir|B70147|B70147 protein kinase C inhibitor homolog - Lyme dise...    62   9e-09   Borreliella burgdorferi
sp|P94252|YHIT_BORBU|YHIT_BORBU Hypothetical HIT-like protein BB0379.>gb:BB...    62   9e-09   Borreliella burgdorferi
sp|O07513|HIT_BACSU|HIT_BACSU Hit protein.>pir|A69642|A69642 cell-cycle re...    62   1e-08   Bacillus subtilis
gb:AE017205_404832 Lactobacillus johnsonii NCC 533, section 6 of...    61   2e-08   
gb:BA000040_733395 Bradyrhizobium japonicum USDA 110 DNA, comple...    60   2e-08   
gb:AP006627_563851 Bacillus clausii KSM-K16 DNA, complete genome.      60   2e-08   
gb:AL935256_551259 Lactobacillus plantarum strain WCFS1 complete...    60   2e-08   
gb:CR382139_1672674 Debaryomyces hansenii chromosome G of strain...    60   3e-08   
gb:AY596297_633885 Haloarcula marismortui ATCC 43049 chromosome ...    60   3e-08   
gb:AE016969_369776 Mycoplasma gallisepticum strain R section 3 o...    60   3e-08   
gb:AE010221_260674 Pyrococcus furiosus DSM 3638, section 96 of 1...    60   3e-08   
gb:AE006602_220600 Streptococcus pyogenes M1 GAS, section 131 of...    60   3e-08   
gb:AE016819_1748992 Ashbya gossypii (= Eremothecium gossypii) AT...    60   4e-08   
gb:BA000023_692838 Sulfolobus tokodaii str. 7 DNA, complete genome.    60   4e-08   
gb:AE017310_438651 Desulfovibrio vulgaris subsp. vulgaris str. H...    59   6e-08   
pir|B97929|B97929 conserved hypothetical protein spr0458 [import...    59   6e-08   Streptococcus pneumoniae
gb:BX897700_828933 Bartonella quintana str. Toulouse, complete g...    59   7e-08   
gb:AE000516_21332 Mycobacterium tuberculosis CDC1551, complete g...    59   7e-08   
gb:AE014291_308601 Brucella suis 1330 chromosome I, complete seq...    59   9e-08   
pir|AC3354|AC3354 bis(5'-nucleosyl)-tetraphosphatase (asymmetric...    59   9e-08   Brucella melitensis
gb:BX842643_822510 Mycoplasma mycoides subsp. mycoides SC genomi...    58   1e-07   
gb:AL646079_548864 Ralstonia solanacearum GMI1000 megaplasmid, c...    57   2e-07   
gb:AE017263_420798 Mesoplasma florum L1 complete genome.               57   2e-07   
sp|Q04344|HNT1_YEAST|HNT1_YEAST Hit family protein 1 (Adenosine 5'-monophos...    57   2e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:MLU15187_149040 Mycobacterium leprae cosmid L296.                   57   4e-07   
pir|E84369|E84369 histidine triad protein [imported] - Halobacte...    57   4e-07   Halobacterium salinarum
pir|D71092|D71092 hypothetical protein PH1001 - Pyrococcus horik...    56   5e-07   Pyrococcus horikoshii
gb:BX572603_802753 Rhodopseudomonas palustris CGA009 complete ge...    56   6e-07   
gb:AE009914_257343 Pyrobaculum aerophilum strain IM2 section 169...    56   6e-07   
sp|P71816|YHI1_MYCTU|YHI1_MYCTU Hypothetical HIT-like protein Rv0759c/MT078...    56   6e-07   Mycobacterium tuberculosis
sp|P49774|YHI1_MYCLE|YHI1_MYCLE Hypothetical HIT-like protein ML2237.>pir|A...    56   6e-07   Mycobacterium leprae
gb:BX248338_758649 Mycobacterium bovis subsp. bovis AF2122/97 co...    55   8e-07   
gb:BA000028_695541 Oceanobacillus iheyensis HTE831 DNA, complete...    55   8e-07   
sp|Q11066|YHI2_MYCTU|YHI2_MYCTU Hypothetical HIT-like protein Rv1262c/MT130...    55   8e-07   Mycobacterium tuberculosis
gb:AY316120_608569 Uncultured crenarchaeote DeepAnt-EC39 genomic...    55   1e-06   
gb:AE017229_411298 Mycobacterium avium subsp. paratuberculosis s...    55   1e-06   
gb:CP000033_89817 Lactobacillus acidophilus NCFM, complete genome.     55   1e-06   
sp|P95937|YHIT_SULSO|YHIT_SULSO Hypothetical hit-like protein SSO2163.>pir|...    54   2e-06   Saccharolobus solfataricus
gb:AE017343_1755258 Cryptococcus neoformans var. neoformans JEC2...    54   3e-06   
gb:AY568724_1615482 Lycopersicon esculentum histidine triad fami...    54   3e-06   
gb:AE017236_413215 Mycobacterium avium subsp. paratuberculosis s...    54   3e-06   
gb:AE016949_364769 Enterococcus faecalis V583, section 3 of 11 o...    53   4e-06   
gb:AE017283_431158 Propionibacterium acnes KPA171202, complete g...    53   5e-06   
pir|D82911|D82911 probable HIT protein UU272 [imported] - Ureapl...    53   5e-06   Ureaplasma urealyticum
gb:AY657766_2146776 Synthetic construct Peudomonas aeruginosa cl...    52   9e-06   
pir|F83481|F83481 probable HIT family protein PA1306 [imported] ...    52   9e-06   Pseudomonas aeruginosa
gb:BX571966_795150 Burkholderia pseudomallei strain K96243, chro...    52   1e-05   
gb:BA000031_707276 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    52   1e-05   
sp|P47378|YHIT_MYCGE|YHIT_MYCGE Hypothetical HIT-like protein MG132.>pir|F6...    52   1e-05   Mycoplasma genitalium
gb:AE017318_441089 Desulfovibrio vulgaris subsp. vulgaris str. H...    50   3e-05   
gb:CR555306_106223 Azoarcus sp. EbN1 complete genome.                  50   3e-05   
gb:AP006627_566069 Bacillus clausii KSM-K16 DNA, complete genome.      50   4e-05   
gb:TACID4_196897 Thermoplasma acidophilum complete genome; segme...    49   6e-05   
sp|P75504|YHIT_MYCPN|YHIT_MYCPN Hypothetical 16.1 kDa HIT-like protein (A65...    49   6e-05   Mycoplasma pneumoniae
gb:BX640423_808313 Bordetella parapertussis strain 12822, comple...    49   7e-05   
gb:BA000037_722594 Vibrio vulnificus YJ016 DNA, chromosome I, co...    49   7e-05   
gb:AF393466_506960 Uncultured crenarchaeote 74A4 partial genomic...    49   7e-05   
gb:LMFP1295_1388687 Leishmania major Friedlin chromosome 14 PAC ...    48   2e-04   
gb:AE017261_419481 Picrophilus torridus DSM 9790, complete genome.     47   2e-04   
pir|T40979|T40979 hypothetical HIT-family protein - fission yeas...    47   3e-04   Schizosaccharomyces pombe
gb:CR555306_105585 Azoarcus sp. EbN1 complete genome.                  47   4e-04   
sp|Q7YRZ1|APTX_PIG|APTX_PIG Aprataxin homolog (Forkhead-associated domain...    47   4e-04   Sus scrofa [pigs]
gb:AJ627420_527882 Uncultured crenarchaeote genomic fragment 6a13.     46   5e-04   
gb:BA000011_664691 Thermoplasma volcanium GSS1 DNA, complete gen...    46   6e-04   
pir|T43198|T43198 nitrilase/Fhit protein - Caenorhabditis elegan...    46   6e-04   Caenorhabditis elegans [roundworm]
gb:AP006878_576791 Thermococcus kodakaraensis strain KOD1 DNA, c...    45   8e-04   
gb:AP006840_569597 Symbiobacterium thermophilum DNA, complete ge...    45   8e-04   
gb:AP008231_582164 Synechococcus elongatus PCC 6301 DNA, complet...    45   0.001   
gb:AE017333_447852 Bacillus licheniformis DSM 13, complete genom...    45   0.001   
gb:AP003570_1831018 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:CNS07EGF_1373814 chromosome VIII of strain GB-M1 of Encephali...    45   0.001   
gb:AF265258_493751 Rhodococcus sp. S9 dolichyl-phosphate beta-gl...    45   0.001   
gb:BT020761_1436119 Bos taurus aprataxin (APTX), mRNA, complete ...    44   0.002   
gb:AC117070_1207624 Dictyostelium discoideum chromosome 2 map 20...    44   0.002   
gb:BA000035_717273 Corynebacterium efficiens YS-314 DNA, complet...    44   0.002   
gb:AE017199_403044 Nanoarchaeum equitans Kin4-M, complete genome.      44   0.002   
sp|Q7YRZ2|APTX_BOVIN|APTX_BOVIN Aprataxin homolog (Forkhead-associated doma...    44   0.002   Bos taurus [bovine]
gb:BC021872_2093678 Mus musculus aprataxin, mRNA (cDNA clone IMA...    44   0.003   
gb:AL935260_552340 Lactobacillus plantarum strain WCFS1 complete...    44   0.003   
gb:AE016936_361934 Bacteroides thetaiotaomicron VPI-5482, sectio...    44   0.003   
pir|G72481|G72481 probable histidine triad (HIT) protein APE2495...    44   0.003   Aeropyrum pernix
sp|Q8K4H4|APTX_RAT|APTX_RAT Aprataxin homolog (Forkhead-associated domain...    44   0.003   Rattus norvegicus [brown rat]
gb:AY332757_2528299 Oncorhynchus mykiss FHA-HIT mRNA, complete cds.    43   0.004   
gb:BC071213_2106440 Mus musculus aprataxin, mRNA (cDNA clone IMA...    43   0.005   
gb:AK088928_1175708 Mus musculus 2 days neonate thymus thymic ce...    43   0.005   
gb:AK010516_1155818 Mus musculus ES cells cDNA, RIKEN full-lengt...    43   0.005   
gb:AK005286_1152926 Mus musculus adult male cerebellum cDNA, RIK...    43   0.005   
gb:BX248359_763201 Corynebacterium diphtheriae gravis NCTC13129,...    43   0.005   
gb:AE017177_397842 Porphyromonas gingivalis W83 section 6 of 8 o...    43   0.005   
sp|Q7TQC5|APTX_MOUSE|APTX_MOUSE Aprataxin homolog (Forkhead-associated doma...    43   0.005   Mus musculus [mouse]
gb:AB026677_2461163 Gallus gallus Wpkci-8 mRNA, complete cds.>gb...    42   0.007   
gb:AP006841_574838 Bacteroides fragilis YCH46 DNA, complete genome.    42   0.007   
gb:AP006627_565637 Bacillus clausii KSM-K16 DNA, complete genome.      42   0.007   
gb:AP006618_556947 Nocardia farcinica IFM 10152 DNA, complete ge...    42   0.007   
gb:CNS07EGG_1374033 chromosome X of strain GB-M1 of Encephalitoz...    42   0.009   
sp|P61797|APTX_CANFA|APTX_CANFA Aprataxin homolog (Forkhead-associated doma...    42   0.009   
gb:HSM806366_2018302 Homo sapiens mRNA; cDNA DKFZp686L1965 (from...    41   0.016   
gb:AY208835_1939217 Homo sapiens hypothalamus FHA-HIT isoform mR...    41   0.016   
gb:AY208833_1939215 Homo sapiens kidney FHA-HIT isoform 2 mRNA, ...    41   0.016   
gb:AY208831_1939213 Homo sapiens skin FHA-HIT isoform mRNA, comp...    41   0.016   
gb:AY208830_1939212 Homo sapiens testis FHA-HIT short isoform mR...    41   0.016   
gb:AL162590_1922537 Human DNA sequence from clone RP11-54K16 on ...    41   0.016   
gb:AL162590_1922536 Human DNA sequence from clone RP11-54K16 on ...    41   0.016   
gb:AX716699_1473705 Sequence 3 from Patent EP1293570.>gb:AL35371...    41   0.016   
gb:BA000035_715050 Corynebacterium efficiens YS-314 DNA, complet...    41   0.016   
sp|Q9BGQ0|APTX_MACFA|APTX_MACFA Aprataxin homolog (Forkhead-associated doma...    41   0.016   
sp|Q7Z2E3|APTX_HUMAN|APTX_HUMAN Aprataxin (Forkhead-associated domain histi...    41   0.016   
gb:CR382123_1655914 Kluyveromyces lactis strain NRRL Y-1140 chro...    41   0.020   
gb:BX927155_834136 Corynebacterium glutamicum ATCC 13032, IS fin...    41   0.020   
gb:BX842647_823569 Bdellovibrio bacteriovorus complete genome, s...    41   0.020   
gb:BA000036_720328 Corynebacterium glutamicum ATCC 13032 DNA, co...    41   0.020   
gb:AY208847_2519273 Takifugu rubripes FHA-HIT short isoform mRNA...    40   0.027   
gb:AB033880_2461541 Gallus gallus Wpkci-7 mRNA, complete cds.>gb...    40   0.027   
gb:CR382128_1660967 Yarrowia lipolytica chromosome B of strain C...    40   0.027   
sp|P61800|APTX_FUGRU|APTX_FUGRU Aprataxin homolog (Forkhead-associated doma...    40   0.027   
gb:AY208834_1939216 Homo sapiens dendritic cells FHA-HIT isoform...    40   0.035   
gb:AB125151_1873828 Macaca fascicularis APTX mRNA for aprataxin,...    40   0.035   
gb:BT004792_1637826 Arabidopsis thaliana At4g16566 gene, complet...    40   0.035   
gb:AY088482_1573501 Arabidopsis thaliana clone 7101 mRNA, comple...    40   0.035   
gb:AX716697_1473704 Sequence 1 from Patent EP1293570.>gb:AK00016...    40   0.035   
gb:BA000011_665683 Thermoplasma volcanium GSS1 DNA, complete gen...    40   0.035   
gb:AY208842_1939224 Homo sapiens lymphoma FHA-HIT aberrant isofo...    40   0.045   
sp|P61799|APTX_BRARE|APTX_BRARE Aprataxin homolog (Forkhead-associated doma...    39   0.059   
gb:BC088684_2565810 Xenopus laevis hypothetical LOC496222, mRNA ...    39   0.077   
gb:BC087368_2565213 Xenopus laevis hypothetical LOC495983, mRNA ...    39   0.077   
gb:BC077654_2560349 Xenopus tropicalis fragile histidine triad g...    39   0.077   
pir|S64700|S64700 bis(5'-nucleosyl)-tetraphosphatase (asymmetric...    39   0.077   
sp|P49776|APH1_SCHPO|APH1_SCHPO Bis(5'-nucleosyl)-tetraphosphatase [Asymmet...    39   0.077   
gb:TACID5_197090 Thermoplasma acidophilum complete genome; segme...    39   0.10    
gb:BX571658_777832 Wolinella succinogenes, complete genome; segm...    38   0.13    
sp|P49775|HNT2_YEAST|HNT2_YEAST Hit family protein 2.>pir|S61191|S61191 asy...    38   0.13    
gb:BT004955_1637901 Arabidopsis thaliana clone U51053 unknown pr...    38   0.17    
gb:CP000001_851182 Bacillus cereus ZK, complete genome.                38   0.17    
gb:AB019228_1514098 Arabidopsis thaliana genomic DNA, chromosome...    37   0.29    
gb:AX885765_1481218 Sequence 1628 from Patent EP1033401.               37   0.29    
gb:AE014187_938815 Plasmodium falciparum 3D7 chromosome 14 compl...    37   0.29    
gb:AE017266_421945 Bacillus cereus ATCC 10987, section 3 of 18 o...    37   0.29    
gb:AE016811_338601 Vibrio vulnificus CMCP6 chromosome II section...    37   0.29    
gb:AE016814_1745777 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.38    
gb:CR382139_1672457 Debaryomyces hansenii chromosome G of strain...    37   0.38    
gb:AY144442_1583540 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...    37   0.38    
gb:CR859092_1183229 Pongo pygmaeus mRNA; cDNA DKFZp459J1929 (fro...    37   0.38    
gb:AB026679_2461165 Gallus gallus Wpkci-7 and Wpkci genes, parti...    36   0.50    
gb:BT003103_1636684 Arabidopsis thaliana At5g58240 mRNA, complet...    36   0.50    
gb:BA000038_725448 Vibrio vulnificus YJ016 DNA, chromosome II, c...    36   0.50    
gb:AE017144_389880 Helicobacter hepaticus ATCC 51449 section 1 o...    36   0.50    
sp|P61801|APTX_XENTR|APTX_XENTR Aprataxin homolog (Forkhead-associated doma...    36   0.50    
gb:AE014296_1133960 Drosophila melanogaster chromosome 3L, compl...    36   0.65    
gb:AE017355_461879 Bacillus thuringiensis serovar konkukian str....    36   0.65    
pir|D97098|D97098 hIT family hydrolase [imported] - Clostridium ...    36   0.65    
gb:BX927255_2568067 Zebrafish DNA sequence from clone CH211-266I...    35   0.85    
gb:BX537272_2567621 Zebrafish DNA sequence from clone DKEY-25E12...    35   0.85    
gb:AY389749_1178356 Hyacinthus orientalis diadenosine tetraphosp...    35   0.85    
sp|P61802|APTX_CIOIN|APTX_CIOIN Aprataxin homolog (Forkhead-associated doma...    35   0.85    
gb:AY486460_1951530 Homo sapiens histidine triad protein 3 mutan...    35   1.1     
gb:AY035387_1934768 Homo sapiens HINT4 mRNA, complete cds.>gb:AY...    35   1.1     
pir|G83992|G83992 cell-cycle regulation histidine triad (Hit fam...    35   1.1     
pir|F86870|F86870 hypothetical protein yueA [imported] - Lactoco...    35   1.5     
sp|Q7T287|APTX_XENLA|APTX_XENLA Aprataxin homolog (Forkhead-associated doma...    35   1.5     
gb:BC059526_2552503 Danio rerio fragile histidine triad gene, mR...    34   1.9     
gb:AB033883_2461544 Anas platyrhynchos mRNA for Wpkci, partial cds.    34   1.9     
gb:OSJN00196_1696543 Oryza sativa genomic DNA, chromosome 4, BAC...    34   1.9     
gb:AK002482_1151237 Mus musculus adult male kidney cDNA, RIKEN f...    34   1.9     
gb:AE011376_272281 Leptospira interrogans serovar lai str. 56601...    34   1.9     
pir|S72501|S72501 protein kinase C inhibitor - human (fragment)        34   1.9     
gb:AY040767_2074392 Rattus norvegicus histidine triad protein 4 ...    34   2.5     
gb:MMFHIT3_2114919 Mus musculus fragile histidine triad protein ...    33   3.2     
gb:BC012662_2091595 Mus musculus fragile histidine triad gene, m...    33   3.2     
gb:AP005782_1857740 Oryza sativa (japonica cultivar-group) genom...    33   3.2     
gb:AP006627_566135 Bacillus clausii KSM-K16 DNA, complete genome.      33   3.2     
sp|O89106|FHIT_MOUSE|FHIT_MOUSE Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.2...    33   3.2     
gb:HSA565855_2009105 Homo sapiens partial mRNA for aprataxin (AP...    33   4.2     
gb:HSA565854_2009104 Homo sapiens partial mRNA for aprataxin (AP...    33   4.2     
gb:HSA565852_2009102 Homo sapiens partial mRNA for aprataxin (AP...    33   4.2     
gb:CR382138_1671606 Debaryomyces hansenii chromosome F of strain...    33   4.2     
gb:AY118832_1300554 Drosophila melanogaster GM01362 full insert ...    33   4.2     
gb:AE006479_219338 Streptococcus pyogenes M1 GAS, section 8 of 1...    33   4.2     
gb:MHO416603_144012 Mycoplasma hominis partial hitB gene for mem...    33   4.2     
gb:AE017225_406016 Bacillus anthracis str. Sterne, complete genome.    33   5.5     
gb:AE017026_380904 Bacillus anthracis str. Ames section 3 of 18 ...    33   5.5     
gb:HVSC488_2438563 Herpesvirus saimiri C-488 DNA for ORF 12 to 2...    32   7.2     
gb:AE017343_1755720 Cryptococcus neoformans var. neoformans JEC2...    32   7.2     
gb:AF398236_1419472 Bos taurus HINT-4 mRNA, complete cds.              32   7.2     
pir|F96805|F96805 unknown protein T5M16.20 [imported] - Arabidop...    32   7.2     
pir|T41152|T41152 hypothetical protein SPCC18.09c - fission yeas...    32   7.2     
sp|Q01007|UL87_SHV21|UL87_SHV21 Gene 24 protein.>pir|D36808|D36808 hypothet...    32   7.2     
gb:HSA565850_2009100 Homo sapiens partial mRNA for aprataxin (AP...    32   9.4     
gb:AC091774_1735047 Oryza sativa chromosome 6 BAC OJ1540_H01 gen...    32   9.4     
gb:BA000023_692479 Sulfolobus tokodaii str. 7 DNA, complete genome.    32   9.4     
gb:AY458629_619106 Uncultured bacterium 105 clone EBAC750-01A01 ...    32   9.4     
gb:AY394858_616265 Rhodococcus equi SugE (sugE) gene, complete c...    32   9.4     
pir|T49362|T49362 hypothetical protein B1D1.160 [imported] - Neu...    32   9.4     
pir|T05741|T05741 dnaK-type molecular chaperone HSP70 - barley>g...    32   9.4     
sp|P61798|APTX_CHICK|APTX_CHICK Aprataxin homolog (Forkhead-associated doma...    32   9.4     


>gb:BT002356_1635959 Arabidopsis thaliana clone C104996 putative
           protein kinase C inhibitor (At3g56490) mRNA, complete
           cds.
          Length = 147

 Score =  206 bits (524), Expect = 3e-52
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 6/147 (4%)
 Frame = +2

Query: 2   SSRLQRLTSHLSPHTPMASGN------AVPSDSPTIFDKIINKEIPANIVYEDDQVLAFR 163
           S R+  L+SH SP + + +        A PSDSPTIFDKII+KEIP+ +V+EDD+VLAFR
Sbjct: 2   SHRVSILSSHFSPASAVMASEKEAALAATPSDSPTIFDKIISKEIPSTVVFEDDKVLAFR 61

Query: 164 DIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVIN 343
           DI P+ P HILLIPKV+DGLTGLSKAEERH +ILGRLLYTAKLVAKQEGL E GFR+VIN
Sbjct: 62  DITPQGPVHILLIPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLAE-GFRIVIN 120

Query: 344 DGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           DG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct: 121 DGPQGCQSVYHIHVHLIGGRQMNWPPG 147



>pir|T49050|T49050 protein kinase C inhibitor-like protein -
           Arabidopsis thaliana>gb:ATT5P19_1556254 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T5P19.>gb:AY045861_1561372 Arabidopsis thaliana putative
           protein kinase C inhibitor (At3g56490) mRNA, complete
           cds.>gb:AY086874_1571915 Arabidopsis thaliana clone
           28847 mRNA, complete sequence.
          Length = 129

 Score =  200 bits (508), Expect = 2e-50
 Identities = 96/120 (80%), Positives = 109/120 (90%)
 Frame = +2

Query: 65  AVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAE 244
           A PSDSPTIFDKII+KEIP+ +V+EDD+VLAFRDI P+ P HILLIPKV+DGLTGLSKAE
Sbjct: 11  ATPSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLSKAE 70

Query: 245 ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           ERH +ILGRLLYTAKLVAKQEGL E GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct: 71  ERHIDILGRLLYTAKLVAKQEGLAE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG 129



>pir|S45368|S45368 protein kinase C inhibitor - maize
          Length = 129

 Score =  193 bits (491), Expect = 2e-48
 Identities = 92/120 (76%), Positives = 109/120 (90%)
 Frame = +2

Query: 65  AVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAE 244
           AV  DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGL+KAE
Sbjct: 11  AVLDDSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLAKAE 70

Query: 245 ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           ERH EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct: 71  ERHIEILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG 129



>sp|P42856|ZB14_MAIZE 14 kDa zinc-binding protein (Protein kinase C
           inhibitor) (PKCI).>gb:ZMUPKCIMR_1732261 Z.mays (A619)
           PKCI mRNA for protein kinase C Inhibitor.
          Length = 128

 Score =  191 bits (486), Expect = 7e-48
 Identities = 90/116 (77%), Positives = 107/116 (92%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           DSPTIFDKII KEIP+ +VYED++VLAFRDI+P+APTHIL+IPKVKDGLTGL+KAEERH 
Sbjct: 14  DSPTIFDKIIKKEIPSTVVYEDEKVLAFRDINPQAPTHILIIPKVKDGLTGLAKAEERHI 73

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           EILG LLY AK+VAKQEGL E+G+R+VINDG  G Q+V+HIH+HL+GGRQ+NWPPG
Sbjct: 74  EILGYLLYVAKVVAKQEGL-EDGYRVVINDGPSGCQSVYHIHVHLLGGRQMNWPPG 128



>sp|P42855|ZB14_BRAJU 14 kDa zinc-binding protein (Protein kinase C
           inhibitor) (PKCI) (Fragment).>gb:BJU09406_1633036
           Brassica juncea putative protein kinase C inhibitor
           mRNA, partial cds.
          Length = 113

 Score =  187 bits (475), Expect = 1e-46
 Identities = 90/113 (79%), Positives = 102/113 (90%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII+KEIP+ +VYEDD+VLAFRDI P+ P HILLIPKV+DGLTGL KAEERH +IL
Sbjct: 2   TIFGKIISKEIPSTVVYEDDKVLAFRDITPQGPVHILLIPKVRDGLTGLFKAEERHIDIL 61

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           GRLLYTAKLVAKQEGLDE GFR+VINDG  G Q+V+HIH+HLIGGRQ+NWPPG
Sbjct: 62  GRLLYTAKLVAKQEGLDE-GFRIVINDGPQGCQSVYHIHVHLIGGRQMNWPPG 113



>gb:BT005107_1638053 Arabidopsis thaliana clone U50317 putative
           protein kinase C inhibitor (Zinc-binding protein)
           (At1g31160) mRNA, complete cds.>gb:AK117570_1815599
           Arabidopsis thaliana At1g31160 mRNA for putative protein
           kinase C inhibitor (Zinc-binding protein), complete cds,
           clone: RAFL17-22-C23.
          Length = 187

 Score =  165 bits (418), Expect = 5e-40
 Identities = 75/133 (56%), Positives = 107/133 (80%)
 Frame = +2

Query: 26  SHLSPHTPMASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP 205
           +H       A+ +   + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IP
Sbjct: 56  AHNEEAAAKAAASVADTGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIP 115

Query: 206 KVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHL 385
           K++DGLT L KAE RH E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +  Q+V+H+HL
Sbjct: 116 KLRDGLTSLGKAEPRHVEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACQSVYHLHL 174

Query: 386 HLIGGRQLNWPPG 424
           H++GGRQ+ WPPG
Sbjct: 175 HVLGGRQMKWPPG 187



>pir|C86437|C86437 F28K20.9 protein - Arabidopsis
           thaliana>gb:AE005172_891976 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F28K20_1678133 Arabidopsis thaliana
           chromosome 1 BAC F28K20 sequence, complete sequence.
          Length = 214

 Score =  154 bits (389), Expect = 1e-36
 Identities = 76/160 (47%), Positives = 108/160 (67%), Gaps = 27/160 (16%)
 Frame = +2

Query: 26  SHLSPHTPMASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP 205
           +H       A+ +   + +PTIFDKII KEIP++IVYED+ VLAFRDI+P+AP H+L+IP
Sbjct: 56  AHNEEAAAKAAASVADTGAPTIFDKIIAKEIPSDIVYEDENVLAFRDINPQAPVHVLVIP 115

Query: 206 KVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKD---------- 355
           K++DGLT L KAE RH E+LG+LL+ +K+VA++EG+  +GFR+VIN+G +          
Sbjct: 116 KLRDGLTSLGKAEPRHVEVLGQLLHASKIVAEKEGI-LDGFRVVINNGVEACKSFLFFSI 174

Query: 356 -----------------GGQTVFHIHLHLIGGRQLNWPPG 424
                             GQ+V+H+HLH++GGRQ+ WPPG
Sbjct: 175 QLSIIVLIHMTELTSSHSGQSVYHLHLHVLGGRQMKWPPG 214



>pir|AH2316|AH2316 protein kinase C inhibitor [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685076 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 122

 Score =  147 bits (372), Expect = 1e-34
 Identities = 73/125 (58%), Positives = 93/125 (74%)
 Frame = +2

Query: 50  MASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG 229
           M+S N +   + TIF KII +EIPANIVYEDD  LAF+D+ P+AP HIL+IP  K  L  
Sbjct: 1   MSSDNRMSETTETIFSKIIRREIPANIVYEDDLALAFKDVHPQAPVHILVIP--KQPLAK 58

Query: 230 LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           LS A+     +LG LL TAK VA++ GL ENG+R+VIN+G DGGQTV+H+HLH++GGR +
Sbjct: 59  LSDADSHDHALLGHLLLTAKRVAQEAGL-ENGYRVVINNGNDGGQTVYHLHLHILGGRPM 117

Query: 410 NWPPG 424
            WPPG
Sbjct: 118 AWPPG 122



>gb:AY860950_1354217 Bombyx mori protein kinase c inhibitor mRNA,
           complete cds.
          Length = 128

 Score =  140 bits (354), Expect = 1e-32
 Identities = 62/113 (54%), Positives = 89/113 (78%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KI+ KEIPAN +YED+Q +AF D++P+APTH+L+IP+    +  LS A++   ++L
Sbjct: 18  TIFGKILRKEIPANFIYEDEQCVAFNDVNPQAPTHVLVIPRKP--IPQLSLADDTDEQLL 75

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL  A+ +A Q GLD+ GFRLV+NDGK+G Q+V+H+H+H++GGRQ+ WPPG
Sbjct: 76  GHLLIVARKLAAQLGLDKTGFRLVVNDGKNGAQSVYHLHIHILGGRQMQWPPG 128



>gb:BC081526_2562356 Danio rerio zgc:103764, mRNA (cDNA clone
           MGC:103764 IMAGE:7087466), complete cds.
          Length = 126

 Score =  140 bits (353), Expect = 2e-32
 Identities = 65/113 (57%), Positives = 87/113 (76%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPANI+YEDDQ +AF D+ P+APTH L++P+    ++ +SK E+   E+L
Sbjct: 17  TIFGKIIRKEIPANIIYEDDQCIAFNDVAPQAPTHFLVVPRKP--ISQISKVEDADKELL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G ++  AK  A+Q GL   G+RLV+NDG DGGQ+V+HIH+H++GGRQL WPPG
Sbjct: 75  GHMMIVAKKCAEQVGLPR-GYRLVVNDGPDGGQSVYHIHIHVLGGRQLGWPPG 126



>gb:AP008231_579860 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 128

 Score =  140 bits (353), Expect = 2e-32
 Identities = 73/127 (57%), Positives = 90/127 (70%)
 Frame = +2

Query: 44  TPMASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGL 223
           TP+  GN + S+  TIF KII +EIPA+IVYEDD  LAFRD+ P+AP HIL+IP  K  +
Sbjct: 6   TPVLFGNWLMSED-TIFGKIIRREIPADIVYEDDLCLAFRDVAPQAPVHILVIP--KQPI 62

Query: 224 TGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGR 403
             L +A   H  +LG LL T K +A QEGL E G+R VIN G  GGQTV+H+H+HL+GGR
Sbjct: 63  ANLLEATAEHQALLGHLLLTVKAIAAQEGLTE-GYRTVINTGPAGGQTVYHLHIHLLGGR 121

Query: 404 QLNWPPG 424
            L WPPG
Sbjct: 122 SLAWPPG 128



>gb:AE013061_288644 Thermoanaerobacter tengcongensis MB4, section 88
           of 244 of the complete genome.>gb:AE008691_1110709
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 114

 Score =  140 bits (352), Expect = 2e-32
 Identities = 64/115 (55%), Positives = 86/115 (74%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KI+NKE+P+NIVYEDD V+AFRDI+P+AP HIL++PK  + +  L    E +  
Sbjct: 2   SECIFCKIVNKEVPSNIVYEDDLVVAFRDINPQAPVHILIVPK--EHIPTLLDVTEENKH 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           ++ R    AK +AK+EG+DE G+R+V N GKDGGQTV+H+H HL+GGR + WPPG
Sbjct: 60  LISRAYMVAKEIAKKEGIDEKGYRIVTNCGKDGGQTVYHLHFHLLGGRFMTWPPG 114



>gb:BC068885_2555382 Xenopus laevis hypothetical protein MGC82426,
           mRNA (cDNA clone MGC:82426 IMAGE:4680087), complete cds.
          Length = 177

 Score =  138 bits (348), Expect = 7e-32
 Identities = 65/124 (52%), Positives = 92/124 (74%)
 Frame = +2

Query: 53  ASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL 232
           A+ N V   SPTIF +II+K +PA+I+YED++ LAFRD++P+AP H L+IP++   +  +
Sbjct: 57  AARNRVSPTSPTIFSRIIDKTLPADIIYEDEKCLAFRDVNPQAPVHFLVIPRIP--IARI 114

Query: 233 SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
           S       E+LG LL TA  +A +EGL  +G+RLVINDG+ G Q+V+H+HLH+IGGRQ+ 
Sbjct: 115 SHVNASDTELLGHLLVTASSLAHKEGL-ADGYRLVINDGRHGAQSVYHLHLHVIGGRQMG 173

Query: 413 WPPG 424
           WPPG
Sbjct: 174 WPPG 177



>gb:BA000039_726781 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 114

 Score =  137 bits (345), Expect = 2e-31
 Identities = 68/113 (60%), Positives = 87/113 (76%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF +II +EIPA+IV+ED+  LAFRDI+P+AP HIL+IPK    +  LS AE     +L
Sbjct: 5   TIFSRIIRREIPADIVHEDELCLAFRDINPQAPVHILVIPKKP--IPQLSLAEPEDHRVL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL TAK +A+ EGL  NG+R+VIN+G DGGQTV+H+HLHL+GGR + WPPG
Sbjct: 63  GHLLLTAKRIAEAEGLT-NGYRVVINNGPDGGQTVYHLHLHLLGGRPMQWPPG 114



>gb:AB033882_2461543 Coturnix coturnix japonica mRNA for protein
           kinase C inhibitor, complete cds.>gb:AB033884_2461545
           Anas platyrhynchos mRNA for protein kinase C inhibitor,
           complete cds.
          Length = 126

 Score =  137 bits (344), Expect = 2e-31
 Identities = 67/125 (53%), Positives = 87/125 (69%)
 Frame = +2

Query: 50  MASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG 229
           ++   A      TIF KII KEIPANI+YED+Q LAF DI P+APTH L+IP  K  +  
Sbjct: 5   ISKAQAARPGGDTIFGKIIRKEIPANIIYEDEQCLAFHDISPQAPTHFLVIP--KKPIVR 62

Query: 230 LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           LS+AE+    +LG L+   K  A   GL  NGFR+V+N+G +GGQ+V+H+HLH++GGRQL
Sbjct: 63  LSEAEDSDESLLGHLMIVGKKCAANLGL-TNGFRMVLNEGPEGGQSVYHVHLHILGGRQL 121

Query: 410 NWPPG 424
            WPPG
Sbjct: 122 GWPPG 126



>gb:AB026675_2461161 Gallus gallus chPKCI mRNA for protein kinase C
           inhibitor, complete cds.>gb:AB026676_2461162 Gallus
           gallus chPKCI gene for protein kinase C inhibitor,
           complete cds.
          Length = 126

 Score =  136 bits (343), Expect = 3e-31
 Identities = 66/113 (58%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPANI+YED+Q LAF DI P+APTH L+IP  K  +  LS+AE+    +L
Sbjct: 17  TIFGKIIRKEIPANIIYEDEQCLAFHDISPQAPTHFLVIP--KKPIVRLSEAEDSDESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL  NGFR+V+N+G +GGQ+V+H+HLH++GGRQL WPPG
Sbjct: 75  GHLMIVGKKCAANLGL-TNGFRMVLNEGPEGGQSVYHVHLHILGGRQLGWPPG 126



>gb:AF539981_2500161 Taeniopygia guttata PKCI-Z-related protein
           mRNA, partial cds.
          Length = 124

 Score =  135 bits (341), Expect = 5e-31
 Identities = 65/113 (57%), Positives = 85/113 (75%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPANI++ED+Q LAF DI P+APTH L+IPK    +  LS+AE+    +L
Sbjct: 15  TIFGKIIRKEIPANIIFEDEQCLAFHDISPQAPTHFLVIPKKP--IVRLSEAEDSDESLL 72

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A + GL  NGFR+V+N+G +GGQ+V+H+HLH++GGRQL WPPG
Sbjct: 73  GHLMIVGKKCAAELGLT-NGFRMVVNEGPEGGQSVYHVHLHVLGGRQLGWPPG 124



>sp|P32084|YHIT_SYNP7 Hypothetical 12.4 kDa HIT-like protein in
           PSBAII 5'region (ORF 1).>pir|A35153|A35153 histidine
           triad protein homolog - Synechococcus
           sp.>gb:SYOPSBAII_195691 Synechococcus sp. photosystem II
           thylakoid membrane D1 protein (psbAII) and ORF 1 genes,
           5' end.
          Length = 114

 Score =  135 bits (341), Expect = 5e-31
 Identities = 68/113 (60%), Positives = 82/113 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA+IVYEDD  LAFRD+ P+AP HIL+IP  K  +  L +A   H  +L
Sbjct: 5   TIFGKIIRREIPADIVYEDDLCLAFRDVAPQAPVHILVIP--KQPIANLLEATAEHQALL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL T K +A QEGL E G+R VIN G  GGQTV+H+H+HL+GGR L WPPG
Sbjct: 63  GHLLLTVKAIAAQEGLTE-GYRTVINTGPAGGQTVYHLHIHLLGGRSLAWPPG 114



>gb:AF085236_1881729 Homo sapiens protein kinase C inhibitor-2 mRNA,
           complete cds.
          Length = 128

 Score =  135 bits (340), Expect = 6e-31
 Identities = 64/115 (55%), Positives = 87/115 (75%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           +PTIF +I++K +PA+I+YED Q L FRD+ P+AP H L+IPK    +  +S+AEE   +
Sbjct: 17  APTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKP--IPRISQAEEEDQQ 74

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +LG LL  AK  AK EGL + G+RLVINDGK G Q+V+H+H+H++GGRQL WPPG
Sbjct: 75  LLGHLLLVAKQTAKAEGLGD-GYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 128



>gb:AX530394_1469963 Sequence 7 from Patent
           WO0240674.>gb:AX530396_1469964 Sequence 9 from Patent
           WO0240674.>gb:AF356515_1898837 Homo sapiens HIT-17kDa
           mRNA, complete cds.>gb:AF356875_1898845 Homo sapiens
           histidine triad protein 3 mRNA, complete
           cds.>gb:AF490476_1904893 Homo sapiens histidine triad
           nucleotide binding protein 2 (HINT2) gene, complete
           cds.>gb:AL133410_1918511 Human DNA sequence from clone
           RP11-112J3 on chromosome 9p13.1-13.3 Contains the 3' end
           of the CA9 gene for carbonic anhydrase IX (MN), the TPM2
           gene for tropomyosin 2 (beta) (DA1, TMSB, AMCD1), the
           TLN1 gene for talin 1 (TLN, KIAA1027), the CREB3 gene
           for cAMP responsive element binding protein 3 (luman)
           (LZIP, LUMAN, MGC15333, MGC19782), the GBA2 gene for
           glucosidase, beta (bile acid) 2 (AD035, KIAA1605,
           MGC16895, DKFZp762K054), a novel gene (KIAA0258), five
           novel genes, the NPR2 gene for natriuretic peptide
           receptor B/guanylate cyclase B (atrionatriuretic peptide
           receptor B) (NPRB, ANPRB, GUC2B, NPRBi), the SPAG8 gene
           for sperm associated antigen 8 (SMP1, BS-84, HSD-1,
           hSMP-1, MGC26201), the HINT2 gene for Histidine triad
           nucleotide binding protein 2, the gene for NAG-5 protein
           (LOC51754), an olfactory receptor pseudogene, the gene
           for a novel seven transmembrane helix receptor, a NADH
           dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,13kDa
           (B13, NUFM, UQOR13, FLJ12147, CI-13KD-B) (NDUFA5)
           pseudogene and six CpG islands, complete
           sequence.>gb:AY033094_1934557 Homo sapiens HINT2 mRNA,
           complete cds.>gb:BC047737_1983993 Homo sapiens histidine
           triad nucleotide binding protein 2, mRNA (cDNA clone
           MGC:54098 IMAGE:6018376), complete cds.
          Length = 163

 Score =  135 bits (340), Expect = 6e-31
 Identities = 64/115 (55%), Positives = 87/115 (75%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           +PTIF +I++K +PA+I+YED Q L FRD+ P+AP H L+IPK    +  +S+AEE   +
Sbjct: 52  APTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKP--IPRISQAEEEDQQ 109

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +LG LL  AK  AK EGL + G+RLVINDGK G Q+V+H+H+H++GGRQL WPPG
Sbjct: 110 LLGHLLLVAKQTAKAEGLGD-GYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163



>gb:AF366940_1418953 Bos taurus histidine triad protein 3 mRNA,
           complete cds.
          Length = 163

 Score =  135 bits (340), Expect = 6e-31
 Identities = 64/115 (55%), Positives = 88/115 (76%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           +PTIF +I+++ +PA+I+YED Q LAFRD+ P+AP H L+IPK    +  +S+AEE   +
Sbjct: 52  APTIFSRILDRSLPADILYEDQQCLAFRDVAPQAPVHFLVIPKKP--IPRISQAEEEDQQ 109

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +LG LL  AK  AK EGL + G+RLVINDGK G Q+V+H+H+H++GGRQL WPPG
Sbjct: 110 LLGHLLLVAKETAKAEGLGD-GYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163



>gb:RRU09407_2138266 Rattus norvegicus putative protein kinase C
           inhibitor mRNA, complete cds.
          Length = 126

 Score =  134 bits (338), Expect = 1e-30
 Identities = 64/113 (56%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I+YEDDQ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 17  TIFGKIIRKEIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKY--ISQISAAEDDDESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL + G+R+V+N+G DGGQ+V+H+HLH++GGRQ+NWPPG
Sbjct: 75  GHLMIVGKKCAADLGL-KKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126



>gb:BTU09405_1437449 Bos taurus putative protein kinase C inhibitor
           mRNA, complete cds.
          Length = 126

 Score =  134 bits (338), Expect = 1e-30
 Identities = 64/113 (56%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I+YEDDQ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 17  TIFGKIIRKEIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKY--ISEISAAEDDDESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL + G+R+V+N+G DGGQ+V+H+HLH++GGRQ+NWPPG
Sbjct: 75  GHLMIVGKKCAADLGL-KKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126



>sp|P16436|HNT1_BOVIN Histidine triad nucleotide-binding protein 1
           (Adenosine 5'- monophosphoramidase) (Protein kinase C
           inhibitor 1) (Protein kinase C- interacting protein 1)
           (PKCI-1) (17 kDa inhibitor of protein kinase
           C).>pir|A35350|A35350 protein kinase C inhibitor -
           bovine
          Length = 125

 Score =  134 bits (338), Expect = 1e-30
 Identities = 64/113 (56%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I+YEDDQ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 16  TIFGKIIRKEIPAKIIYEDDQCLAFHDISPQAPTHFLVIPKKY--ISQISAAEDDDESLL 73

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL + G+R+V+N+G DGGQ+V+H+HLH++GGRQ+NWPPG
Sbjct: 74  GHLMIVGKKCAADLGL-KKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 125



>gb:BC087609_2565390 Xenopus tropicalis hypothetical LOC496618, mRNA
           (cDNA clone IMAGE:6981829), partial cds.
          Length = 191

 Score =  134 bits (337), Expect = 1e-30
 Identities = 64/124 (51%), Positives = 89/124 (71%)
 Frame = +2

Query: 53  ASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL 232
           A  N      PTIF +II++ +PA+I++EDD+ +AFRD++P+AP H L+IPK    +  L
Sbjct: 71  AERNGGSPSPPTIFSRIIDRTLPADIIHEDDKCVAFRDVNPQAPVHFLVIPKTP--IARL 128

Query: 233 SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
           S+      E+LG LL TA  +A +EGL + G+RLVINDGK G Q+V+H+HLH+IGGRQ+ 
Sbjct: 129 SQVNASDTELLGHLLVTASRLAHKEGLAD-GYRLVINDGKHGAQSVYHLHLHVIGGRQMG 187

Query: 413 WPPG 424
           WPPG
Sbjct: 188 WPPG 191



>sp|P53795|YHIT_CAEEL Hypothetical HIT-like protein
           F21C3.3.>pir|T21189|T21189 hypothetical protein F21C3.3
           - Caenorhabditis elegans>gb:CEF21C3_1362752
           Caenorhabditis elegans cosmid F21C3, complete sequence.
          Length = 130

 Score =  134 bits (337), Expect = 1e-30
 Identities = 64/125 (51%), Positives = 90/125 (72%)
 Frame = +2

Query: 50  MASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG 229
           +A+ N     + T+F KII KEIPA I++EDD+ LAF D+ P+AP H L+IPK +  +  
Sbjct: 9   LAAINKDVQANDTLFGKIIRKEIPAKIIFEDDEALAFHDVSPQAPIHFLVIPKRRIDM-- 66

Query: 230 LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           L  A +    ++G+L+ TA  VAKQ G+  NG+R+V+N+GKDG Q+VFH+HLH++GGRQL
Sbjct: 67  LENAVDSDAALIGKLMVTASKVAKQLGM-ANGYRVVVNNGKDGAQSVFHLHLHVLGGRQL 125

Query: 410 NWPPG 424
            WPPG
Sbjct: 126 QWPPG 130



>gb:OCHINT_1442178 Oryctolagus cuniculus mRNA for histidine triad
           nucleotide-binding protein 1 (HINT gene).
          Length = 126

 Score =  134 bits (336), Expect = 2e-30
 Identities = 63/113 (55%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I++EDDQ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 17  TIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL + G+R+V+N+G DGGQ+V+H+HLH++GGRQ+NWPPG
Sbjct: 75  GHLMIVGKKCAADLGL-KKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126



>sp|P80912|HNT1_RABIT Histidine triad nucleotide-binding protein 1
           (Adenosine 5'- monophosphoramidase) (P13.7).
          Length = 125

 Score =  134 bits (336), Expect = 2e-30
 Identities = 63/113 (55%), Positives = 84/113 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I++EDDQ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 16  TIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKH--ISQISAAEDADESLL 73

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL + G+R+V+N+G DGGQ+V+H+HLH++GGRQ+NWPPG
Sbjct: 74  GHLMIVGKKCAADLGL-KKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 125



>gb:BA000045_741004 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 114

 Score =  133 bits (334), Expect = 3e-30
 Identities = 64/116 (55%), Positives = 87/116 (75%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           ++ T+F KI+ +EIPA IV+ED++ LAFRDI+P+AP HIL+IP  K  +  L +      
Sbjct: 2   NTDTVFGKILRREIPAAIVFEDERALAFRDINPQAPVHILVIP--KRAIAQLEQVAPEDE 59

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +LG LLY A  VA+QEGLD +G+RLV+N+G  GGQTV+H+H+HL+GGR L WPPG
Sbjct: 60  ALLGHLLYVAVQVARQEGLD-SGYRLVVNNGVQGGQTVYHLHVHLLGGRMLAWPPG 114



>gb:AK004497_1152376 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1190005L05
           product:HIT-17KDA (PKCI-1-RELATED HIT PROTEIN) homolog
           [Homo sapiens], full insert
           sequence.>gb:AF356874_2064032 Mus musculus histidine
           triad protein 3 mRNA, complete cds.>gb:AY040765_2074390
           Mus musculus histidine triad protein 3 gene, complete
           cds.>gb:BC086940_2109865 Mus musculus cDNA clone
           MGC:107703 IMAGE:6775318, complete cds.
          Length = 163

 Score =  132 bits (332), Expect = 5e-30
 Identities = 60/115 (52%), Positives = 89/115 (77%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           SPTIF +I+++ +PA+I+YED Q L FRD+ P+AP H L+IP+    +  +S+AEE   +
Sbjct: 52  SPTIFSRILDRSLPADILYEDQQCLVFRDVAPQAPVHFLVIPRKP--IPRISQAEEDDQQ 109

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +LG LL  AK +A+ +GL ++G+RLV+NDGK G Q+V+H+H+H++GGRQL WPPG
Sbjct: 110 LLGHLLLVAKKIAQAQGL-KDGYRLVVNDGKMGAQSVYHLHIHVLGGRQLQWPPG 163



>gb:CR857292_1181536 Pongo pygmaeus mRNA; cDNA DKFZp469O2221 (from
           clone DKFZp469O2221).
          Length = 126

 Score =  130 bits (328), Expect = 1e-29
 Identities = 61/113 (53%), Positives = 86/113 (76%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I++EDD+ LAF DI P+APTH L+IPK    ++ +S AE+ +  +L
Sbjct: 17  TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDNESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL++ G+R+V+N+G DGGQ+V+H+HLH++GGRQ++WPPG
Sbjct: 75  GHLMIVGKKCAADLGLNK-GYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126



>gb:AK002965_1151567 Mus musculus adult male brain cDNA, RIKEN
           full-length enriched library, clone:0710001J24
           product:histidine triad nucleotide binding protein, full
           insert sequence.>gb:AK012433_1156955 Mus musculus 11
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700055H04 product:histidine triad
           nucleotide binding protein, full insert
           sequence.>gb:AL954817_2073200 Mouse DNA sequence from
           clone RP24-84L18 on chromosome 11 Contains the 5' end of
           the gene for a novel protein similar to human non-kinase
           Cdc42 effector protein SPEC2, a heterogeneous nuclear
           ribonucleoprotein A3 (Hnrpa3) pseudogene, three novel
           genes, the Hint1 gene for histidine triad nucleotide
           binding protein and two CpG islands, complete
           sequence.>gb:BC070415_2106257 Mus musculus histidine
           triad nucleotide binding protein 1, mRNA (cDNA clone
           MGC:99939 IMAGE:5714321), complete
           cds.>gb:BC080296_2107745 Mus musculus histidine triad
           nucleotide binding protein 1, mRNA (cDNA clone MGC:90833
           IMAGE:6814185), complete cds.>gb:MMU60001_2122704 Mus
           musculus protein kinase C inhibitor (mPKCI) mRNA,
           complete cds.
          Length = 126

 Score =  130 bits (328), Expect = 1e-29
 Identities = 63/125 (50%), Positives = 86/125 (68%)
 Frame = +2

Query: 50  MASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG 229
           +A          TIF KII KEIPA I++EDD+ LAF DI P+APTH L+IPK    ++ 
Sbjct: 5   IAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQ 62

Query: 230 LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           +S A++    +LG L+   K  A   GL + G+R+V+N+G DGGQ+V+HIHLH++GGRQ+
Sbjct: 63  ISVADDDDESLLGHLMIVGKKCAADLGL-KRGYRMVVNEGADGGQSVYHIHLHVLGGRQM 121

Query: 410 NWPPG 424
           NWPPG
Sbjct: 122 NWPPG 126



>sp|P70349|HNT1_MOUSE Histidine triad nucleotide-binding protein 1
           (Adenosine 5'- monophosphoramidase) (Protein kinase C
           inhibitor 1) (Protein kinase C- interacting protein 1)
           (PKCI-1).
          Length = 125

 Score =  130 bits (328), Expect = 1e-29
 Identities = 63/125 (50%), Positives = 86/125 (68%)
 Frame = +2

Query: 50  MASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTG 229
           +A          TIF KII KEIPA I++EDD+ LAF DI P+APTH L+IPK    ++ 
Sbjct: 4   IAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQ 61

Query: 230 LSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           +S A++    +LG L+   K  A   GL + G+R+V+N+G DGGQ+V+HIHLH++GGRQ+
Sbjct: 62  ISVADDDDESLLGHLMIVGKKCAADLGL-KRGYRMVVNEGADGGQSVYHIHLHVLGGRQM 120

Query: 410 NWPPG 424
           NWPPG
Sbjct: 121 NWPPG 125



>gb:BC078475_2561016 Xenopus laevis MGC85233 protein, mRNA (cDNA
           clone MGC:85233 IMAGE:6872685), complete cds.
          Length = 126

 Score =  130 bits (327), Expect = 2e-29
 Identities = 62/113 (54%), Positives = 81/113 (71%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I+YED+Q +AF D+ P+AP H L++PK    +T LSKA+    E+L
Sbjct: 17  TIFGKIIRKEIPAKIIYEDEQCIAFHDVAPQAPVHFLVVPK--KFITQLSKADASDKELL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+      A   GL  NG+RLV+N+G DGGQ+V+H+HLH+ GGRQ+ WPPG
Sbjct: 75  GHLMIVGSKCAADLGLT-NGYRLVVNEGPDGGQSVYHLHLHVFGGRQMGWPPG 126



>gb:AJ821828_1814268 Guillardia theta partial mRNA for putative
           protein kinase C inhibitor (pkci gene).
          Length = 181

 Score =  130 bits (326), Expect = 3e-29
 Identities = 60/113 (53%), Positives = 83/113 (73%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIFDKI+ K IP+ +V+EDD+VL F+DI+P+APTH+L+IPK ++ L+ L  A   H  IL
Sbjct: 71  TIFDKIVAKSIPSQVVFEDDKVLVFKDINPQAPTHLLVIPKRRETLSQLRFATAEHEGIL 130

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G +L     VA +EGL +  +RLV+NDG+  GQ VFH+H+H++ GR L WPPG
Sbjct: 131 GHMLAVVAKVASEEGLGD--YRLVVNDGRGAGQEVFHLHMHVLAGRPLTWPPG 181



>gb:AX888112_1483565 Sequence 3975 from Patent
           EP1033401.>gb:BC001287_1967456 Homo sapiens histidine
           triad nucleotide binding protein 1, mRNA (cDNA clone
           MGC:5161 IMAGE:3458182), complete
           cds.>gb:BC007090_1970515 Homo sapiens histidine triad
           nucleotide binding protein 1, mRNA (cDNA clone MGC:14708
           IMAGE:4250172), complete cds.>gb:CR457048_1993255 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834B0615D for gene HINT1, histidine triad
           nucleotide binding protein 1; complete cds, incl.
           stopcodon.>gb:HSU27143_2023092 Human protein kinase C
           inhibitor-I cDNA, complete cds.>gb:HSU51004_2024676 Homo
           sapiens protein kinase C inhibitor (PKCI-1) mRNA,
           complete cds.
          Length = 126

 Score =  130 bits (326), Expect = 3e-29
 Identities = 61/113 (53%), Positives = 85/113 (75%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I++EDD+ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 17  TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDDESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL++ G+R+V+N+G DGGQ+V+H+HLH++GGRQ++WPPG
Sbjct: 75  GHLMIVGKKCAADLGLNK-GYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126



>gb:AY142815_591998 Heliobacillus mobilis Hit family protein gene,
           partial cds.
          Length = 143

 Score =  130 bits (326), Expect = 3e-29
 Identities = 63/115 (54%), Positives = 83/115 (72%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KI+ KEIPA IVYEDD V+AF+DI+P APTHIL+IP+  + ++ ++ AE  H  
Sbjct: 31  SDCIFCKIVRKEIPAQIVYEDDVVVAFKDINPAAPTHILIIPR--EHISSIAAAEASHQA 88

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           ILG+LL  ++ V    G++ +  RLVIN G D GQTVFH+H+HL+ GR L WPPG
Sbjct: 89  ILGQLLLASQKVTAALGIEPDKHRLVINTGADAGQTVFHLHVHLLAGRNLGWPPG 143



>sp|P49773|HNT1_HUMAN Histidine triad nucleotide-binding protein 1
           (Adenosine 5'- monophosphoramidase) (Protein kinase C
           inhibitor 1) (Protein kinase C- interacting protein 1)
           (PKCI-1).
          Length = 125

 Score =  130 bits (326), Expect = 3e-29
 Identities = 61/113 (53%), Positives = 85/113 (75%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I++EDD+ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 16  TIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDDESLL 73

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL++ G+R+V+N+G DGGQ+V+H+HLH++GGRQ++WPPG
Sbjct: 74  GHLMIVGKKCAADLGLNK-GYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 125



>gb:BX294150_770414 Pirellula sp. strain 1 complete genome; segment
           18/24.
          Length = 112

 Score =  129 bits (324), Expect = 4e-29
 Identities = 65/113 (57%), Positives = 81/113 (71%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           +IF KII KEIPA+IVYEDD  LAFRDI PKAPTHIL+IPK +  +  L+   +    ++
Sbjct: 3   SIFSKIIAKEIPADIVYEDDLCLAFRDIAPKAPTHILVIPKRE--IVSLADLTDEDQAVM 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           GR +  A  VA  EGL + GFRLV+N G DGGQ V H+H HL+GGR++ WPPG
Sbjct: 61  GRCVVVASKVAADEGLGD-GFRLVVNTGSDGGQEVPHVHFHLLGGRKMTWPPG 112



>gb:AK026557_1910655 Homo sapiens cDNA: FLJ22904 fis, clone
           KAT05632.
          Length = 126

 Score =  128 bits (322), Expect = 7e-29
 Identities = 60/113 (53%), Positives = 85/113 (75%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA I++EDD+ LAF DI P+APTH L+IPK    ++ +S AE+    +L
Sbjct: 17  TIFGKIIREEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKH--ISQISVAEDDDESLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   K  A   GL++ G+R+V+N+G DGGQ+V+H+HLH++GGRQ++WPPG
Sbjct: 75  GHLMIVGKKCAADLGLNK-GYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126



>gb:PFMAL8P1_1192164 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered
           pieces.>gb:AF056206_1237043 Plasmodium falciparum
           putative protein kinase C interacting protein 1 (pkci1)
           gene, complete cds.
          Length = 130

 Score =  128 bits (321), Expect = 1e-28
 Identities = 61/124 (49%), Positives = 88/124 (70%)
 Frame = +2

Query: 53  ASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGL 232
           A+G     DS  IF KI   E+P + VYEDD+V+AF DI P+AP HI++IPK +DGLT L
Sbjct: 11  AAGKDENGDS--IFGKIARGEVPVDAVYEDDKVIAFNDIYPQAPVHIIVIPKRRDGLTRL 68

Query: 233 SKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
           SKAEE+H EILG L++    + ++  L +  FRLV+N+G +  Q+++++HLH++  RQ+ 
Sbjct: 69  SKAEEKHKEILGHLMWAVAEIVRKNNLGD--FRLVVNNGPEACQSIYYLHLHILAKRQMK 126

Query: 413 WPPG 424
           WPPG
Sbjct: 127 WPPG 130



>sp|P73481|YHIT_SYNY3 Hypothetical HIT-like protein
           slr1234.>pir|S77418|S77418 histidine triad-like protein
           - Synechocystis sp. (strain PCC 6803)>gb:BA000022_688300
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 114

 Score =  125 bits (313), Expect = 8e-28
 Identities = 65/113 (57%), Positives = 80/113 (70%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA IVYEDD  LAF+D++P+AP H+LLIP  K  L  LS A      +L
Sbjct: 5   TIFSKIIRREIPAAIVYEDDLCLAFKDVNPQAPVHVLLIP--KKPLPQLSAATPEDHALL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL  AK VA   G+ +  FRLVIN+G + GQTVFH+HLH++GGR  +WPPG
Sbjct: 63  GHLLLKAKEVAADLGIGDQ-FRLVINNGAEVGQTVFHLHLHILGGRPFSWPPG 114



>gb:AE017296_434493 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 10 of 14 of the
           complete sequence.>gb:AE016823_1067504 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 116

 Score =  124 bits (311), Expect = 1e-27
 Identities = 60/117 (51%), Positives = 80/117 (68%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH 253
           +D   IF KII KEIP+ +V+E+D++LAF DI P+AP HI+ IPK    +  LS+ E   
Sbjct: 2   TDPNCIFCKIIRKEIPSKVVFENDEILAFYDISPQAPVHIVFIPKKH--IPSLSEIENED 59

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
             +LG +L   +  AK  G  ENG+R+V N GK+GGQTVFHIH HL+  R+L+WPPG
Sbjct: 60  SHLLGNILLQIRDTAKNLGFAENGYRVVNNTGKNGGQTVFHIHFHLLAERRLHWPPG 116



>gb:AE011324_271673 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 133 of 397 of the complete
           sequence.>gb:AE010300_1005072 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 122

 Score =  124 bits (311), Expect = 1e-27
 Identities = 60/117 (51%), Positives = 80/117 (68%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH 253
           +D   IF KII KEIP+ +V+E+D++LAF DI P+AP HI+ IPK    +  LS+ E   
Sbjct: 8   TDPNCIFCKIIRKEIPSKVVFENDEILAFYDISPQAPVHIVFIPKKH--IPSLSEIENED 65

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
             +LG +L   +  AK  G  ENG+R+V N GK+GGQTVFHIH HL+  R+L+WPPG
Sbjct: 66  SHLLGNILLQIRDTAKNLGFAENGYRVVNNTGKNGGQTVFHIHFHLLAERRLHWPPG 122



>gb:AE016775_329872 Pseudomonas putida KT2440 section 2 of 21 of the
           complete genome.>gb:AE015451_944949 Pseudomonas putida
           KT2440 complete genome.
          Length = 112

 Score =  124 bits (310), Expect = 2e-27
 Identities = 59/112 (52%), Positives = 83/112 (74%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KIIN+EIPA+I+YEDDQ+LAF+DI P AP H L+IP  K  +  L+   E    + G
Sbjct: 4   LFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIP--KKHIRTLNDLTEEDKALAG 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +L+TA+ +A ++G +E GFR+V+N    GGQTV+HIH+H++G RQ+NWPPG
Sbjct: 62  HILFTAQRLAVEQGCEE-GFRVVMNCNPKGGQTVYHIHMHVLGQRQMNWPPG 112



>gb:AE014134_1127225 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003582_1216433 Drosophila melanogaster
           chromosome 2L, section 9 of 83 of the complete sequence.
          Length = 126

 Score =  123 bits (309), Expect = 2e-27
 Identities = 57/113 (50%), Positives = 82/113 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KI+ KEIP   ++EDD+ +AF D+ P+APTH L+IP+    +  LS AE+   ++L
Sbjct: 17  TIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKP--IAQLSLAEDGDADLL 74

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   + VAK+ GL + G+R+VIN+GK G Q+V+H+HLH +GGRQ+ WPPG
Sbjct: 75  GHLMLVGRKVAKELGLAD-GYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 126



>gb:AE014134_1127224 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003582_1216432 Drosophila melanogaster
           chromosome 2L, section 9 of 83 of the complete
           sequence.>gb:AY070643_1294788 Drosophila melanogaster
           RH02823 full length cDNA.>gb:AY071745_1295829 Drosophila
           melanogaster RH49748 full length cDNA.
          Length = 150

 Score =  123 bits (309), Expect = 2e-27
 Identities = 57/113 (50%), Positives = 82/113 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KI+ KEIP   ++EDD+ +AF D+ P+APTH L+IP+    +  LS AE+   ++L
Sbjct: 41  TIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKP--IAQLSLAEDGDADLL 98

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G L+   + VAK+ GL + G+R+VIN+GK G Q+V+H+HLH +GGRQ+ WPPG
Sbjct: 99  GHLMLVGRKVAKELGLAD-GYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150



>gb:CR628336_112930 Legionella pneumophila str. Paris complete
           genome.
          Length = 113

 Score =  123 bits (308), Expect = 3e-27
 Identities = 58/112 (51%), Positives = 77/112 (68%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI   EIPA +V+ED  +LAFRDI P+APTH+L+IPK    +  ++   +   E+L 
Sbjct: 4   LFCKIAQGEIPATVVFEDKNILAFRDIRPQAPTHLLIIPKKH--IATINDVNDGDSELLA 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +L  AK +A+ EGL E G+RLV N    GGQ V+HIHLHL+GGRQ+ WPPG
Sbjct: 62  NILIRAKKLAQAEGLSETGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG 113



>sp|O66536|YHIT_AQUAE Hypothetical HIT-like protein
           AQ_141.>pir|E70313|E70313 histidine triad-like protein
           pkcI - Aquifex aeolicus>gb:AE000675_25887 Aquifex
           aeolicus VF5 section 7 of 109 of the complete
           genome.>gb:AE000657_976418 Aquifex aeolicus VF5 complete
           genome.
          Length = 121

 Score =  122 bits (307), Expect = 4e-27
 Identities = 62/117 (52%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  E+PA  VYEDD+VLAF DI+P AP HIL+IPK    + G+   E     ++G
Sbjct: 7   IFCKIVRGEVPAKKVYEDDKVLAFHDINPVAPVHILIIPKKH--IMGIQTLEPEDECLVG 64

Query: 269 RLLYTAKLVAKQEGL--DEN---GFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            + Y A+ +A+  G+  DEN   G+RLV N GKD GQ+VFH+HLHLIGGR+++WPPG
Sbjct: 65  HMFYVARKIAEDLGIAPDENLNKGYRLVFNVGKDAGQSVFHLHLHLIGGREMSWPPG 121



>gb:BX572099_798938 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 113

 Score =  122 bits (306), Expect = 5e-27
 Identities = 62/113 (54%), Positives = 79/113 (69%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF +++  EIP + VY D++ LAFRDI P+AP H+L+IP+    L  L  A+    E+L
Sbjct: 5   TIFGQMLRGEIPFDEVYSDERCLAFRDIQPQAPVHVLVIPRKP--LDSLRAADSTDSELL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL  A  VAKQEGLD+  FR VIN G + GQTVFH+H+H+IGGR L WPPG
Sbjct: 63  GHLLLVAARVAKQEGLDD--FRTVINSGLEAGQTVFHLHVHVIGGRPLAWPPG 113



>gb:CR628337_115887 Legionella pneumophila str. Lens complete
           genome.>gb:AE017354_461102 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete genome.
          Length = 113

 Score =  122 bits (306), Expect = 5e-27
 Identities = 58/112 (51%), Positives = 77/112 (68%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI   EIPA +V+ED  +LAFRDI P+APTH+L+IPK    +  ++   +   E+L 
Sbjct: 4   LFCKIAQGEIPATVVFEDKNILAFRDIRPQAPTHLLIIPKKH--IATINDVNDDDSELLA 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +L  AK +A+ EGL E G+RLV N    GGQ V+HIHLHL+GGRQ+ WPPG
Sbjct: 62  NILIRAKKLAQAEGLSEMGYRLVFNVNSGGGQEVYHIHLHLLGGRQMTWPPG 113



>gb:AE016858_350054 Pseudomonas syringae pv. tomato str. DC3000
           section 3 of 21 of the complete
           genome.>gb:AE016853_1035229 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 112

 Score =  122 bits (305), Expect = 7e-27
 Identities = 60/113 (53%), Positives = 83/113 (73%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F KIIN+EIPA I+YEDDQVLAF DI P+AP H L+IP  K  +  L+   E    + 
Sbjct: 3   TLFTKIINREIPAKIIYEDDQVLAFHDIAPQAPVHFLVIP--KKPIRTLNDLTEEDKGLA 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G +L+TA+ +A + G +E GFR+V+N  + GGQTV+HIH+H++G RQ++WPPG
Sbjct: 61  GHILFTAQRLAIELGCEE-GFRVVMNCNELGGQTVYHIHMHVLGQRQMSWPPG 112



>sp|P36950|YCFF_ECOLI HIT-like protein ycfF.>pir|A99814|A99814
           hypothetical protein ECs1481 [imported] - Escherichia
           coli  (strain O157:H7, substrain RIMD
           0509952)>pir|E85673|E85673 histidine triad-like protein
           ycfF - Escherichia coli (strain O157:H7, substrain
           EDL933)>pir|JC5685|JC5685 histidine triad-like protein
           ycfF - Escherichia coli (strain K-12)>gb:AE005174_65782
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:AE005674_70689 Shigella flexneri 2a str. 301,
           complete genome.>gb:D90745_121985 Escherichia coli K12
           genomic DNA. (24.8 - 25.2 min).>gb:D90746_121993
           Escherichia coli K12 genomic DNA. (25.0 - 25.4
           min).>gb:U00096_200173 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016981_371061 Shigella flexneri 2a
           str. 2457T section 4 of 16 of the complete
           genome.>gb:BA000007_659493 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014073_995811 Shigella flexneri 2a
           str. 2457T complete genome.
          Length = 119

 Score =  121 bits (303), Expect = 1e-26
 Identities = 56/108 (51%), Positives = 80/108 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIP++IVY+DD V AFRDI P+APTHIL+IP +   +  ++     H + L
Sbjct: 5   TIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNIL--IPTVNDVSAEHEQAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A+QEG+ E+G+RL++N  + GGQ V+HIH+HL+GGR L
Sbjct: 63  GRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPL 110



>gb:AE017153_392505 Haemophilus ducreyi strain 35000HP section 3 of
           6 of the complete genome.>gb:AE017143_1026767
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 120

 Score =  120 bits (300), Expect = 3e-26
 Identities = 61/108 (56%), Positives = 76/108 (70%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPANIVY+DD V AFRDI P+APTHIL++P          K E+    IL
Sbjct: 9   TIFSKIIRKEIPANIVYQDDLVTAFRDIAPQAPTHILIVPNKLIPTINHIKTEDE--MIL 66

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GRL   A  +A+QEG+  +G+RL++N  K GGQ VFHIH+HL+GG+ L
Sbjct: 67  GRLFTVAAQIAEQEGIAADGYRLIMNCNKHGGQEVFHIHMHLVGGKPL 114



>gb:BA000031_706424 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 116

 Score =  119 bits (299), Expect = 3e-26
 Identities = 59/108 (54%), Positives = 80/108 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA+I+Y+DD V AFRDI+P+AP+HIL+IP      T   +AE+    ++
Sbjct: 5   TIFSKIIRKEIPADILYQDDLVTAFRDINPRAPSHILIIPNKLIPTTNDVEAEDE--AMM 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GRL   AK +AK+EG+ E+G+RL++N    GGQ V+HIH+HL+GGR L
Sbjct: 63  GRLFTVAKKLAKEEGIAEDGYRLILNCNPHGGQEVYHIHMHLLGGRPL 110



>gb:BA000016_675064 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 114

 Score =  119 bits (299), Expect = 3e-26
 Identities = 55/115 (47%), Positives = 78/115 (67%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KI+  EIP+  +YEDD+VLAF DI P+AP H L+IPK  + +  L++  E + E
Sbjct: 2   SDCIFCKIVAGEIPSKKIYEDDKVLAFHDISPEAPVHFLVIPK--EHIASLNEVNEENAE 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +   +  T   + K++ + E+G+R+V N G+ GGQTV HIH H++GGR LNWPPG
Sbjct: 60  VFAHIFKTINKLVKEQEVAEDGYRVVTNCGEQGGQTVGHIHFHVLGGRNLNWPPG 114



>pir|AF0643|AF0643 probable protein kinase C inhibitor STY1245
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:CP000026_76457 Salmonella
           enterica subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008752_242906 Salmonella typhimurium LT2,
           section 56 of 220 of the complete
           genome.>gb:AE016839_345807 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 6 of 16 of the
           complete genome.>gb:AL627269_541461 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 5/20.>gb:AE014613_983139 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_999988 Salmonella typhimurium LT2,
           complete genome.
          Length = 119

 Score =  119 bits (298), Expect = 4e-26
 Identities = 55/108 (50%), Positives = 80/108 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIP++IVY+D+ V AFRDI P+APTHIL+IP +   +  ++     H + L
Sbjct: 5   TIFSKIIRREIPSDIVYQDELVTAFRDISPQAPTHILIIPNIL--IPTVNDVTAEHEQAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A+QEG+ E+G+RL++N  + GGQ V+HIH+HL+GGR L
Sbjct: 63  GRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPL 110



>gb:BX571868_787682 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 10/17.
          Length = 118

 Score =  118 bits (296), Expect = 8e-26
 Identities = 56/108 (51%), Positives = 79/108 (73%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIP++IVY+DD V AFRDI P+APTHIL+IP V   +  ++  +  H   L
Sbjct: 5   TIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNVL--IPTMNDVKPEHEAAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A+QEG+ E+G+RL++N  +  GQ V+HIH+HL+GGR L
Sbjct: 63  GRMMTVAAKIAEQEGIAEDGYRLIMNCNRHAGQEVYHIHMHLVGGRYL 110



>gb:AE016827_342027 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 149

 Score =  118 bits (295), Expect = 1e-25
 Identities = 60/108 (55%), Positives = 76/108 (70%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA+I+Y+DD V AFRDI P+A THIL+IP           AE+    +L
Sbjct: 38  TIFSKIIRKEIPADIIYQDDLVTAFRDIAPQAKTHILIIPNKLIPTVNDVTAEDE--AVL 95

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GRL  TA  +AK EG+ E+G+RL++N  K GGQ VFHIH+HL+GG +L
Sbjct: 96  GRLFITAAKIAKLEGIAEDGYRLIVNCNKHGGQEVFHIHMHLLGGEKL 143



>gb:AE016759_325398 Escherichia coli CFT073 section 5 of 18 of the
           complete genome.>gb:AE014075_955982 Escherichia coli
           CFT073 complete genome.
          Length = 125

 Score =  118 bits (295), Expect = 1e-25
 Identities = 54/105 (51%), Positives = 78/105 (74%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIP++IVY+DD V AFRDI P+APTHIL+IP +   +  ++     H + L
Sbjct: 11  TIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNIL--IPTVNDVSAEHEQAL 68

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
           GR++  A  +A+QEG+ E+G+RL++N  + GGQ V+HIH+HL+GG
Sbjct: 69  GRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGG 113



>gb:BX569689_775230 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 113

 Score =  117 bits (293), Expect = 2e-25
 Identities = 60/113 (53%), Positives = 77/113 (68%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KI+  +IP + VY DD+ LAFRDI P+AP H+L+IP+    +  L  A      +L
Sbjct: 5   TIFGKILRGDIPCDEVYSDDRCLAFRDIAPQAPVHVLVIPR--QPIESLRSAGSGDEALL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL  A  VA+QEGL++  FR VIN G   GQTVFH+H+H+IGGR L+WPPG
Sbjct: 63  GHLLLVAARVARQEGLED--FRTVINSGAAAGQTVFHLHVHVIGGRPLDWPPG 113



>gb:AE017340_456477 Idiomarina loihiensis L2TR, complete genome.
          Length = 122

 Score =  117 bits (293), Expect = 2e-25
 Identities = 53/112 (47%), Positives = 79/112 (70%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KIIN++IPA+I+YEDD+ LAF+DI+P+AP H L+IP  K  +   +   E +  ++
Sbjct: 5   TIFTKIINRDIPADIIYEDDKALAFKDINPQAPFHCLIIP--KQPIATANDINEDNAGLV 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPP 421
           G L   A  +A +    ++G+RLV+N  + GGQTV+HIHLH++ G+Q+ WPP
Sbjct: 63  GHLYVVAAKLAAEHNFSQDGYRLVMNCNEYGGQTVYHIHLHMLAGKQMGWPP 114



>gb:AE017161_394538 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030207 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 113

 Score =  117 bits (293), Expect = 2e-25
 Identities = 58/113 (51%), Positives = 78/113 (69%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF +I+  EI  + +Y D+  LAFRDI P+AP HIL+IP+    +  L +AE +   +L
Sbjct: 5   TIFSRILRGEIDCDEIYSDEMCLAFRDIQPQAPVHILVIPR--KAIPSLREAEIQDESLL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL  +  +AK EGL  N +R VIN G + GQTVFH+H+H+IGGR+LNWPPG
Sbjct: 63  GHLLLVSAKIAKLEGL--NHWRTVINSGSEAGQTVFHLHIHVIGGRKLNWPPG 113



>gb:BX950851_840550 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 116

 Score =  116 bits (291), Expect = 3e-25
 Identities = 55/108 (50%), Positives = 78/108 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F KII +EIPA+IVY+D+ V AFRDI P+ PTHIL++P V   +  ++     H   L
Sbjct: 5   TLFSKIIRREIPADIVYQDELVTAFRDIAPRTPTHILIVPNVL--IPTVNDTAPEHEAAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A+QEG+ E+G+RL+IN  + GGQ V+HIH+HL+GGR L
Sbjct: 63  GRMVTVAGKIAQQEGIAEDGYRLIINCNRHGGQEVYHIHMHLVGGRAL 110



>pir|G64162|G64162 histidine triad protein homolog HI0961 -
           Haemophilus influenzae (strain Rd KW20)>gb:U32777_204633
           Haemophilus influenzae Rd KW20 section 92 of 163 of the
           complete genome.>gb:L42023_1097182 Haemophilus
           influenzae Rd KW20 complete genome.
          Length = 130

 Score =  116 bits (291), Expect = 3e-25
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 1/109 (0%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP-KVKDGLTGLSKAEERHCEI 262
           TIF KII KEIPANIVY+D+ V AFRDI P+A THIL+IP KV   +  +++ +E     
Sbjct: 19  TIFSKIIRKEIPANIVYQDELVTAFRDISPQAKTHILIIPNKVIPTVNDVTEQDE---VA 75

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           LGRL   A  +AK+EG+ E+G+RL++N  K GGQ VFH+H+HL+GG  L
Sbjct: 76  LGRLFSVAAKLAKEEGVAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPL 124



>sp|P44956|YCFF_HAEIN HIT-like protein HI0961.
          Length = 116

 Score =  116 bits (291), Expect = 3e-25
 Identities = 60/109 (55%), Positives = 79/109 (72%), Gaps = 1/109 (0%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP-KVKDGLTGLSKAEERHCEI 262
           TIF KII KEIPANIVY+D+ V AFRDI P+A THIL+IP KV   +  +++ +E     
Sbjct: 5   TIFSKIIRKEIPANIVYQDELVTAFRDISPQAKTHILIIPNKVIPTVNDVTEQDE---VA 61

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           LGRL   A  +AK+EG+ E+G+RL++N  K GGQ VFH+H+HL+GG  L
Sbjct: 62  LGRLFSVAAKLAKEEGVAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPL 110



>gb:CP000020_871310 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 116

 Score =  116 bits (290), Expect = 4e-25
 Identities = 55/108 (50%), Positives = 78/108 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA++VY+DD V AFRDI+P+AP+H+L+IP      T   + E+    ++
Sbjct: 5   TIFSKIIRKEIPADVVYQDDLVTAFRDINPRAPSHVLIIPNKLIPTTNDVEPEDE--LVM 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GRL   A+ +A+ EG+ E+G+RL++N    GGQ V+HIH+HL+GGR L
Sbjct: 63  GRLFTVARKIAQDEGIAEDGYRLIVNCNPHGGQEVYHIHMHLVGGRPL 110



>pir|AF0196|AF0196 conserved hypothetical protein YPO1611 [imported]
           - Yersinia pestis (strain CO92)>gb:AE013780_300080
           Yersinia pestis KIM section 180 of 415 of the complete
           genome.>gb:AE017135_388026 Yersinia pestis biovar
           Medievalis str. 91001 section 9 of 16 of the complete
           genome.>gb:AJ414149_523426 Yersinia pestis strain CO92
           complete genome; segment 9/20.>gb:BX936398_837096
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_930263 Yersinia pestis KIM
           complete genome.>gb:AE017042_1144592 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 117

 Score =  116 bits (290), Expect = 4e-25
 Identities = 56/108 (51%), Positives = 78/108 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA++VY+D+ V AFRDI P+APTHIL+IP V   +  ++     H   L
Sbjct: 5   TIFSKIIRREIPADVVYQDELVTAFRDIAPQAPTHILIIPNVL--IPTVNDVTAEHEAAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A+QEG+ E+G+RL+IN     GQ V+HIH+HL+GGR+L
Sbjct: 63  GRMVTVAAKLAEQEGIAEDGYRLIINCNHHAGQVVYHIHMHLVGGREL 110



>gb:CR378670_95764 Photobacterium profundum SS9; segment 8/12.
          Length = 116

 Score =  115 bits (287), Expect = 8e-25
 Identities = 55/108 (50%), Positives = 79/108 (73%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA+++Y+DD V AFRDI+P+AP+HIL+IP          +AE+    ++
Sbjct: 5   TIFSKIIRKEIPADVLYQDDLVTAFRDINPRAPSHILIIPNKLIPTVNDVEAEDE--VMM 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR+   A+ +A++EG+ ENG+RL++N    GGQ V+HIH+HL+GGR L
Sbjct: 63  GRMFTVARKLAEKEGVAENGYRLIVNCNPHGGQEVYHIHMHLLGGRPL 110



>pir|G82143|G82143 Hit family protein VC1897 [imported] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004265_52275
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, section 173 of 251 of the complete
           chromosome.>gb:AE003852_1053049 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 116

 Score =  115 bits (287), Expect = 8e-25
 Identities = 56/108 (51%), Positives = 77/108 (71%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KI+ +EIPA+I+Y+D+ V AFRDI P+AP+HIL+IP     +  ++  E      L
Sbjct: 5   TIFSKIVRREIPADILYQDELVTAFRDIHPRAPSHILIIPNKL--IPTVNDVEVEDELAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GRL   AK +A+QEG+ ENG+RL++N    GGQ V+HIH+HL+GGR L
Sbjct: 63  GRLFTVAKKIAEQEGIAENGYRLIMNCNSHGGQEVYHIHMHLVGGRPL 110



>gb:AE015943_321091 Clostridium tetani E88, section 8 of 10 of the
           complete genome.>gb:AE015927_963880 Clostridium tetani
           E88, complete genome.
          Length = 114

 Score =  114 bits (284), Expect = 2e-24
 Identities = 53/112 (47%), Positives = 76/112 (67%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  +IP+  VYED+ +LAF+DI P APTH+L+IPK    +  L++  +   +I+ 
Sbjct: 5   IFCKIVKGDIPSEKVYEDELILAFKDISPSAPTHVLVIPKKH--IKNLNELSDNDAKIIS 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +    K +A+Q  ++E G+R+V N G+ GGQTV HIH HL+GGR L WPPG
Sbjct: 63  HIYIKIKELAQQLDINEKGYRVVTNCGEQGGQTVEHIHFHLLGGRNLQWPPG 114



>gb:AE010489_263673 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 31 of 197 of the complete
           genome.>gb:AE009951_910841 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 112

 Score =  114 bits (284), Expect = 2e-24
 Identities = 54/108 (50%), Positives = 78/108 (72%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F KIINKEIPANIVYEDD V+AF+DI P AP H+L++PK +  +  ++   +    ++
Sbjct: 3   TLFTKIINKEIPANIVYEDDDVIAFKDIAPVAPVHVLVVPKKE--IPTINDITDEDTLLI 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           G++      +AK+ G+D++G+R+V N  + GGQTVFHIH HLIGG +L
Sbjct: 61  GKVYRVIGKLAKEFGIDKDGYRVVSNCNEHGGQTVFHIHFHLIGGEKL 108



>gb:AE016803_336709 Vibrio vulnificus CMCP6 chromosome I section 7
           of 11 of the complete sequence.>gb:BA000037_723200
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1046433 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 135

 Score =  112 bits (280), Expect = 5e-24
 Identities = 54/108 (50%), Positives = 76/108 (70%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII KEIPA I+++DD V AFRDI+P+AP HIL+IP          +A++    ++
Sbjct: 24  TIFSKIIRKEIPAQILFQDDLVTAFRDINPRAPKHILIIPNKLIPTVNDVEADDE--AMM 81

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR+   AK +AK+EG+ E G+RL++N    GGQ V+HIH+HL+GG+ L
Sbjct: 82  GRMFTVAKQLAKEEGIAEEGYRLIVNCNAHGGQEVYHIHMHLVGGKPL 129



>gb:AE006042_214961 Pasteurella multocida subsp. multocida str. Pm70
           section 9 of 204 of the complete
           genome.>gb:AE004439_1117691 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 116

 Score =  112 bits (280), Expect = 5e-24
 Identities = 58/109 (53%), Positives = 77/109 (70%), Gaps = 1/109 (0%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP-KVKDGLTGLSKAEERHCEI 262
           TIF KII +EIPANIVY+D+ V AFRDI P+A THIL+IP K+   +  ++  +E     
Sbjct: 5   TIFSKIIRQEIPANIVYQDELVTAFRDISPQAKTHILIIPNKLIPTVNDVTAQDEIS--- 61

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           LGRL   A  +AK EG+ E+G+RL++N  K GGQ VFH+H+HL+GG  L
Sbjct: 62  LGRLFTVAAKLAKDEGIAEDGYRLIVNCNKHGGQEVFHLHMHLVGGEPL 110



>pir|G97058|G97058 HIT family hydrolase [imported] - Clostridium
           acetobutylicum>gb:AE007641_228619 Clostridium
           acetobutylicum ATCC 824 section 129 of 356 of the
           complete genome.>gb:AE001437_1091574 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 114

 Score =  112 bits (279), Expect = 7e-24
 Identities = 52/112 (46%), Positives = 75/112 (66%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  EIP++ VYED+ VLAF DI P AP H+L+IPK    ++ L+   E + +++ 
Sbjct: 5   IFCKIIKGEIPSSKVYEDEDVLAFNDISPAAPVHVLVIPKKH--ISSLNDINEENSKVIA 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +      +AK+ G+DE+GFR+V N G+  GQTV H+H HL+G ++  WPPG
Sbjct: 63  HVFVVISKLAKELGIDEDGFRVVSNCGEAAGQTVHHVHFHLLGKKKFTWPPG 114



>gb:CP000027_79460 Dehalococcoides ethenogenes 195, complete genome.
          Length = 113

 Score =  111 bits (278), Expect = 9e-24
 Identities = 51/107 (47%), Positives = 81/107 (75%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF +I+  EIPA IVY+D+ ++AF+DI+P++P HIL+IP+    +T L++ +E   E+ G
Sbjct: 4   IFCQIVKGEIPAQIVYKDEDLVAFKDINPQSPVHILIIPRRH--ITNLTELDEADTELAG 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           +++  A  +A++  + E+G+RLVIN G++GGQ V H+HLHL+GGRQL
Sbjct: 62  KMILLAGKLAREMDIAESGYRLVINSGREGGQVVNHLHLHLLGGRQL 108



>gb:AE017180_399720 Geobacter sulfurreducens PCA, complete genome.
          Length = 114

 Score =  111 bits (277), Expect = 1e-23
 Identities = 56/112 (50%), Positives = 73/112 (65%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI++  IPA  VYED+ ++A  DI+P AP H+LLIPK K  +  L    E    ++G
Sbjct: 5   IFCKIVDGTIPAKKVYEDEDMVAIEDINPVAPHHLLLIPK-KHVVNALDLTPEDD-RLVG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           R+   A  +A+Q G+DE GFR+V N   D GQ+VFHIH HL+ GR L WPPG
Sbjct: 63  RVFRVAAEIARQRGVDERGFRIVQNSNADAGQSVFHIHFHLLAGRHLGWPPG 114



>gb:AE012786_285548 Chlorobium tepidum TLS section 7 of 194 of the
           complete genome.>gb:AE006470_932716 Chlorobium tepidum
           TLS complete genome.
          Length = 128

 Score =  110 bits (276), Expect = 2e-23
 Identities = 54/115 (46%), Positives = 78/115 (67%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   IF KI    IPAN+VY++D V AF DI+P AP H+L+IP   + +  LS  ++   
Sbjct: 5   DPDCIFCKIATGHIPANLVYKNDHVAAFHDINPVAPIHVLIIPL--EHIRSLSDLKDGDS 62

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPP 421
           EI  ++L  A++VA++ G+ E+G+RLV N+G+D  Q+V HIH HLIGG+ + WPP
Sbjct: 63  EIAAQILLAARIVAEKTGVLESGYRLVFNNGEDALQSVGHIHAHLIGGKTMGWPP 117



>gb:CR522870_99730 Desulfotalea psychrophila LSv54 chromosome.
          Length = 120

 Score =  110 bits (275), Expect = 2e-23
 Identities = 53/115 (46%), Positives = 76/115 (66%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  +F KII  EIP   +YEDD V AF DI P+AP H L++PK    +TG +       +
Sbjct: 9   SDCLFCKIIGGEIPVKKLYEDDDVFAFWDIAPQAPKHFLVVPKKH--ITGPADLAAEDEQ 66

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           ++G+++     +AK++G+ + GFR V+N+G   GQTVFHIH+H++GGR L WPPG
Sbjct: 67  LIGKMMRVGAQLAKEQGIGD-GFRTVLNNGIQAGQTVFHIHMHILGGRDLQWPPG 120



>gb:AE015711_317090 Shewanella oneidensis MR-1 section 260 of 457 of
           the complete genome.>gb:AE014299_952687 Shewanella
           oneidensis MR-1 complete genome.
          Length = 118

 Score =  108 bits (270), Expect = 8e-23
 Identities = 53/108 (49%), Positives = 74/108 (68%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA+I+Y+D+ V AFRDI PKAPTHIL++P          KA +     L
Sbjct: 5   TIFSKIIRREIPADILYQDELVTAFRDISPKAPTHILIVPNHLIPTANDMKASDE--PAL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           GR++  A  +A + G+ ++G+RL++N  K GGQ V+HIH+HL+GG  L
Sbjct: 63  GRMMTVAAKLATEAGIAKDGYRLIMNCNKHGGQEVYHIHIHLVGGEPL 110



>gb:BA000021_686843 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 113

 Score =  108 bits (269), Expect = 1e-22
 Identities = 48/107 (44%), Positives = 75/107 (70%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KIIN E PA I+Y++  V AFRDI+PKAP HI+++    D +  ++  +E+H  +LG
Sbjct: 5   IFTKIINNEYPAEILYKNKYVTAFRDINPKAPIHIIIV--TNDVIRTVNDIKEQHATMLG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            L   +  +AK+E ++  G+RL++N  KDGGQ ++H+H+HL+GG+ L
Sbjct: 63  HLFIASAKIAKKEKINHAGYRLIVNCNKDGGQEIYHLHMHLLGGKNL 109



>gb:AE012197_280260 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 105 of 460 of the complete
           genome.>gb:AE008922_913542 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 116

 Score =  107 bits (268), Expect = 1e-22
 Identities = 53/108 (49%), Positives = 72/108 (66%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA IVYEDD+VL F DI P+AP H+L IPK+   +  L         ++
Sbjct: 4   TIFGKIIRREIPATIVYEDDEVLGFEDIAPQAPVHVLFIPKL-HAIPTLDDVPPEQALLV 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           G+L   A   A+++GL ++G+R+V+N  +  GQTVFHIHLHL+ G  L
Sbjct: 63  GKLALAAAAYAREKGLAQDGYRIVMNCREHAGQTVFHIHLHLLAGAPL 110



>gb:AP006840_567702 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 114

 Score =  107 bits (267), Expect = 2e-22
 Identities = 53/107 (49%), Positives = 73/107 (68%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI   EIP++ VYED+ VLAFRDI+P AP H+L+IPK    +  +++    H E+L 
Sbjct: 6   VFCKIAAGEIPSSKVYEDEHVLAFRDINPVAPVHVLVIPK--QHVPSVAEFGPEHDELLS 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           RL    + VA + G+ E G+R+V N GKD GQ VFH+HLH++GGR L
Sbjct: 64  RLFAAVRKVAAETGVAETGYRVVTNVGKDAGQQVFHVHLHVLGGRPL 110



>gb:AE011740_276056 Xanthomonas axonopodis pv. citri str. 306,
           section 118 of 469 of the complete
           genome.>gb:AE008923_917831 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 116

 Score =  107 bits (267), Expect = 2e-22
 Identities = 54/110 (49%), Positives = 71/110 (64%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S TIF KII +EIPA IVYEDD+VL F DI P+AP H+L IPK +     L         
Sbjct: 2   SDTIFGKIIRREIPATIVYEDDEVLGFEDIAPQAPVHVLFIPK-QHAFPTLDDVPPEQAL 60

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           ++G+L   A   A+ +GL ++G+R+V+N  +  GQTVFHIHLHL+ G  L
Sbjct: 61  LVGKLAIAAATYARAQGLAQDGYRIVMNCREHAGQTVFHIHLHLLAGAPL 110



>gb:AY657706_2146716 Synthetic construct Peudomonas aeruginosa clone
           FLH032547.01F PA0656 gene, partial cds.
          Length = 113

 Score =  107 bits (266), Expect = 2e-22
 Identities = 52/112 (46%), Positives = 77/112 (68%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI+  E+PA   YED++V+AF DI P+AP H L+IPK    +  L    E    + G
Sbjct: 4   LFCKIVAGEVPARKFYEDEEVVAFHDIGPQAPVHFLVIPKRH--IPTLEHLTEADRPLAG 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +L+TA+ +A+++G +E GFR+V+N    GGQTV HIH+H++G RQ++WPPG
Sbjct: 62  HILFTAQRLAREQGCEE-GFRVVMNCNDLGGQTVHHIHMHVLGQRQMHWPPG 112



>gb:AE013598_294768 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 151

 Score =  107 bits (266), Expect = 2e-22
 Identities = 53/108 (49%), Positives = 72/108 (66%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +EIPA IVYEDD+VL F+DI P+AP H+L IPK +  +  L         ++
Sbjct: 39  TIFGKIIRREIPATIVYEDDEVLGFQDIAPQAPVHVLFIPK-QHAIPTLDDVPPEQALLV 97

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           G+L   A   A+ +GL ++G+R+V+N  +  GQTVFHIHLHL+ G  L
Sbjct: 98  GQLAIAAAAYARAQGLAQDGYRIVMNCREHAGQTVFHIHLHLLAGAPL 145



>pir|F83564|F83564 probable HIT family protein PA0656 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004500_54891
           Pseudomonas aeruginosa PAO1, section 61 of 529 of the
           complete genome.>gb:AE004091_968991 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 112

 Score =  107 bits (266), Expect = 2e-22
 Identities = 52/112 (46%), Positives = 77/112 (68%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI+  E+PA   YED++V+AF DI P+AP H L+IPK    +  L    E    + G
Sbjct: 4   LFCKIVAGEVPARKFYEDEEVVAFHDIGPQAPVHFLVIPKRH--IPTLEHLTEADRPLAG 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
            +L+TA+ +A+++G +E GFR+V+N    GGQTV HIH+H++G RQ++WPPG
Sbjct: 62  HILFTAQRLAREQGCEE-GFRVVMNCNDLGGQTVHHIHMHVLGQRQMHWPPG 112



>gb:AE012557_284464 Xylella fastidiosa Temecula1, section 5 of 9 of
           the complete genome.>gb:AE009442_961040 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 117

 Score =  106 bits (265), Expect = 3e-22
 Identities = 51/108 (47%), Positives = 74/108 (68%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +E+PA IVYED++VL F+DI P+AP H+L IPK +  +  L         ++
Sbjct: 7   TIFAKIIRREVPATIVYEDEEVLGFKDIMPRAPVHVLFIPK-RQIIPTLDDLHPEQGPLI 65

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           G+L+  A   A++EG  ++G+R+V+N  + GGQTVFH+HLHL+ G  L
Sbjct: 66  GKLVLAAAEYARREGFAQDGYRIVMNCREHGGQTVFHLHLHLLAGAPL 113



>pir|E82635|E82635 conserved hypothetical protein XF1810 [imported]
           - Xylella fastidiosa (strain 9a5c)>gb:AE004002_49446
           Xylella fastidiosa 9a5c, section 148 of 229 of the
           complete genome.>gb:AE003849_1116656 Xylella fastidiosa
           9a5c, complete genome.
          Length = 114

 Score =  106 bits (264), Expect = 4e-22
 Identities = 50/108 (46%), Positives = 74/108 (68%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII +E+PA  VYED++VL F+DI P+AP H+L IPK ++ +  L         ++
Sbjct: 5   TIFAKIIRREVPATFVYEDEEVLGFKDIMPRAPVHVLFIPK-REMIPTLDDLRPEQGPLI 63

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           G+L+  A   A++EG  ++G+R+V+N  + GGQTVFH+HLHL+ G  L
Sbjct: 64  GKLVLAAAEYARREGFAQDGYRIVMNCREHGGQTVFHLHLHLLAGAPL 111



>gb:BX572090_795693 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 113

 Score =  105 bits (263), Expect = 5e-22
 Identities = 54/113 (47%), Positives = 73/113 (64%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KIIN EIP   ++ED+  LAF DI  +AP H L+IPK    L  L +  E   ++L
Sbjct: 5   TIFSKIINGEIPCEKLHEDELCLAFNDIASQAPVHFLVIPKKP--LVSLCECLEEDRDLL 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G LL   K +AK + L    +R VIN G++ GQTVFH+H+H + GR+++WPPG
Sbjct: 63  GHLLLIGKNIAKSKQL--KNWRTVINTGEESGQTVFHLHIHFLAGRKMSWPPG 113



>sp|Q89AG5|YHIT_BUCBP Hypothetical HIT-like
           protein.>gb:AE014017_302733 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 2 of 2 of the complete
           genome.>gb:AE016826_981334 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 112

 Score =  102 bits (254), Expect = 6e-21
 Identities = 48/108 (44%), Positives = 75/108 (69%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII   IP+ I+Y+D ++ AF DI+P AP HIL++P +   +  L++  E +  ILG
Sbjct: 5   IFQKIIKGIIPSKIIYQDKEITAFHDINPIAPIHILVVPNLL--IKSLNEINENNKHILG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
            +LY +  +AK+  +D+NG+RL+IN  + G Q + H+HLHL+GG++LN
Sbjct: 63  NMLYISIKIAKKFKIDKNGYRLIINCNQHGRQEIQHLHLHLLGGKKLN 110



>gb:AY312991_608475 Alvinella pompejana epibiont 7G3 fosmid clone
           7G3, complete sequence.
          Length = 117

 Score =  102 bits (253), Expect = 7e-21
 Identities = 53/111 (47%), Positives = 72/111 (64%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  EIP+N V E D+ LAF DI+P AP HIL+IPK   G        E   E++G
Sbjct: 3   IFCKIIKGEIPSNRVLESDKFLAFHDINPVAPVHILIIPKEHIG-----SFHETPKELMG 57

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPP 421
            +    + VA++ GLD +G+RL+ N G DGGQ + H+H HL+GG +L++PP
Sbjct: 58  EMTPFIQEVAEKLGLDGSGYRLITNIGDDGGQEISHLHFHLVGGGRLSFPP 108



>pir|G97753|G97753 protein kinase C inhibitor 1 [imported] -
           Rickettsia conorii (strain Malish 7)>gb:AE008607_238795
           Rickettsia conorii str. Malish 7, section 39 of 114 of
           the complete genome.>gb:AE006914_1120913 Rickettsia
           conorii str. Malish 7, complete genome.
          Length = 120

 Score =  101 bits (252), Expect = 1e-20
 Identities = 52/114 (45%), Positives = 75/114 (65%), Gaps = 7/114 (6%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-----VKDGLTGLSKAEERH 253
           +F KII+K +PA I+YED+Q+LAF+DI P AP HI++IPK       D ++  S  E +H
Sbjct: 8   VFAKIIDKNLPAEIIYEDEQILAFKDIAPVAPVHIIVIPKNEYIDYADFISKASIDEIKH 67

Query: 254 CEILGRLLYTAKL--VAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
                   + AKL  +A + GLD++G+RL+ N G+  GQT+FH H H+IGG +L
Sbjct: 68  --------FFAKLSDIANEAGLDKDGYRLITNKGEKSGQTIFHFHFHIIGGEKL 113



>gb:AE016962_368020 Coxiella burnetii strain RSA 493, section 3 of 7
           of the complete genome.>gb:AE016828_1008756 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 113

 Score =  101 bits (251), Expect = 1e-20
 Identities = 50/113 (44%), Positives = 77/113 (68%), Gaps = 1/113 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIP-KVKDGLTGLSKAEERHCEIL 265
           +F KI   EI   ++YED QV+AF D  P+AP HIL+IP +  + +  ++  +E   ++L
Sbjct: 5   VFCKIAKGEI-GELIYEDKQVVAFNDAAPQAPIHILVIPHRHIETINDVTPGDE---DLL 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           G ++  A  +A  + +  +G+RLV+N  ++GGQ VFHIHLHL+GGRQ++WPPG
Sbjct: 61  GHMVVVATRLAHDKNMAADGYRLVMNCNRNGGQAVFHIHLHLLGGRQMHWPPG 113



>sp|O07817|HITA_NEIGO HITA protein.>gb:AE004969_59968 Neisseria
           gonorrhoeae FA 1090, complete genome.>gb:AF003550_467286
           Neisseria gonorrhoeae histidine triad (hitA) gene,
           complete cds.
          Length = 107

 Score =  100 bits (248), Expect = 3e-20
 Identities = 50/103 (48%), Positives = 69/103 (66%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI  KEIPA  VYED +++ F+DI+P AP H+LLIPKV      L+ A   H  +LG
Sbjct: 5   IFCKIAAKEIPAQTVYEDGEMVCFKDINPAAPLHLLLIPKVH--FDSLAHAAPEHQPLLG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG 397
           +++     +AK  GL + GF+ +IN GK GGQ VFH+H+H++G
Sbjct: 63  KMMLKVPEIAKASGLTD-GFKTLINTGKGGGQEVFHLHIHIMG 104



>gb:BX321858_772968 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 3/10.
          Length = 116

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 48/105 (45%), Positives = 71/105 (67%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI+  EIPA  ++ED+  L F DI P AP H+L++PK   G   LS+ +  H ++LG
Sbjct: 5   LFCKIVRGEIPATKIHEDEDTLVFLDIHPAAPVHLLVVPKQHIG--SLSEVDASHQQLLG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGR 403
           ++L+ A  +A  +G  + GFR +IN G+ GGQ VFH+HLH+IGG+
Sbjct: 63  KMLWLAPRLAASQGCTD-GFRTIINTGRVGGQEVFHLHLHVIGGK 106



>gb:AE017144_389782 Helicobacter hepaticus ATCC 51449 section 1 of 6
           of the complete genome.>gb:AE017125_1024044 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 113

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 55/113 (48%), Positives = 74/113 (65%), Gaps = 2/113 (1%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV--KDGLTGLSKAEERHCE 259
           TIF+KI+  EIP   V E+++ LAF DI+PKAP HIL IPKV  KD     SK       
Sbjct: 5   TIFEKIVAGEIPCKKVLENERFLAFYDINPKAPVHILAIPKVCVKDFDCADSK------- 57

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
           +LG L   A+ V K  G+D++G+R++ N G DGGQ V H+HLH++GG +L +P
Sbjct: 58  LLGELCGFAQEVTKSVGIDKSGYRIITNIGADGGQEVPHLHLHILGGGKLKFP 110



>gb:AB029922_1194754 Dictyostelium discoideum DD-1 mRNA, complete
           cds.
          Length = 127

 Score = 98.6 bits (244), Expect = 8e-20
 Identities = 51/124 (41%), Positives = 80/124 (64%), Gaps = 2/124 (1%)
 Frame = +2

Query: 59  GNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLS 235
           GN       TIF KII+  IP+   Y+D+  +A  DI+P+AP H+L+IPK+   GL+ ++
Sbjct: 6   GNIRIDPRDTIFAKIISGAIPSKKFYDDEYCIAIEDINPQAPVHLLVIPKLAVGGLSDVA 65

Query: 236 KAE-ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
             + E++ E +G ++     +A  +G D   +RLVIN+G  G Q+V  +H+H++GGRQ+N
Sbjct: 66  NVDLEKYKESMGHIMSKIHHIASLKGADS--YRLVINEGVLGQQSVRWLHIHILGGRQMN 123

Query: 413 WPPG 424
           WPPG
Sbjct: 124 WPPG 127



>pir|F81925|F81925 probable nucleotide-binding protein NMA0806
           [imported] - Neisseria meningitidis (strain Z2491
           serogroup A)>gb:NMA3Z2491_153745 Neisseria meningitidis
           serogroup A strain Z2491 complete genome; segment 3/7.
          Length = 107

 Score = 98.6 bits (244), Expect = 8e-20
 Identities = 49/103 (47%), Positives = 69/103 (66%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI  K+IPA  VYED +++ F+DI+P AP H+LLIPKV      L+ A   H  +LG
Sbjct: 5   IFCKIAAKDIPAQTVYEDGEMVCFKDINPAAPVHLLLIPKVH--FDSLAHAAPEHQPLLG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG 397
           +++     +AK  GL  +GF+ +IN GK GGQ VFH+H+H++G
Sbjct: 63  KMMLKVPEIAKAAGL-ADGFKTLINTGKGGGQEVFHLHIHIMG 104



>gb:AE017282_428084 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 114

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 50/115 (43%), Positives = 73/115 (63%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF +++   I   +V+ED+  LAFRDI+P+AP H+L+IPK    +  L++       
Sbjct: 2   SQCIFCQMVAGTIKPAVVHEDELTLAFRDINPQAPVHVLVIPKAH--VANLNELPADAPG 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +   L  T K VA  EG+ E+G+R V+N   D GQ V H+HLH++GGR+L+WPPG
Sbjct: 60  LATALFETVKRVAALEGIAESGYRTVVNCLGDAGQAVDHLHLHVLGGRRLHWPPG 114



>pir|F81181|F81181 hitA protein NMB0602 [imported] - Neisseria
           meningitidis  (strain MC58 serogroup
           B)>gb:AE002415_46060 Neisseria meningitidis serogroup B
           strain MC58 section 57 of 206 of the complete
           genome.>gb:AE002098_896173 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 107

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 49/103 (47%), Positives = 69/103 (66%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI  K+IPA  VYED +++ F+DI+P AP H+LLIPKV      L+ A   H  +LG
Sbjct: 5   IFCKIAAKDIPAQTVYEDGEMVCFKDINPAAPVHLLLIPKVH--FDSLAHAAPEHQMLLG 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG 397
           +++     +AK  GL  +GF+ +IN GK GGQ VFH+H+H++G
Sbjct: 63  KMMLKVPEIAKAAGL-ADGFKTLINTGKGGGQEVFHLHIHIMG 104



>sp|P57438|YHIT_BUCAI Hypothetical hit-like protein
           BU357.>pir|E84971|E84971 hypothetical protein [imported]
           - Buchnera sp. (strain APS)>gb:BA000003_653715 Buchnera
           aphidicola str. APS (Acyrthosiphon pisum) genomic DNA,
           complete sequence.
          Length = 114

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 44/108 (40%), Positives = 75/108 (69%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           +IF  II ++IPANIVY+D ++ AF DI PKAP HIL+IP     ++  +   +++  I+
Sbjct: 5   SIFKNIIQRKIPANIVYQDKKITAFEDIKPKAPVHILIIPNF--FISSSNDINKKNKWIM 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
             + Y A  +AKQ+ +++ G+R++IN  + GGQ + ++H+HL+GG++L
Sbjct: 63  SHMFYIAVKIAKQKKINQEGYRIIINCNEYGGQEINYLHMHLLGGKKL 110



>gb:AE017197_402292 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 120

 Score = 97.1 bits (240), Expect = 2e-19
 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 7/114 (6%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-----VKDGLTGLSKAEERH 253
           +F KII K +PA I+YED Q+LAF+DI+P AP HI++IPK       D ++  S  E +H
Sbjct: 7   VFAKIITKNLPAEIIYEDKQILAFKDIEPIAPVHIIVIPKNEYIDYTDFISKASIDEIKH 66

Query: 254 CEILGRLLYTAKL--VAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
                   + AK+  +A + GL + G+RL+ N G+  GQT+FH H H+IGG++L
Sbjct: 67  --------FFAKISDIANEAGLAKAGYRLITNKGEKSGQTIFHFHFHIIGGKKL 112



>sp|Q9ZDL1|YHIT_RICPR Hypothetical HIT-like protein
           RP317.>pir|G71687|G71687 protein kinase C inhibitor 1
           (pkcI) RP317 - Rickettsia prowazekii>gb:RPXX02_167111
           Rickettsia prowazekii strain Madrid E, complete genome;
           segment 2/4.
          Length = 120

 Score = 97.1 bits (240), Expect = 2e-19
 Identities = 49/109 (44%), Positives = 70/109 (64%), Gaps = 2/109 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK--DGLTGLSKAEERHCEI 262
           +F KII K +PA I+YED Q+LAF+DI P AP HI++IPK +  D    +SKA     + 
Sbjct: 7   VFAKIITKNLPAEIIYEDKQILAFKDIAPIAPVHIIVIPKNEYIDYTDFISKAS---IDE 63

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           +         +A + GLD+ G+RL+ N G+  GQT+FH H H+IGG++L
Sbjct: 64  IKHFFSKIADIANEAGLDKVGYRLITNKGEKSGQTIFHFHFHIIGGKKL 112



>gb:SCO939113_176222 Streptomyces coelicolor A3(2) complete genome;
           segment 10/29.
          Length = 117

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 52/114 (45%), Positives = 70/114 (61%), Gaps = 2/114 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV--KDGLTGLSKAEERHCEI 262
           +F KI+  +IPA IV E D  +AFRDI+P+APTH+L+IPK   KD     ++A +   ++
Sbjct: 10  LFCKIVAGQIPATIVRETDTTVAFRDINPQAPTHVLVIPKAHHKDAAALAAEAPQLAADV 69

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           L       + VA  E LD   +R V N G   GQTV+H H H++GGR L WPPG
Sbjct: 70  LRE----TQAVADDEKLD--SYRTVFNTGSGAGQTVWHAHAHVLGGRGLEWPPG 117



>gb:CR767821_116617 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925677_117528 Ehrlichia
           ruminantium str. Gardel, complete
           genome.>gb:CR925678_118482 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 113

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 51/111 (45%), Positives = 72/111 (64%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  +F KI+ KE+P +IVYED+ VLAF DI P+AP HIL+IPK K          +   
Sbjct: 6   DNNNVFAKILRKELPCDIVYEDELVLAFHDIYPQAPIHILVIPKNKH--ISFDDFIDSSP 63

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           +I+       K+  K + L++NG+RLV N GK+GGQ V H H+H++GG+QL
Sbjct: 64  DIIHFFSIVKKITHKFQ-LNKNGYRLVTNHGKEGGQVVPHFHVHILGGKQL 113



>gb:AY872045_2150209 Synthetic construct hypothetical protein
           (FTT1299) gene, complete cds.
          Length = 147

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 49/108 (45%), Positives = 69/108 (63%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KII  EIP+  VYED+ + AF DI+P A  HIL+IP  K  +  L+   E+  E
Sbjct: 28  SDCIFCKIITGEIPSKKVYEDENIFAFHDINPAADVHILVIP--KKHIASLNDLTEQDQE 85

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGR 403
           ++G+ + +   VAK  GL   GF+ + N GK+GGQ VFH+H H++GG+
Sbjct: 86  LMGKFILSIPKVAKLMGL--KGFKTIFNTGKEGGQMVFHLHAHILGGK 131



>gb:AJ749949_531756 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774316_2149029 Synthetic construct
           Francisella tularensis clone FLH156825.01X NT02FT0393
           gene, complete cds.
          Length = 112

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 49/108 (45%), Positives = 69/108 (63%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KII  EIP+  VYED+ + AF DI+P A  HIL+IP  K  +  L+   E+  E
Sbjct: 2   SDCIFCKIITGEIPSKKVYEDENIFAFHDINPAADVHILVIP--KKHIASLNDLTEQDQE 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGR 403
           ++G+ + +   VAK  GL   GF+ + N GK+GGQ VFH+H H++GG+
Sbjct: 60  LMGKFILSIPKVAKLMGL--KGFKTIFNTGKEGGQMVFHLHAHILGGK 105



>gb:BA000030_703462 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 117

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 53/113 (46%), Positives = 70/113 (61%), Gaps = 1/113 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKD-GLTGLSKAEERHCEIL 265
           +F KI+   IPA +V E +  +AFRDI+P+APTH+L+IPKV       L+ AE     I 
Sbjct: 10  LFCKIVAGHIPATLVRETETTVAFRDINPQAPTHVLVIPKVHHPDAAALAAAEPA---IA 66

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
             +L  A  VA+ E L+   +R+V N G   GQTVFH H H+IGGR + WPPG
Sbjct: 67  ADVLREAGEVARDEKLES--YRVVFNTGSGAGQTVFHAHAHVIGGRGMQWPPG 117



>gb:BX248585_764008 Blochmannia floridanus complete genome; segment
           2/3.
          Length = 118

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 46/110 (41%), Positives = 72/110 (65%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  +F KII K+I  NI+Y+D+ V AF D+ PKAP HIL++P   + +  ++  +  H  
Sbjct: 3   SNDLFIKIIQKKIKTNILYQDELVTAFCDLYPKAPIHILIVPN--ELIPTVNDVKSHHEI 60

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            LGRL   A  +A Q+ +  +G+RL+IN   + GQ ++H+H+HL+GG+QL
Sbjct: 61  TLGRLFIVAAKIANQKNIHISGYRLIINCNVNAGQEIYHLHMHLLGGKQL 110



>gb:AE016912_355583 Chromobacterium violaceum ATCC 12472 section 3
           of 16 of the complete genome.>gb:AE016825_1040737
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 107

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 50/106 (47%), Positives = 69/106 (65%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  +F KI+  +IPAN VYEDD VLAF DI P AP H ++IP  K  +  L+     H  
Sbjct: 2   SDCLFCKIVAGQIPANKVYEDDDVLAFHDIRPIAPVHFMIIP--KRHVDSLAHCGPEHEA 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG 397
           +LG++L  A  +AK++GL  +GF+  IN G+ GGQ VFH+H+H+ G
Sbjct: 60  VLGKILTLAPRLAKEQGL-ASGFKTGINTGRGGGQEVFHLHVHVFG 104



>gb:BX908798_830139 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 112

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 44/108 (40%), Positives = 72/108 (66%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F KII  E+ A  V+E+++++  +D+ P AP H+L+IPK +  +  L   ++   E++
Sbjct: 4   TVFGKIIKGELSAEKVFENERIMVIKDLYPVAPVHLLIIPKKE--IPNLQSIQQEDLELV 61

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
             ++  A+ +AKQ  ++E G+RLV N+G   GQ +FH+H HLIGGRQL
Sbjct: 62  SEIVVIAQQLAKQFNIEE-GYRLVTNNGTMAGQVIFHLHFHLIGGRQL 108



>sp|Q8K9I9|YHIT_BUCAP Hypothetical hit-like protein
           BUsg345.>gb:AE014111_303259 Buchnera aphidicola str. Sg
           (Schizaphis graminum) section 36 of 57 of the complete
           genome.>gb:AE013218_935237 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 115

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 43/107 (40%), Positives = 71/107 (66%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII +E   +I+Y+D  V AF DI PKAP HI++IP +   +  L+   +++  I  
Sbjct: 7   IFQKIIKRETSTHIIYQDKIVTAFEDIAPKAPIHIIVIPNIF--IKTLNDINQKNKNIFA 64

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            +LY A  +AK + + E+G+++V+N  K+GGQ + ++H+HL+GG +L
Sbjct: 65  HMLYIAVKIAKNKKISEDGYKIVMNCNKNGGQEINYLHMHLLGGEKL 111



>gb:BX571660_778637 Wolinella succinogenes, complete genome; segment
           4/7.
          Length = 120

 Score = 92.4 bits (228), Expect = 6e-18
 Identities = 47/110 (42%), Positives = 68/110 (61%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F++I+  EIP N V+E+   LAF DI+PKAP H+L IPK           +E     +
Sbjct: 2   TLFERIVAGEIPCNKVHENSDFLAFHDINPKAPIHVLAIPK-----KCARSFQEVDPSWM 56

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNW 415
           G +    + VA++ GLDE G+R++ N G DGGQ V H+H H++GG +L W
Sbjct: 57  GGMTSFIQEVARKLGLDEAGYRVITNIGYDGGQEVPHLHFHILGGTRLAW 106



>pir|G75374|G75374 Hit family protein - Deinococcus radiodurans
           (strain R1)>gb:AE002005_41880 Deinococcus radiodurans R1
           section 142 of 229 of the complete chromosome
           1.>gb:AE000513_882775 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 118

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 48/110 (43%), Positives = 71/110 (64%), Gaps = 1/110 (0%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-VKDGLTGLSKAEER 250
           S  PT+F++II +EIP+ +VYEDD  +A +DI PKAP H+L+IPK V   +  ++   E 
Sbjct: 8   SPQPTLFERIIAREIPSQVVYEDDDYIAIKDIAPKAPIHLLVIPKRVTTRVDEITDPLE- 66

Query: 251 HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
               +GRL   A  +A+++  D   +RLV+N G  GGQ VFH H+H++ G
Sbjct: 67  ----MGRLWLKATEIAREQAPD---YRLVVNCGAGGGQMVFHTHIHILAG 109



>gb:CP000009_862509 Gluconobacter oxydans 621H, complete genome.
          Length = 122

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 51/111 (45%), Positives = 64/111 (57%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   IF +I+ KEIPA  VYEDD  LAF DI P+AP H+L+IPK          A     
Sbjct: 4   DPGNIFARILRKEIPARTVYEDDFALAFHDIAPQAPIHVLVIPKGPYVSIADFGATASPD 63

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           EI G     +K +A+++GL   GFRL+ N G + GQ V H H+HL GG  L
Sbjct: 64  EITGFWRAVSK-IAEEQGLTREGFRLISNSGPNSGQEVPHFHVHLFGGAAL 113



>gb:CP000030_83399 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 123

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 47/107 (43%), Positives = 62/107 (57%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           DS  +F +I+  E P   VYED+QVLAF DI P+AP H+L+IPK K             C
Sbjct: 11  DSGNVFARILRGEAPCRKVYEDEQVLAFHDIRPEAPVHVLVIPKGK--YISYDDFIRSDC 68

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG 397
           +I G    T   +A++ GL   G+RLV N GK  GQ V H H+H++G
Sbjct: 69  DIAG-FFRTVGAIARELGLHHGGYRLVTNHGKSAGQVVPHFHVHILG 114



>pir|B81363|B81363 HIT-family protein Cj0898 [imported] -
           Campylobacter jejuni  (strain NCTC
           11168)>gb:CJ11168X3_847275 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           3/6.>gb:CP000025_878728 Campylobacter jejuni RM1221,
           complete genome.
          Length = 121

 Score = 89.4 bits (220), Expect = 5e-17
 Identities = 46/108 (42%), Positives = 67/108 (62%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF+ I+  ++P N V E D  LAF DI PKAP HIL+IPK           +E   E++
Sbjct: 5   TIFELIVEGKLPCNKVLESDDFLAFHDIAPKAPIHILIIPK-----KYFKDFQEFDPELM 59

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            ++    + +A   G+D++G+RLV N GK+ GQ VFH+H H++GG +L
Sbjct: 60  AKMTSFIQELAVLLGVDKSGYRLVTNCGKNSGQEVFHLHFHMLGGFEL 107



>gb:AP003247_1826219 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0425G02.>gb:AP004331_1840297 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0085D07.
          Length = 143

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 55/122 (45%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = +2

Query: 8   RLQRLTSHLSPHTPMASGN-----AVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDID 172
           RL  L SHLS  +  A        A PSD PTIFDKI+ KEIP+ +VYED+         
Sbjct: 39  RLAVLASHLSQSSRTAGEKEAALAAGPSDGPTIFDKILRKEIPSQVVYEDE--------- 89

Query: 173 PKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGK 352
                                KAEERH E++G LLY AK +AKQE LD+ GFR+VINDG 
Sbjct: 90  ---------------------KAEERHVEVMGHLLYAAKTIAKQENLDD-GFRIVINDGP 127

Query: 353 DG 358
           +G
Sbjct: 128 NG 129



>gb:CR555306_106096 Azoarcus sp. EbN1 complete genome.
          Length = 115

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 42/110 (38%), Positives = 71/110 (64%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF +I+  EIPA  ++ED+ +LAF DI P AP H L+IPK+   +  +++    H  
Sbjct: 2   SDCIFCRIVAGEIPAKKIHEDEDILAFHDIHPVAPVHFLVIPKLH--IPSMAELRPEHAA 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           ++GR++  +  +A + G   +GFR +IN G+ G Q V+H+H+H++GG ++
Sbjct: 60  VMGRVMTESARIAGELGC-LDGFRTIINTGRVGRQEVYHLHVHILGGPEV 108



>gb:BX640436_812506 Bordetella parapertussis strain 12822, complete
           genome; segment 14/14.
          Length = 122

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 47/107 (43%), Positives = 64/107 (59%), Gaps = 3/107 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI   EIPA  V+EDD+ +AF DI+P AP H+LLIP  +  +  L    E   + LG
Sbjct: 6   IFCKIARGEIPAKKVFEDDEFVAFHDINPAAPVHLLLIP--RRHVVSLQDIAEGDADWLG 63

Query: 269 RLLYTAKLVAKQEGLD---ENGFRLVINDGKDGGQTVFHIHLHLIGG 400
           R+   A  +A   G +   + GFRL+ N G +GGQ V H+H H++GG
Sbjct: 64  RMTVLASRLAAGNGCNPGPDGGFRLMANSGAEGGQEVPHLHFHILGG 110



>gb:TTH302653_198475 Thermus thermophilus hint gene for histidine
           nucleotide-binding protein and partial tr-ap gene for
           acid phosphatase 5, tartrate
           resistant.>gb:AE017305_436887 Thermus thermophilus HB27
           section 5 of 7 of the complete
           genome.>gb:AE017221_1078865 Thermus thermophilus HB27
           complete genome.
          Length = 107

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 47/105 (44%), Positives = 69/105 (65%), Gaps = 1/105 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERHCEIL 265
           +F +II  E+P+  VYED+  +AF DI PKAP H+L++PK   + L+     EE   + L
Sbjct: 4   VFCRIIAGELPSKKVYEDEGFVAFHDIRPKAPVHVLVVPKEHVEKLSDYPDTEEGERK-L 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
           G L  TA  VA+  GL+  G+R+ +N G+ GGQ VFH+H+H++GG
Sbjct: 63  GALFRTANRVARVLGLE--GYRVQVNVGEKGGQEVFHVHVHVMGG 105



>gb:AE016822_340501 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 132

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 46/125 (36%), Positives = 76/125 (60%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D  ++F +II  EIPA++VY+ ++++AF+DI P+AP H+L++PK  D    + +      
Sbjct: 15  DERSVFTRIIAGEIPADVVYDGERLIAFKDIAPQAPVHLLVVPKT-DQYRDVVELAAGDP 73

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWPPG*LDL 436
           E+L  L+ TA+ +A +    +  FRL+ N G + GQTVFH+H H+     L+ P G L+ 
Sbjct: 74  ELLAELVATARSLAAEHA--DGDFRLIFNTGANAGQTVFHVHAHV-----LSTPAGGLEE 126

Query: 437 SNCRD 451
            +  D
Sbjct: 127 GSLAD 131



>gb:BX640422_808160 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.>gb:BX640451_817510 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           15/16.
          Length = 122

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 47/107 (43%), Positives = 63/107 (58%), Gaps = 3/107 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI   EIPA  V+EDD+ +AF DI+P AP H+LLIP  +  +  L    E     LG
Sbjct: 6   IFCKIARGEIPAKKVFEDDEFVAFHDINPAAPVHLLLIP--RRHVVSLQDIAEGDAGWLG 63

Query: 269 RLLYTAKLVAKQEGLD---ENGFRLVINDGKDGGQTVFHIHLHLIGG 400
           R+   A  +A   G +   + GFRL+ N G +GGQ V H+H H++GG
Sbjct: 64  RMTVLASRLAAGNGCNPGPDGGFRLMANSGAEGGQEVPHLHFHILGG 110



>gb:AP008226_579074 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 110

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 47/105 (44%), Positives = 68/105 (64%), Gaps = 1/105 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERHCEIL 265
           +F +II  E+P+  VYED+  +AF DI PKAP H+L++PK   + L+     EE   + L
Sbjct: 7   VFCRIIAGELPSRKVYEDEGFVAFHDIRPKAPVHVLVVPKEHVEKLSDYPDTEEGERK-L 65

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
           G L  TA  VA+  GL   G+R+ +N G+ GGQ VFH+H+H++GG
Sbjct: 66  GALFRTANRVARLLGL--QGYRVQVNVGEKGGQEVFHVHVHVMGG 108



>gb:BX571965_792927 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866839
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 121

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/112 (41%), Positives = 65/112 (58%), Gaps = 4/112 (3%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   +F KI   EIP+  V+EDD+ +AFRDI P A TH+L+IP  +  L  LS       
Sbjct: 4   DPNCLFCKIAAGEIPSTKVHEDDEFVAFRDIRPAADTHVLVIP--RKHLPTLSAVTADDA 61

Query: 257 EILGRLLYTAKLVAKQEGL----DENGFRLVINDGKDGGQTVFHIHLHLIGG 400
            +LGR++     +A++ G      E GFR VIN G  GGQ V+H+H H++ G
Sbjct: 62  PLLGRMMVLVARLAERLGCAYTGGETGFRTVINTGPGGGQEVYHLHAHILAG 113



>gb:AE008692_241236 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 125

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 45/113 (39%), Positives = 70/113 (61%)
 Frame = +2

Query: 71  PSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER 250
           P D   IF +II  EIP   V+E+DQVLAF DI+P+AP HIL+IPK +  ++    +E+ 
Sbjct: 8   PYDDNNIFARIIRGEIPCKKVFENDQVLAFHDINPQAPVHILVIPKGR-YVSWDDFSEKA 66

Query: 251 HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
               +  L      +++   L+ NG+RL++N G D  Q V H+H+H++ G++L
Sbjct: 67  SDTEIAALTRAVGQISRDPALN-NGYRLIVNCGHDADQLVPHLHIHILSGKEL 118



>sp|Q9PK09|Y664_CHLMU Hypothetical HIT-like protein
           TC0664.>gb:AE002334_45248 Chlamydia muridarum Nigg
           section 63 of 85 of the complete
           genome.>gb:AE002160_1149388 Chlamydia muridarum Nigg,
           complete genome.
          Length = 126

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 41/105 (39%), Positives = 67/105 (63%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF++II   +  + V+ED+  +  +D  P+AP H+L+IPK    +  L   +     +L
Sbjct: 18  TIFERIIEGAVECDKVFEDENFIVIKDKFPQAPVHLLIIPKKH--IEKLQDMQSDDFSLL 75

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
                  +L+A+  G+ ENG+R+VIN+G +GGQ+VFH+H+HL+GG
Sbjct: 76  SEAGKIIQLMARDFGI-ENGYRVVINNGLEGGQSVFHLHIHLLGG 119



>gb:AE017321_441873 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 122

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 47/115 (40%), Positives = 69/115 (60%), Gaps = 4/115 (3%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK----DGLTGLSKAE 244
           DS  IF +I+  E+P   VYED+ VLAF D  P AP HIL++PK +    D     + AE
Sbjct: 7   DSNNIFAQILRGELPCKKVYEDEDVLAFYDKYPDAPVHILVVPKSQYISYDDFIFKASAE 66

Query: 245 ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
               EI+G    T + +  +  L++ G+RLV N G++G Q V H H+H++GG++L
Sbjct: 67  ----EIVG-FFKTVREITYKYNLEKTGYRLVTNCGENGEQVVPHFHMHILGGKRL 116



>sp|O84390|YHIT_CHLTR Hypothetical HIT-like protein
           CT385.>pir|E71522|E71522 probable hit hydrolase -
           Chlamydia trachomatis (serotype D, strain
           UW3/Cx)>gb:AE001311_34317 Chlamydia trachomatis
           D/UW-3/CX section 38 of 87 of the complete
           genome.>gb:AE001273_1098343 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 111

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 40/105 (38%), Positives = 67/105 (63%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF++II   +  + V+ED+  +  +D  P+AP H+L+IPK    +  L   +     +L
Sbjct: 3   TIFERIIEGAVECDKVFEDENFIVIKDKFPQAPVHLLIIPKKH--IEKLQDIQGDDFLLL 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
                  +L+A+  G+ ENG+R+V+N+G +GGQ+VFH+H+HL+GG
Sbjct: 61  AEAGKIIQLMARNFGI-ENGYRVVVNNGLEGGQSVFHLHIHLLGG 104



>sp|P26724|YHIT_AZOBR Hypothetical 13.2 kDa HIT-like protein in hisE
           3'region (ORF2).>pir|S16804|S16804 histidine triad
           protein (hisE 3' region) - Azospirillum
           brasilense>gb:ABHISHAFE_18407 A.brasilense hisB, H, A, F
           and E genes for imidazole glycerolphosphate dehydratase,
           glutamine amidotransferase,
           phosphorybosilformimino-5-amino-phosphorybosil-4-
           imidazolecarboxamide isomerase, cyclase and
           phosphorybosil-AMP-cyclohydrolase.
          Length = 122

 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 45/111 (40%), Positives = 61/111 (54%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   +F +I+  EIP   V E +  LAF DI+P+APTHIL+IPK          A     
Sbjct: 6   DPNNVFARILRGEIPCKKVLETEHALAFHDINPQAPTHILVIPKGAYVDMDDFSARATEA 65

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           EI G L      VA+  G  E G+R++ N G+D  Q V H+H+H+  GR+L
Sbjct: 66  EIAG-LFRAVGEVARGAGAAEPGYRILSNCGEDANQEVPHLHIHVFAGRRL 115



>gb:AE014295_311251 Bifidobacterium longum NCC2705, complete genome.
          Length = 112

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 44/108 (40%), Positives = 65/108 (60%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KII  +IP++ VYED+   AF DI+PKA  H+L++PK K        A +   E L 
Sbjct: 8   LFCKIIAGQIPSSKVYEDETTYAFNDINPKAKVHVLVVPK-KHYANVAELAADDPTE-LA 65

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
            ++  A+ +A +E      +RLV N G D GQTVFH+H H++ G +L+
Sbjct: 66  HIVSIAQNIADKE--FHGAYRLVFNTGLDAGQTVFHVHAHVMTGEKLD 111



>gb:AE017260_418831 Wolbachia endosymbiont of Drosophila
           melanogaster, section 5 of 5 of the complete
           genome.>gb:AE017196_1059468 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 122

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 4/115 (3%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK----DGLTGLSKAE 244
           DS  IF +I+  E+P   V+E++ VLAF D  P AP HIL+I K +    D    + KA 
Sbjct: 7   DSDNIFAQILRGELPCEKVHENENVLAFHDKYPDAPVHILVISKNQYISYDDF--ILKAP 64

Query: 245 ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           E   E +     T + +A +  L++ G+RLV N G++G Q V H H+H++GG++L
Sbjct: 65  E---EEIADFFKTVREIAHKYNLEKTGYRLVTNYGENGEQVVPHFHVHILGGKKL 116



>pir|H90512|H90512 hit-like protein (cell cycle regulation)
           [imported] - Mycoplasma pulmonis (strain UAB
           CTIP)>gb:MPULM01_149521 Mycoplasma pulmonis (strain UAB
           CTIP) complete genome; segment 1/3.
          Length = 116

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 44/109 (40%), Positives = 65/109 (59%), Gaps = 2/109 (1%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           +IF KII+++ PA I+YEDDQ +A  D  P  P H L+IPK     T L   EE   + +
Sbjct: 7   SIFKKIIDRKEPAQIIYEDDQAIAIMDKFPYNPGHFLVIPKKHS--TNLKDIEE---QSI 61

Query: 266 GRLLYTAKLVAKQ--EGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQ 406
             L+  A  +AK+  E  +   F+L+IN+G+  GQ V+H H+H+I  R+
Sbjct: 62  NHLMKIAIKLAKEKIENKEFEDFKLIINNGEKAGQVVYHTHIHIIPFRK 110



>gb:AE016994_374321 Chlamydophila caviae GPIC section 1 of 4 of the
           complete genome.>gb:AE015925_994000 Chlamydophila caviae
           GPIC complete genome.
          Length = 110

 Score = 75.5 bits (184), Expect = 7e-13
 Identities = 42/111 (37%), Positives = 68/111 (61%), Gaps = 3/111 (2%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF+KII   I    V+E++  +A +D  P+A  H+L+IPK       + + ++   E L
Sbjct: 2   TIFEKIIEGSIECEKVFENENFIAIKDRFPQAAVHLLIIPKKH-----IERVQDMQEEDL 56

Query: 266 GRLLYTAKLV---AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
             L    K++   A+  G+ + G+R+VIN+G +GGQ+VFH+H+HL+GG  L
Sbjct: 57  PLLAEAGKIIQQLAETFGIAD-GYRVVINNGIEGGQSVFHLHIHLLGGSAL 106



>sp|Q23921|PKIA_DICDI Protein pkiA.>gb:DDU61986_1377368
           Dictyostelium discoideum PkiA (pkiA) mRNA, complete cds.
          Length = 172

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 42/113 (37%), Positives = 69/113 (61%), Gaps = 2/113 (1%)
 Frame = +2

Query: 59  GNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLS 235
           GN       TIF KII+  IP+   Y+D+  +A  DI+P+AP H+L+IPK+   GL+ ++
Sbjct: 59  GNIRIDPRDTIFAKIISGAIPSKKFYDDEYCIAIEDINPQAPVHLLVIPKLAVGGLSDVA 118

Query: 236 KAE-ERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHL 391
             + E++ E +G ++     +A  +G D   +RLVIN+G  G Q+V  +H+H+
Sbjct: 119 NVDLEKYKESMGHIMSKIHHIASLKGAD--SYRLVINEGVLGQQSVRWLHIHI 169



>gb:AE016851_348806 Tropheryma whipplei str. Twist, section 2 of 3
           of the complete genome.>gb:AE014184_1029002 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 107

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 41/108 (37%), Positives = 62/108 (57%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           +IF +IIN+E+PA I++EDD+ +   DI PKA  H L+I   K     +++A       +
Sbjct: 3   SIFTRIINREVPAEILFEDDEFICIEDIAPKAKIHYLVI--AKHPWKDVTEAVRDDPLFV 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            ++L  A  + K  G   + FRL+ N G   GQTVFH+H H++ G  L
Sbjct: 61  NKILAIAVRLTKDFG---SQFRLIFNTGALVGQTVFHVHAHILSGEAL 105



>sp|P56147|YHIT_HELPY Hypothetical HIT-like protein
           HP0404/JHP0977.>pir|D64570|D64570 protein kinase C
           inhibitor homolog - Helicobacter
           pylori>gb:AE000556_24581 Helicobacter pylori 26695
           section 34 of 134 of the complete
           genome.>gb:AE001527_35968 Helicobacter pylori, strain
           J99 section 88 of 132 of the complete
           genome.>gb:AE000511_880020 Helicobacter pylori 26695
           complete genome.>gb:AE001439_884738 Helicobacter pylori,
           strain J99 complete genome.
          Length = 104

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 37/105 (35%), Positives = 63/105 (60%), Gaps = 1/105 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERHCEIL 265
           +F+KII  EIP + + E+++ L+F DI+PKA  H L+IPK       G++       E++
Sbjct: 3   VFEKIIQGEIPCSKILENERFLSFYDINPKAKVHALVIPKQSIQDFNGITP------ELM 56

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGG 400
            ++      V ++ G+ E G++L+ N GK+ GQ V H+H H++ G
Sbjct: 57  AQMTSFIFEVVEKLGIKEKGYKLLTNVGKNAGQEVMHLHFHILSG 101



>gb:BX251411_764684 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 107

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 40/108 (37%), Positives = 62/108 (57%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           ++F +IIN+E+PA I++EDD+ +   DI PKA  H L+I   K     +++A       +
Sbjct: 3   SVFTRIINREVPAEILFEDDEFICIEDIAPKAKIHYLVI--AKHPWKDVTEAVRDDPLFV 60

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
            ++L  A  + K  G   + FRL+ N G   GQTVFH+H H++ G  L
Sbjct: 61  NKILAIAVRLTKDFG---SQFRLIFNTGALVGQTVFHVHAHILSGEAL 105



>gb:AE002186_43752 Chlamydophila pneumoniae AR39, section 21 of 94
           of the complete genome.>gb:AE002161_885877 Chlamydophila
           pneumoniae AR39, complete genome.
          Length = 125

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 41/114 (35%), Positives = 70/114 (61%), Gaps = 3/114 (2%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D  T+F +II+  I    V+E++  +A +D  P+AP H+L+IPK       + + ++   
Sbjct: 14  DHMTVFKQIIDGLIDCEKVFENENFIAIKDRFPQAPVHLLIIPKKP-----IPRFQDIPG 68

Query: 257 EILGRLLYTAKLV---AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
           + +  +    K+V   A + G+ + G+R+VIN+G +GGQ VFH+H+HL+GGR L
Sbjct: 69  DEMILMAEAGKIVQELAAEFGIAD-GYRVVINNGAEGGQAVFHLHIHLLGGRPL 121



>gb:BA000043_737234 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 143

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 47/108 (43%), Positives = 58/108 (53%), Gaps = 3/108 (2%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERHC 256
           S  IF KIIN E+PA  VYEDD VLAF DI      H L+IPKV  + +  L+       
Sbjct: 5   SDCIFCKIINGELPAAKVYEDDHVLAFLDISQVTKGHTLVIPKVHTENIFTLTS------ 58

Query: 257 EILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           E  G+L      +A   +      G  L+ N+G+  GQTVFH HLHLI
Sbjct: 59  EAAGQLFRAVPTIANALRRAFSPVGLNLLNNNGEQAGQTVFHYHLHLI 106



>gb:AE017199_403338 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 129

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 45/102 (44%), Positives = 61/102 (59%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KIINKEIPA IVYEDD V+A  DI P A  H L+IP  K  +T L +  E   + L 
Sbjct: 3   IFCKIINKEIPAYIVYEDDFVIAILDIYPMAKGHTLVIP--KKHVTRLKELSEEEAKKLF 60

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             L   K++ K E +  + + ++IN G   GQ + H+H+H+I
Sbjct: 61  AGL--KKVIEKIEKISPD-YNIIINQGPKAGQEIDHLHIHII 99



>gb:AE017308_437711 Mycoplasma mobile 163K complete genome.
          Length = 122

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 44/106 (41%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KIINKE+PA I+YED + +AF DI P +  H L++P  K+    L   ++   E L
Sbjct: 6   TIFQKIINKEVPAKIIYEDSKTIAFLDIKPISKGHFLVVP--KNFSRNLISIDD---EDL 60

Query: 266 GRLLYTAKLVAKQEGLDEN---GFRLVINDGKDGGQTVFHIHLHLI 394
             L+  A  +AK + + EN   G++L +N+  D  Q VFH H+H+I
Sbjct: 61  INLMMVANKLAK-KFMKENKASGYQLHVNNESDARQVVFHTHVHII 105



>pir|B64408|B64408 histidine triad (HIT) protein MJ0866 -
           Methanococcus jannaschii
          Length = 129

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 41/102 (40%), Positives = 61/102 (59%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KIIN EIPA +VYED+ VLAF DI+P+   H L++PK K         ++  C  + 
Sbjct: 3   IFCKIINGEIPAKVVYEDEHVLAFLDINPRNKGHTLVVPK-KHYERFDEMPDDELCNFIK 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +  T +++ K   L  +G+ +V N+G+  GQ V H+H H+I
Sbjct: 62  GVKKTVEVLKK---LGFDGYNIVNNNGRVAGQEVNHVHFHII 100



>sp|Q58276|Y866_METJA Hypothetical HIT-like protein
           MJ0866.>gb:U67530_206976 Methanocaldococcus jannaschii
           DSM 2661 section 72 of 150 of the complete
           genome.>gb:L77117_1099734 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 129

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 41/102 (40%), Positives = 61/102 (59%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KIIN EIPA +VYED+ VLAF DI+P+   H L++PK K         ++  C  + 
Sbjct: 3   IFCKIINGEIPAKVVYEDEHVLAFLDINPRNKGHTLVVPK-KHYERFDEMPDDELCNFIK 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +  T +++ K   L  +G+ +V N+G+  GQ V H+H H+I
Sbjct: 62  GVKKTVEVLKK---LGFDGYNIVNNNGRVAGQEVNHVHFHII 100



>sp|Q9Z863|YHIT_CHLPN HIT-like protein
           CPn0488/CP0266/CPj0488/CpB0508.>pir|D86551|D86551 HIT
           family hydrolase [imported] - Chlamydophila pneumoniae
           (strain J138)>pir|G72071|G72071 hit family hydrolase -
           Chlamydophila pneumoniae (strain
           CWL029)>gb:AE001634_37340 Chlamydia pneumoniae section
           50 of 103 of the complete genome.>gb:AE017158_393849
           Chlamydophila pneumoniae TW-183, section 2 of 4 of the
           complete genome.>gb:BA000008_663857 Chlamydophila
           pneumoniae J138 genomic DNA, complete
           sequence.>gb:AE001363_941897 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028111 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 110

 Score = 72.4 bits (176), Expect = 6e-12
 Identities = 40/111 (36%), Positives = 69/111 (62%), Gaps = 3/111 (2%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           T+F +II+  I    V+E++  +A +D  P+AP H+L+IPK       + + ++   + +
Sbjct: 2   TVFKQIIDGLIDCEKVFENENFIAIKDRFPQAPVHLLIIPKKP-----IPRFQDIPGDEM 56

Query: 266 GRLLYTAKLV---AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQL 409
             +    K+V   A + G+ + G+R+VIN+G +GGQ VFH+H+HL+GGR L
Sbjct: 57  ILMAEAGKIVQELAAEFGIAD-GYRVVINNGAEGGQAVFHLHIHLLGGRPL 106



>gb:CR543861_104197 Acinetobacter sp. ADP1 complete genome.
          Length = 137

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 46/102 (45%), Positives = 57/102 (55%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF +I+  E+PA  VYEDDQVLAF DI P+A  H L+IPKV    T L    E     + 
Sbjct: 8   IFARILRDELPAIKVYEDDQVLAFMDIMPQADGHTLVIPKV-PAETLLDLPPEAAAYTIQ 66

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +   AK +  + GLD  G  L+   G   GQTV H+H HLI
Sbjct: 67  IVQKVAKAI--ETGLDVKGIVLMQLSGSSAGQTVPHVHFHLI 106



>gb:MHP60F_144073 M.hominis gene for membrane protein P80 (ORF1),
           membrane lipoprotein protein P60 (ORF2) and putative
           HIT-like protein (ORF3).
          Length = 106

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF+KII +EIPA I+YED++ +AF DI P    H L+   VK+  T L   +++    L 
Sbjct: 5   IFEKIITREIPAKIIYEDEKFIAFEDIKPVDKGHFLV--TVKNHATNLYDIDDQTLSSL- 61

Query: 269 RLLYTAKLVAKQ-EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +L + +L  K+ + L   GF L+IN+     QTVF IH+H+I
Sbjct: 62  -ILKSRELALKRVKELGATGFNLIINNNLSADQTVFRIHVHII 103



>pir|AI2744|AI2744 HIT family protein [imported] - Agrobacterium
           tumefaciens  (strain C58, Dupont)>pir|H97525|H97525
           probable hit family protein (PA3295) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008063_233101 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 121 of 254 of the
           complete sequence.>gb:AE009098_248402 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 124 of
           256 of the complete sequence.>gb:AE007869_1082770
           Agrobacterium tumefaciens str. C58 circular chromosome,
           complete sequence.>gb:AE008688_1086245 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 142

 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 39/108 (36%), Positives = 61/108 (56%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   IF KI+  EIP++ +YED+  LAF D+ P+AP H+L++PK     TG     +   
Sbjct: 6   DDNNIFAKILRGEIPSHKLYEDEHTLAFMDVMPQAPGHLLVVPK-----TGSRNLLDADP 60

Query: 257 EILGRLLYTAK--LVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           ++L R +   +   VA +E  + +G  +   +    GQTVFH+H H+I
Sbjct: 61  QVLARTIAVVQKLAVAAKEAFNADGVFVAQFNEPAAGQTVFHLHFHVI 108



>gb:AE017355_462281 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.>gb:CP000001_851578 Bacillus
           cereus ZK, complete genome.
          Length = 144

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERHCEIL 265
           IF KII+ +IP + VYED+ VLAF DI      H L+IPKV K  +  L+       EI 
Sbjct: 9   IFCKIIDGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTP------EIA 62

Query: 266 GRLLYTAKLVAKQEGLDEN--GFRLVINDGKDGGQTVFHIHLHLI 394
             +      +A     + N  GF L+ N+G+  GQTVFH HLHLI
Sbjct: 63  SHIFSVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLI 107



>gb:AE017268_422380 Bacillus cereus ATCC 10987, section 5 of 18 of
           the complete genome.>gb:AE017194_1060799 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 165

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERHCEIL 265
           IF KII+ +IP + VYED+ VLAF DI      H L+IPKV K  +  L+       EI 
Sbjct: 30  IFCKIIDGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTP------EIA 83

Query: 266 GRLLYTAKLVAKQEGLDEN--GFRLVINDGKDGGQTVFHIHLHLI 394
             +      +A     + N  GF L+ N+G+  GQTVFH HLHLI
Sbjct: 84  SHIFSVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLI 128



>gb:AE017001_375992 Bacillus cereus ATCC 14579 section 4 of 18 of
           the complete genome.>gb:AE016877_1016242 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 144

 Score = 70.5 bits (171), Expect = 2e-11
 Identities = 45/105 (42%), Positives = 58/105 (55%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERHCEIL 265
           IF KII+ +IP + VYED+ VLAF DI      H L+IPKV K  +  L+       EI 
Sbjct: 9   IFCKIIDGQIPCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTP------EIA 62

Query: 266 GRLLYTAKLVAKQEGLDEN--GFRLVINDGKDGGQTVFHIHLHLI 394
             +      +A     + N  GF L+ N+G+  GQTVFH HLHLI
Sbjct: 63  SHIFSVVPKIANAIKTEFNPVGFNLLNNNGEKAGQTVFHFHLHLI 107



>pir|F86874|F86874 hypothetical protein yuhI [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006430_218900 Lactococcus lactis subsp.
           lactis IL1403 section 192 of 218 of the complete
           genome.>gb:AE005176_1095973 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 133

 Score = 69.3 bits (168), Expect = 5e-11
 Identities = 41/102 (40%), Positives = 56/102 (54%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  EIP+  +YEDD VLAF DI      H L++PK K     LS   E+  E+  
Sbjct: 5   IFCKIIAGEIPSTKIYEDDDVLAFLDITQTTKGHTLVVPK-KHYRNILSMTGEQSAELFS 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           ++ + A  +     L   G  ++ N+ +  GQTVFH H+HLI
Sbjct: 64  KVPFIANKIV--NNLHAKGMNILQNNEEIAGQTVFHTHIHLI 103



>gb:BX957219_843584 Methanococcus maripaludis S2 complete genome;
           segment 1/5.
          Length = 130

 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 41/102 (40%), Positives = 61/102 (59%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF  I+  +IPA I+YEDD+ LAF D  P+A  H L+IPK +   T     +E  CE++ 
Sbjct: 3   IFCDIVKGDIPARIIYEDDKFLAFMDAFPRAVGHTLIIPK-EHFETFDELPKELACEMME 61

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +    K+V K E L+ +G+ L+ N+ +  GQ V H+H H+I
Sbjct: 62  VI---HKIVKKLEKLEMDGYNLLNNNKQVSGQEVPHVHFHII 100



>gb:AP006618_556954 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 200

 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 46/107 (42%), Positives = 56/107 (52%), Gaps = 1/107 (0%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERH 253
           D  TIF  II    PA+ VYED  VLAF DI P  P H+L++PKV    L  L  A    
Sbjct: 56  DPYTIFSDIIAGRAPASTVYEDSDVLAFMDIRPMTPGHLLVVPKVPARSLAELDPAIGGK 115

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
              +G+ L  A L A +   D  G    + DG   GQ VFH+HLH+I
Sbjct: 116 LFQVGQKL-AAALRASEVACD--GVNFFLADGVAAGQEVFHVHLHVI 159



>gb:AE017332_445623 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 110

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 1/107 (0%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-VKDGLTGLSKAEERH 253
           ++ T+F  II K++PA I+YED++V+AF D  P +P H L++PK     L  +S  +  +
Sbjct: 2   ENTTLFLDIIAKKLPAKIIYEDEKVIAFYDKFPVSPGHFLVVPKNYSRNLFTISDEDFTY 61

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
                R L   +L    + L+   F+L+IN+ K+  QT+FH H+H+I
Sbjct: 62  LIKKARELALVEL----KKLNAISFKLLINNEKEAQQTIFHTHIHII 104



>gb:SAG766844_169885 Streptococcus agalactiae NEM316 complete
           genome, segment 2.>gb:AE014208_305710 Streptococcus
           agalactiae 2603V/R section 18 of 100 of the complete
           genome.>gb:AE009948_935823 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 139

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 43/103 (41%), Positives = 60/103 (58%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI-L 265
           IF KII+ EIP++ VYEDD+VLAF DI      H LLIP  K  +  + + +E+  +I  
Sbjct: 5   IFCKIISGEIPSSKVYEDDEVLAFLDITQTTTGHTLLIP--KKHVRNVLEMDEKTAQITF 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            RL   A+ V  Q      G  ++ N+ +  GQTVFH H+HL+
Sbjct: 63  ERLPKVARAV--QAATKAKGMNIINNNEEIAGQTVFHAHVHLV 103



>gb:CP000024_877388 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 139

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 41/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE-IL 265
           IF KII+ EIP++ VYEDD+VLAF DI      H L+IP  K+ +  + +   ++ E + 
Sbjct: 5   IFCKIISGEIPSSKVYEDDKVLAFLDISQATKGHTLVIP--KEHVRNILEMSAKNAETVF 62

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            R+   A+ V K  G    G  ++ N+ +  GQTVFH H+HL+
Sbjct: 63  SRVPKIARAVQKATG--AIGMNILNNNEEVAGQTVFHAHIHLV 103



>pir|E83798|E83798 Hit-like protein involved in cell-cycle
           regulation hit [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_655135 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 142

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 45/109 (41%), Positives = 57/109 (52%), Gaps = 3/109 (2%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERH 253
           D   IF KII  EIP+  VYEDD V AF DI      H L+IPKV K  +  LS+     
Sbjct: 4   DPNCIFCKIIAGEIPSATVYEDDHVYAFLDISQVTKGHTLVIPKVHKRNVFELSE----- 58

Query: 254 CEILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            EI   L      +++   +     G  +V N+G+  GQTVFH HLHL+
Sbjct: 59  -EIASSLFAAVPKISRAINDAFQPIGMNIVNNNGEAAGQTVFHYHLHLL 106



>pir|E87555|E87555 HIT family protein [imported] - Caulobacter
           crescentus>gb:AE005916_213604 Caulobacter crescentus
           CB15 section 242 of 359 of the complete
           genome.>gb:AE005673_923503 Caulobacter crescentus CB15
           complete genome.
          Length = 144

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 42/108 (38%), Positives = 60/108 (55%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF KII  EIP+  V+EDD+VLAF D+ P++  H L+I KV      L    E   
Sbjct: 8   DTGNIFAKIIRGEIPSVKVFEDDKVLAFMDVFPQSRGHALVISKVSQARNLL----EVEP 63

Query: 257 EILGRLLYTAKLVAKQ--EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           E+L  L+   + +AK     L  +G  +   +G   GQT+FH+H H+I
Sbjct: 64  EVLADLIAATQKLAKATVTALKPDGVVVTQFNGAPAGQTIFHLHFHVI 111



>pir|E89970|E89970 hypothetical protein hit [imported] -
           Staphylococcus aureus  (strain N315)>gb:CP000046_91999
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677524 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680106
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_712070 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781359 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783983 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 140

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 41/105 (39%), Positives = 56/105 (53%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S TIF KI+  EIP+  VYEDD V AF DI      H LLIP  K     + + +E   +
Sbjct: 2   SETIFGKILTGEIPSFKVYEDDYVYAFLDISQVTKGHTLLIP--KKASANIFETDEETMK 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +G  L       K+   + +G  ++ N+G+   Q+VFHIH HLI
Sbjct: 60  HIGAALPKVANAIKR-AFNPDGLNIIQNNGEFADQSVFHIHFHLI 103



>gb:BA000026_693701 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 145

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 43/107 (40%), Positives = 56/107 (52%), Gaps = 5/107 (4%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE--I 262
           +F KI+NKEIP+NIV E+   LAF DI P +  H L+IPK           +  HC+   
Sbjct: 10  LFCKIVNKEIPSNIVDENAYALAFLDISPASDGHTLVIPK-------KHCIDLVHCDELY 62

Query: 263 LGRLLYTAKLVA---KQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           L   +  AK VA   +   L   GF  + N G   GQ +FH HLH+I
Sbjct: 63  LKETISLAKKVADTIESSSLKPWGFNFLSNQGSIAGQVIFHFHLHVI 109



>gb:CP000023_875461 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 139

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 42/102 (41%), Positives = 58/102 (56%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII+ EIP++ VYEDD+VLAF DI      H L+IPK +     L  + E    +  
Sbjct: 5   IFCKIISGEIPSSKVYEDDKVLAFLDISQATKGHTLVIPK-EHVRNILEMSAETAETVFS 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+ V K  G    G  ++ N+ +  GQTVFH H+HL+
Sbjct: 64  RVPKIARAVQKATG--AIGMNILNNNEEVAGQTVFHAHIHLV 103



>gb:AE017027_381274 Bacillus anthracis str. Ames section 4 of 18 of
           the complete genome.>gb:AE017225_406378 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451123 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1010979 Bacillus
           anthracis str. Ames complete genome.
          Length = 144

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 44/105 (41%), Positives = 57/105 (54%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERHCEIL 265
           IF KII+ +I  + VYED+ VLAF DI      H L+IPKV K  +  L+       EI 
Sbjct: 9   IFCKIIDGQILCSKVYEDEHVLAFLDISQVTKGHTLVIPKVHKQDIFALTP------EIA 62

Query: 266 GRLLYTAKLVAKQEGLDEN--GFRLVINDGKDGGQTVFHIHLHLI 394
             +      +A     + N  GF L+ N+G+  GQTVFH HLHLI
Sbjct: 63  SHIFSVVPKIANAIKAEFNPVGFNLLNNNGEKAGQTVFHFHLHLI 107



>gb:AP006618_557406 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 150

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 40/105 (38%), Positives = 56/105 (53%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F +I+    PA  VYED+ + AF DI P A  H L+IPK      GL   +      + 
Sbjct: 9   VFCRIVAGAAPATKVYEDETLCAFLDIRPIARGHTLVIPKRH--AAGLPDLDPELGAAMF 66

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGR 403
           R  +   L  ++ GL  +G  LV+NDG+   QTV H+HLH+I  R
Sbjct: 67  RAAHRIALAMRRGGLAADGANLVLNDGRAAFQTVGHVHLHVIPRR 111



>gb:BX897699_827242 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 140

 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 39/108 (36%), Positives = 59/108 (54%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF K+I  EIP+  VYEDD V+AF DI P+AP H L+IPK      G     +   
Sbjct: 6   DNNNIFAKLIRNEIPSVRVYEDDDVIAFMDIMPQAPGHTLVIPK-----KGSRNLLDADT 60

Query: 257 EILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           E L  ++   + +AK  ++    +G  ++  +     QTV+H+H H+I
Sbjct: 61  ETLFPVIKAVQKIAKAVKKAFQADGITVMQFNEAASQQTVYHLHFHII 108



>sp|P32083|YHIT_MYCHR Hypothetical 13.1 kDa HIT-like protein in P37
           5'region.
          Length = 111

 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-VKDGLTGLSKAEERHCEIL 265
           +F KII +E PA I+YEDD+V+AF D       H L++PK     L  +S       E L
Sbjct: 8   LFLKIIKREEPATILYEDDKVIAFLDKYAHTKGHFLVVPKNYSRNLFSISD------EDL 61

Query: 266 GRLLYTAKLVAKQE--GLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             L+  A+  A QE   L   GF+L+IN+  D  Q++FH H+H+I
Sbjct: 62  SYLIVKAREFALQEIKKLGATGFKLLINNEPDAEQSIFHTHVHII 106



>gb:AY657240_2146250 Synthetic construct Peudomonas aeruginosa clone
           FLH043783.01F PA3295 gene, partial cds.
          Length = 146

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/106 (36%), Positives = 57/106 (53%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           DS  IF KII  E P   VYED+ VLAF D+ P++  H L+IPK  +    L    +   
Sbjct: 8   DSQNIFAKIIRGEAPCYKVYEDEDVLAFLDLFPQSYGHTLVIPKHAEARNLLEIEAQNLV 67

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +++  +    +  A  E +  +G ++   +G   GQTVFHIH H+I
Sbjct: 68  KVMAVVQRLTR--ALVEEVQPDGVQVAQFNGAPAGQTVFHIHFHVI 111



>gb:BA000012_666495 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 143

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           ++  IF KI+  EIP++ VYEDD V+AF D+ P+ P H L++PK            + + 
Sbjct: 7   ETDNIFAKILRGEIPSHRVYEDDAVVAFMDVMPQGPGHTLVVPKAPS-----RNLLDANP 61

Query: 257 EILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
              G L    + VA+  ++ L+ +G  ++  +    GQTV+H+H+H+I
Sbjct: 62  STFGPLFNVVQKVAQAVKKALNADGVTILQFNEPASGQTVYHLHVHVI 109



>gb:AP006628_567065 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 153

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/103 (37%), Positives = 57/103 (55%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KII K++P  ++YED+ V+AF DI      H L++PK ++    L   E+    + 
Sbjct: 17  TIFTKIIKKQVPGYLLYEDNLVVAFLDIAQATKGHTLVVPK-QEYRDILMMPEDVFAHLF 75

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             +   +K  A  +     G  L+ N+GK  GQTVFH H+HLI
Sbjct: 76  KVVHQISK--ALMDVFQAQGINLLNNNGKVAGQTVFHYHVHLI 116



>pir|H83234|H83234 probable HIT family protein PA3295 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004751_57531
           Pseudomonas aeruginosa PAO1, section 312 of 529 of the
           complete genome.>gb:AE004091_971631 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 145

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/106 (36%), Positives = 57/106 (53%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           DS  IF KII  E P   VYED+ VLAF D+ P++  H L+IPK  +    L    +   
Sbjct: 8   DSQNIFAKIIRGEAPCYKVYEDEDVLAFLDLFPQSYGHTLVIPKHAEARNLLEIEAQNLV 67

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +++  +    +  A  E +  +G ++   +G   GQTVFHIH H+I
Sbjct: 68  KVMAVVQRLTR--ALVEEVQPDGVQVAQFNGAPAGQTVFHIHFHVI 111



>gb:AE014888_312839 Streptococcus mutans UA159 section 36 of 185 of
           the complete genome.>gb:AE014133_939840 Streptococcus
           mutans UA159 complete genome.
          Length = 139

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 36/102 (35%), Positives = 57/102 (55%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI+  +IP++ VYED+ VLAF DI      H L+IPK +     L   + +   +  
Sbjct: 5   LFCKIVAGDIPSSKVYEDEDVLAFLDISQATKGHTLVIPK-EHVRNALEMTQTQAANLFA 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+  A Q+    +G  ++ N+ +  GQTVFH H+HL+
Sbjct: 64  RIPKIAR--ALQKATKADGLNIINNNEETAGQTVFHAHVHLV 103



>gb:CP000029_81970 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016749_323168 Staphylococcus epidermidis
           ATCC 12228, section 6 of 9 of the complete
           genome.>gb:AE015929_1147837 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 141

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 39/105 (37%), Positives = 56/105 (53%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S TIF KII+ EIP+  +YE+D V AF DI   +  H LL+PK       + + +E   +
Sbjct: 2   SETIFSKIISGEIPSFKIYENDYVYAFLDISQVSKGHTLLVPKKPS--ANIFETDEETMK 59

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +G  L       K      +G  ++ N+G+   Q+VFHIH HLI
Sbjct: 60  HIGVALPKVANAIK-NAFHPDGLNIIQNNGEYADQSVFHIHFHLI 103



>gb:AE010743_266186 Methanosarcina acetivorans str. C2A, section 88
           of 534 of the complete genome.>gb:AE010299_906745
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 150

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 38/104 (36%), Positives = 57/104 (54%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KII  EIP++ +YEDD + AF DI P +  H L+ PK       LS   + + E + 
Sbjct: 17  LFCKIITGEIPSHRIYEDDAIYAFLDIYPASEGHTLIAPK-----KHLSNFTDMNAEDVA 71

Query: 269 RLLYTAKLV--AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            L   A+ V  A ++     G  + IN+G+  GQ V H+H+H+I
Sbjct: 72  LLFEAARKVTAAVEKAFSAEGSNIGINNGEVAGQEVPHVHVHVI 115



>gb:CR382126_1658604 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 148

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 46/130 (35%), Positives = 61/130 (46%), Gaps = 11/130 (8%)
 Frame = +2

Query: 62  NAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKA 241
           +AV  D+  IF KII  EIP+  + E     +F DI P    HIL+IPK   G     K 
Sbjct: 2   SAVAHDAACIFCKIIKGEIPSFKLVETQYSYSFLDIQPTEENHILIIPKHHGG-----KL 56

Query: 242 EERHCEILGRLLYTAKLVAK-----QEGLDENGFRLVINDGKDGGQTVFHIHLHLI---- 394
                E L  LL   K + K     Q+G D  G+ ++ N+G+   Q V H+H HLI    
Sbjct: 57  HNIPDEYLADLLPVTKKLVKAIGFDQDGPDGPGYNVLQNNGRIAHQEVDHVHFHLIPKKT 116

Query: 395 --GGRQLNWP 418
              G  + WP
Sbjct: 117 KDAGLIVGWP 126



>gb:BA000023_692124 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 141

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 3/105 (2%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  EI +  VYED +++AF DI+P    H+L+IP  KD    +    +   E LG
Sbjct: 7   IFCKIVKGEIKSQKVYEDQEIMAFLDINPVNKGHVLVIP--KDHYENIFDVPK---EKLG 61

Query: 269 RLLYTAKLVA---KQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +++   + VA   ++ G D  G  +V N+GK   Q +FH+H+H+I
Sbjct: 62  KVIEVVQKVAIALRKMGAD--GVNIVSNNGKAAEQHIFHLHIHVI 104



>pir|D75073|D75073 hit-like protein PAB0657 - Pyrococcus abyssi
           (strain Orsay)>gb:CNSPAX04_849738 Pyrococcus abyssi
           complete genome; segment 4/6.
          Length = 147

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 51/152 (33%), Positives = 69/152 (45%), Gaps = 24/152 (15%)
 Frame = +2

Query: 119 PANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLV- 295
           P N+VYED  +    D  P  P H+L++PK             RH   +G L    KL  
Sbjct: 10  PENVVYEDKFIRILLDNYPANPGHLLVVPK-------------RHVTSIGNLTEDEKLAL 56

Query: 296 ---------AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI-----------GGRQ--- 406
                    A +  L  +GF + IN GK  GQTV HIH+H+I           GG +   
Sbjct: 57  LKGIELAVKALKRALKADGFNVGINIGKAAGQTVDHIHIHVIPRYEGDCDYPEGGIRKAV 116

Query: 407 LNWPPG*LDLSNCRDPEDRCPSRIIQRIRVVL 502
           LN+P       N R+ ++R  S+ I+RIR VL
Sbjct: 117 LNFPD-----ENLRNTKNRLSSKEIERIRRVL 143



>pir|AC1722|AC1722 histidine triad (HIT) protein homolog lin2319
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596171_539661 Listeria innocua Clip11262
           complete genome, segment 9/12.
          Length = 140

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 40/102 (39%), Positives = 55/102 (53%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  EIP+  VYEDD+V AF D+      H L+IPK K         EE   E+  
Sbjct: 5   IFCKIVRGEIPSAKVYEDDEVYAFLDLGQVTEGHTLVIPK-KHARNTFDLPEETAAELFR 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+  A +E L   G  ++ N+ +   Q+VFH H+HLI
Sbjct: 64  RVPKIAR--ALKEALPLQGLNILNNNEEVAYQSVFHCHIHLI 103



>gb:CR380956_1652394 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 145

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 7/125 (5%)
 Frame = +2

Query: 65  AVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAE 244
           +V  D+  IF KII  EIP+  + E   V +F DI P +  H L+IPK        +K  
Sbjct: 4   SVAHDAACIFCKIIKGEIPSFKLIETKHVYSFLDIQPTSQGHALVIPKWHG-----AKLH 58

Query: 245 ERHCEILGRLLYTAKLVAKQEGLDENG-FRLVINDGKDGGQTVFHIHLHLI------GGR 403
           +   E L  +L TAK +AK   LD +G + ++ N+G+   Q V H+H HLI       G 
Sbjct: 59  DIPDEYLHDVLPTAKKIAKALNLDADGNYNILQNNGRLAHQEVDHVHFHLIPKPDEKTGL 118

Query: 404 QLNWP 418
            + WP
Sbjct: 119 IVGWP 123



>gb:SME591787_185508 Sinorhizobium meliloti 1021 complete
           chromosome; segment 6/12.
          Length = 139

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 2/112 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF KI+  EIP++ VYED+  +AF D+ P+A  H+L++PK            +   
Sbjct: 5   DTNNIFAKILRGEIPSHRVYEDEATVAFMDVMPQAEGHVLVLPKAPS-----RNILDADP 59

Query: 257 EILGRLLYTAK--LVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQ 406
             L  L+ T +   VA +   D +G  ++  +    GQ+VFH+H H++  R+
Sbjct: 60  ATLTSLIATVQKIAVAAKAAFDADGVTIMQFNEAPAGQSVFHLHFHVVPRRE 111



>gb:AF539982_2500162 Taeniopygia guttata ASW-related protein
           (ASW92-1) mRNA, complete cds.
          Length = 107

 Score = 62.4 bits (150), Expect = 7e-09
 Identities = 33/89 (37%), Positives = 54/89 (60%)
 Frame = +2

Query: 158 FRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLV 337
           F D+ P   T  L++PK  + +  LS+A      +LG ++   ++      L  NGFR+V
Sbjct: 22  FHDLLPLDGTLFLVMPK--EPIIELSEAGASGESLLGHVMIVGEMCVAHLVLT-NGFRMV 78

Query: 338 INDGKDGGQTVFHIHLHLIGGRQLNWPPG 424
           +++  +GGQ+V+H+HL ++GG QL WPPG
Sbjct: 79  LDERPEGGQSVYHMHLPVLGGLQLGWPPG 107



>gb:CP000013_869611 Borrelia garinii PBi, complete genome.
          Length = 139

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 37/104 (35%), Positives = 55/104 (52%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGL-SKAEERHCEI 262
           IF KI+NKE+P+  VYEDD VLAF D++P    H L+IPK   + L  +  K  ER   +
Sbjct: 5   IFCKIVNKELPSYKVYEDDLVLAFLDVNPLTVGHTLVIPKEHSENLLNMDDKFNERVLRV 64

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             ++   +  + +       G  +  + G   GQ +FH H H+I
Sbjct: 65  CKKI---SNALKRMNSSIYGGINIYSSLGAGAGQEIFHTHFHVI 105



>gb:AE017333_446953 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856770 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 139

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 2/107 (1%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF KIIN EIP   V+E++ VLAF DI      H L+IPKV       +   E   E
Sbjct: 2   SDCIFCKIINGEIPCAKVFENEHVLAFLDISQVTKGHTLVIPKVHK-----TNIYEMTPE 56

Query: 260 ILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +          +A+  ++  +  G  L+ N+G+  GQ+VFH H+H+I
Sbjct: 57  VSREFFEAVPKIAQAIKDEYEPIGLNLLNNNGEKAGQSVFHYHMHII 103



>gb:AE013433_292288 Methanosarcina mazei strain Goe1, section 215 of
           379 of the complete genome.>gb:AE008384_966397
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 155

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 38/104 (36%), Positives = 55/104 (52%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KII+ EIP+  VYEDD V AF DI P +  H L+ PK        +   +   E   
Sbjct: 10  LFCKIISGEIPSKKVYEDDAVCAFLDIYPASEGHTLIAPK-----KHFNSFTDMGAEDTA 64

Query: 269 RLLYTAKLV--AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           RL   A+ +  A ++     G  + IN+G+  GQ V H+H+H+I
Sbjct: 65  RLFEAARKITAAVEKAFSAEGSNIGINNGEVAGQEVPHVHVHVI 108



>gb:CP000031_85426 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 140

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 45/122 (36%), Positives = 61/122 (50%), Gaps = 6/122 (4%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERH 253
           D   IF KI+  EIP+  VYEDD  LAF DI P+A  H+L+IPK     L   S A+   
Sbjct: 6   DPDNIFAKILRGEIPSTRVYEDDDTLAFMDIMPRADGHLLVIPKTPCRNLLDASPAQ--- 62

Query: 254 CEILGRLLYTAKLV--AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI---GGRQLNWP 418
              L  ++ T + +  A        G  +   +   GGQ VFH+H H++    G +L  P
Sbjct: 63  ---LAAVMATVQKLSHAVMAAFGAEGVTIQQFNEAAGGQEVFHLHFHVLPRHEGERLR-P 118

Query: 419 PG 424
           PG
Sbjct: 119 PG 120



>pir|AH1351|AH1351 histidine triad (HIT) protein homolog lmo2216
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AE017329_444667 Listeria monocytogenes str. 4b
           F2365, section 8 of 10 of the complete
           genome.>gb:AL591982_536707 Listeria monocytogenes strain
           EGD, complete genome, segment 10/12.>gb:AE017262_1077023
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 140

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 39/102 (38%), Positives = 55/102 (53%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  EIP+  VYEDD+V AF D+      H L+IPK K         +E   E+  
Sbjct: 5   IFCKIVRGEIPSAKVYEDDEVYAFLDLGQVTEGHTLVIPK-KHARNTFDLPDETAAELFR 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+  A +E L   G  ++ N+ +   Q+VFH H+HLI
Sbjct: 64  RVPKIAR--ALKEALPIQGLNILNNNEEVAFQSVFHCHIHLI 103



>pir|B70147|B70147 protein kinase C inhibitor homolog - Lyme disease
           spirochete>gb:AE001143_32359 Borrelia burgdorferi B31
           (section 29 of 70) of the complete
           genome.>gb:AE000783_1120010 Borrelia burgdorferi B31
           complete genome.
          Length = 149

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 41/104 (39%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGL-SKAEERHCEI 262
           IF KIINKE+P+  VYEDD VLAF DI+P    H L+IPK   + L  +  K  ER  ++
Sbjct: 15  IFCKIINKELPSYKVYEDDLVLAFLDINPLTVGHTLVIPKEHSESLLNMDDKFNERVLKV 74

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             ++    K +         G  +    G   GQ VFH H H+I
Sbjct: 75  CKKISNALKRI---NSSIYGGINIYSALGAGAGQEVFHTHFHVI 115



>sp|P94252|YHIT_BORBU Hypothetical HIT-like protein
           BB0379.>gb:BBU49938_747879 Borrelia burgdorferi
           potential virulence gene cluster, partial sequence;
           putative protein 4, magnesium ion transporter MgtE
           (mgtE), and protein kinase C1 inhibitor Pkci (pkci)
           genes, complete cds.
          Length = 139

 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 41/104 (39%), Positives = 54/104 (51%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGL-SKAEERHCEI 262
           IF KIINKE+P+  VYEDD VLAF DI+P    H L+IPK   + L  +  K  ER  ++
Sbjct: 5   IFCKIINKELPSYKVYEDDLVLAFLDINPLTVGHTLVIPKEHSESLLNMDDKFNERVLKV 64

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             ++    K +         G  +    G   GQ VFH H H+I
Sbjct: 65  CKKISNALKRI---NSSIYGGINIYSALGAGAGQEVFHTHFHVI 105



>sp|O07513|HIT_BACSU Hit protein.>pir|A69642|A69642 cell-cycle
           regulation histidine triad (HIT) protein - Bacillus
           subtilis>gb:BSUB0006_752968 Bacillus subtilis complete
           genome (section 6 of 21): from 1011039 to
           1209781.>gb:BSY14077_756214 Bacillus subitlis 10.6 Kb
           chromosomal DNA: glyB-prsA region.
          Length = 145

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  +IP+  VYED+ VLAF DI      H L+IPK     T +    E   E+  
Sbjct: 8   IFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPK-----THIENVYEFTDELAK 62

Query: 269 RLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +  +    +A+  ++  +  G   + N+G+  GQ+VFH H+H+I
Sbjct: 63  QYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHII 106



>gb:AE017205_404832 Lactobacillus johnsonii NCC 533, section 6 of 7
           of the complete genome.>gb:AE017198_1123319
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 144

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 39/110 (35%), Positives = 57/110 (51%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KII  EIP+  V+E+D V AF DI      H L+IPK K  +     ++E     L 
Sbjct: 9   LFCKIIRGEIPSYTVFENDDVKAFLDISQVTKGHTLIIPK-KHLVNFFDYSQEDAARFLQ 67

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
            +   A+ + K +   + G  + +N+G+  GQ V H H+HLI  R  N P
Sbjct: 68  YIPVIAQAIKKSDPTIK-GLNVEVNNGEIAGQVVMHSHIHLIPRRSENDP 116



>gb:BA000040_733395 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 142

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERH 253
           D+  IF KI+  E P + VYED+ V AF DI P+ P H L+IPK     +  +   +  H
Sbjct: 5   DTNNIFAKILRGEFPCHKVYEDEHVFAFLDIMPRVPGHTLVIPKAPARNILDIKPDDYAH 64

Query: 254 CEILGRLLYTAKLVA-KQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
                  +  A + A K +G+    F     +   GGQ VFH+H+H++
Sbjct: 65  VARGAHRISAAAMKAFKADGITVQQF-----NEPAGGQVVFHLHMHVL 107



>gb:AP006627_563851 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 141

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 37/102 (36%), Positives = 52/102 (50%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI+  EIPA  +YEDD+++AF DI      H L+IPK       +    E+    L 
Sbjct: 6   VFCKIVQGEIPAVKLYEDDEIVAFFDISQVTKGHALVIPKAHH--ADIFSLPEKTAATLF 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             +       K E     G  ++ N+G+  GQTVFH HLHL+
Sbjct: 64  AAVPKLASALKAE-FAPAGMNILNNNGEAAGQTVFHYHLHLL 104



>gb:AL935256_551259 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 5/11.
          Length = 150

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 41/109 (37%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERH 253
           D   IF KII  +IP+  VYEDD V AF DI    P H L++PK     + G  +  +  
Sbjct: 9   DDDCIFCKIIKGDIPSYTVYEDDMVKAFLDISQGTPGHTLVVPKTHVADIFGYDR--DLA 66

Query: 254 CEILGRLLYTAKLVAKQEGLDEN--GFRLVINDGKDGGQTVFHIHLHLI 394
             +  R+   A+ +   +  DEN  G  +V N+G    Q+VFH H HLI
Sbjct: 67  SIVFARIPEIARAI---KATDENIIGMNIVNNNGAVAYQSVFHSHFHLI 112



>gb:CR382139_1672674 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 150

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 44/127 (34%), Positives = 60/127 (47%), Gaps = 12/127 (9%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH 253
           S++  IF KII  EIP+  + E     +F DI P A  H L+IPK        +K     
Sbjct: 4   SNASCIFCKIIKGEIPSFKLIETKLTYSFLDIQPTAEAHCLIIPKYHG-----AKLHSIP 58

Query: 254 CEILGRLLYTAKLVAKQEGLDEN------GFRLVINDGKDGGQTVFHIHLHLI------G 397
            E L  +L   K +AK   LDEN      G+ ++ N+G+   Q V H+H HLI       
Sbjct: 59  DEYLADILPVTKKLAKLLKLDENNTLDGEGYNVLQNNGRIAHQVVDHVHFHLIPKKDEAT 118

Query: 398 GRQLNWP 418
           G  + WP
Sbjct: 119 GLGVGWP 125



>gb:AY596297_633885 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 142

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 37/116 (31%), Positives = 59/116 (50%), Gaps = 8/116 (6%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF +I+  +IP   VYEDD VLAF D +P +P H L+IPK         +  +   ++  
Sbjct: 6   IFCQIVAGDIPGRTVYEDDTVLAFLDANPLSPGHTLVIPKAHH-----ERLNDTPADVAS 60

Query: 269 RLLYTAK--LVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI------GGRQLN 412
            ++ T    + A +  +D     +  N+G+  GQ V H+H H+I      GGR ++
Sbjct: 61  AVMSTLHELVPAVESAVDAPASTVAFNNGEVAGQEVPHVHGHIIPRFEDDGGRPIH 116



>gb:AE016969_369776 Mycoplasma gallisepticum strain R section 3 of 4
           of the complete genome.>gb:AE015450_1034425 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 146

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 36/102 (35%), Positives = 54/102 (52%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KIIN EI A++V ++D  +AF D  P +  H L+IPK        +  EE H  +  
Sbjct: 17  VFCKIINNEIQAHVVAQNDLAIAFLDAFPVSNGHTLVIPKKHHQDFSRTPKEEMHA-VTD 75

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
                 KL+ + + L+ +G+  + N     GQ VFH HLH+I
Sbjct: 76  LAQEVVKLLDRSD-LNVHGYNYLSNQASIAGQEVFHFHLHII 116



>gb:AE010221_260674 Pyrococcus furiosus DSM 3638, section 96 of 173
           of the complete genome.>gb:AE009950_901455 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 146

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 35/90 (38%), Positives = 53/90 (58%)
 Frame = +2

Query: 125 NIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVAKQ 304
           NIVYEDD++    D  P  P H+L++PK    +T +    E    +L + +  A + A +
Sbjct: 12  NIVYEDDKIRILLDSFPANPGHLLVVPKRH--ITNIEGLNEEEKVMLMKGVEMA-IKALK 68

Query: 305 EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           E L+ +GF + IN GK  GQTV H+H+H+I
Sbjct: 69  EALNPDGFNVGINLGKAAGQTVSHLHVHVI 98



>gb:AE006602_220600 Streptococcus pyogenes M1 GAS, section 131 of
           167 of the complete genome.>gb:AE010084_259153
           Streptococcus pyogenes strain MGAS8232, section 132 of
           173 of the complete genome.>gb:AE014165_304981
           Streptococcus pyogenes MGAS315, section 30 of 37 of the
           complete genome.>gb:BA000034_713287 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:CP000003_861391
           Streptococcus pyogenes MGAS10394, complete
           genome.>gb:AE009949_905535 Streptococcus pyogenes strain
           MGAS8232, complete genome.>gb:AE014074_928160
           Streptococcus pyogenes MGAS315, complete
           genome.>gb:AE004092_1106446 Streptococcus pyogenes M1
           GAS, complete genome.
          Length = 139

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 37/102 (36%), Positives = 52/102 (50%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF  II  +IP++ VYED+QVLAF DI      H L+IPK +     L    E    +  
Sbjct: 5   IFCSIIQGDIPSSKVYEDEQVLAFLDISQTTKGHTLVIPK-QHVRNLLEMTAETASHLFA 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+ +  Q         ++ N+    GQTVFH H+HL+
Sbjct: 64  RIPKIARAI--QSATGATAMNIINNNEALAGQTVFHAHVHLV 103



>gb:AE016819_1748992 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 150

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 11/140 (7%)
 Frame = +2

Query: 62  NAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKA 241
           +AV  D+  +F KII  EIP+  + E     AF DI P A  H L+IPK        +K 
Sbjct: 3   SAVAHDAACVFCKIIKGEIPSFKLMETAHSYAFLDIQPTAEGHTLIIPKYHG-----AKL 57

Query: 242 EERHCEILGRLLYTAKLVAKQEGLDEN-----GFRLVINDGKDGGQTVFHIHLHLI---- 394
                E L  +L   + + K  G D +     G+ ++ N+G+   Q V H+H HLI    
Sbjct: 58  HNVPDEYLADILPVTRKLVKALGCDNDGPTGPGYNVLQNNGRLAHQEVDHVHFHLIPKRN 117

Query: 395 --GGRQLNWPPG*LDLSNCR 448
              G  + WP    D+ + +
Sbjct: 118 AVSGLGVGWPAAPADMESLK 137



>gb:BA000023_692838 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 150

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 37/111 (33%), Positives = 60/111 (54%), Gaps = 2/111 (1%)
 Frame = +2

Query: 92  FDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGR 271
           F  IIN+E+    VYED++  A  D  P +  H L+IPK         +A+E   + L  
Sbjct: 4   FCSIINRELEGYFVYEDEKFAAILDKYPVSLGHTLVIPKKH--FENYLEADE---DTLAE 58

Query: 272 LLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
           L    KLV+   ++ +  +G RL+ N G+  GQ +FH+H+H+I   + ++P
Sbjct: 59  LAKVVKLVSLGIKDAVKADGLRLLTNIGRSAGQVIFHLHVHIIPTWEGDYP 109



>gb:AE017310_438651 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 2 of 12 of the complete
           genome.>gb:AE017285_1071812 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 139

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 36/107 (33%), Positives = 51/107 (47%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH 253
           S S  IF KII  EIP   +Y DD V++F DI P    H L++P+ +   T      E  
Sbjct: 2   SQSDCIFCKIIRGEIPCAQLYADDHVISFMDIGPVKRGHALVVPR-EHHATVFDMPAELG 60

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             ++G      + +    G +  G  +  N+    GQ VFH+H HLI
Sbjct: 61  AHVMGAAQRVGRAIMAATGAE--GLNIFQNNFAAAGQVVFHVHWHLI 105



>pir|B97929|B97929 conserved hypothetical protein spr0458 [imported]
           - Streptococcus pneumoniae (strain R6)>pir|F95060|F95060
           HIT family protein [imported] - Streptococcus pneumoniae
            (strain TIGR4)>gb:AE007363_225740 Streptococcus
           pneumoniae TIGR4 section 46 of 194 of the complete
           genome.>gb:AE008426_236779 Streptococcus pneumoniae R6
           section 42 of 184 of the complete
           genome.>gb:AE007317_942937 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1103508 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 136

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 6/111 (5%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK------VKDGLTGLSKA 241
           S  IF KII  EIPA+ VYED+QVLAF DI      H L++PK      ++   T  S+ 
Sbjct: 2   SDCIFCKIIAGEIPASKVYEDEQVLAFLDISQVTLGHTLVVPKEHYRNLLEMDATSASQL 61

Query: 242 EERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             +  ++  +++   K           G  ++ N  +  GQTVFH H+HL+
Sbjct: 62  FAQVPKVAQKVMKVTKAA---------GMNIISNCEEVAGQTVFHTHVHLV 103



>gb:BX897700_828933 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 140

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF K+I  EI +  VYEDD V+AF DI P+AP H L+IP+      G     +   
Sbjct: 6   DNNNIFAKLIRNEISSVRVYEDDDVIAFMDIMPQAPGHTLVIPR-----KGSRNLLDADT 60

Query: 257 EILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           E L  ++   + +A   ++    +G  ++  +     QTV+H+H H+I
Sbjct: 61  ETLFPVIKVVQKIANAVKKAFQADGVTVMQFNEAASQQTVYHLHFHVI 108



>gb:AE000516_21332 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 156

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 46/141 (32%), Positives = 65/141 (46%), Gaps = 4/141 (2%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKD-GLTGLSKAEER 250
           SD P +F  II  E PA  +YED   LA  DI P    H L++PK     LT        
Sbjct: 11  SDMPCVFCAIIAGEAPAIRIYEDGGYLAILDIRPFTRGHTLVLPKRHTVDLTDTPPEALA 70

Query: 251 HCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI---GGRQLNWPP 421
               +G+ +  A    K      +   + INDG+   QTVFH+HLH++    G +L+   
Sbjct: 71  DMVAIGQRIARAARATKL----ADATHIAINDGRAAFQTVFHVHLHVLPPRNGDKLSVAK 126

Query: 422 G*LDLSNCRDPEDRCPSRIIQ 484
           G   +   RDP+     RI++
Sbjct: 127 G---MMLRRDPDREATGRILR 144



>gb:AE014291_308601 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 140

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 35/106 (33%), Positives = 54/106 (50%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   IF KI+  EIP+  VYE D V+AF D+ P+   H L++PK       L    E   
Sbjct: 6   DDNNIFAKILRGEIPSTRVYETDSVVAFMDVMPQGKGHTLVVPKA-PSRNLLDARPETLA 64

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +++  +   A  V K    + +G  ++  +    GQTV+H+H H+I
Sbjct: 65  DVIQAVQKIANAVKK--AFNADGVTVMQFNEPASGQTVYHLHFHVI 108



>pir|AC3354|AC3354 bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
           (EC 3.6.1.17) [imported] - Brucella melitensis (strain
           16M)>gb:AE009523_252735 Brucella melitensis 16M
           chromosome I, section 80 of 195 of the complete
           sequence.>gb:AE008917_978647 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 149

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 35/106 (33%), Positives = 54/106 (50%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   IF KI+  EIP+  VYE D V+AF D+ P+   H L++PK       L    E   
Sbjct: 15  DDNNIFAKILRGEIPSTRVYETDSVVAFMDVMPQGKGHTLVVPKA-PSRNLLDARPETLA 73

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +++  +   A  V K    + +G  ++  +    GQTV+H+H H+I
Sbjct: 74  DVIQAVQKIANAVKK--AFNADGVTVMQFNEPASGQTVYHLHFHVI 117



>gb:BX842643_822510 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 2/4.
          Length = 132

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC-EIL 265
           +F KIIN+EIP+  +YE++ V +F D+ P +  H+L+IP  K      S  ++++  E++
Sbjct: 4   LFCKIINQEIPSYKIYENEYVYSFLDVRPVSNGHLLIIP--KKHFENFSACDDKYLQEVI 61

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
               +   L+  +E L+  GF  + N+    GQTV H H H++
Sbjct: 62  LAKKHLVNLL--KEKLNPAGFNYLSNEQAISGQTVLHYHEHIM 102



>gb:AL646079_548864 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 4/11.
          Length = 144

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF KI+  E P   VYED+  LAF DI P+A  H+L++PK      G ++  +   
Sbjct: 7   DNQNIFAKILRGEAPCIKVYEDEHTLAFMDIMPQADGHVLVLPK-----EGAAELFDLSD 61

Query: 257 EILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +     + T + +A+  +      G  +   +G   GQTV H+H H++
Sbjct: 62  DAAAAAIRTTRKLARAVRRAFTPPGIAVFQLNGSAAGQTVPHVHFHVL 109



>gb:AE017263_420798 Mesoplasma florum L1 complete genome.
          Length = 135

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 34/102 (33%), Positives = 52/102 (50%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII +EIP+  +YE++ V AF DI+P +  H L+IPKV      LS   + +   + 
Sbjct: 5   IFCKIIKQEIPSYKIYENEYVYAFLDINPVSDGHALVIPKVH--AENLSTTPDLYLSEVS 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           +       + +++     GF  V N      Q VFH H H++
Sbjct: 63  KAKKVVAQILQEKLKGVKGFNYVSNQEAIAKQVVFHYHEHIL 104



>sp|Q04344|HNT1_YEAST Hit family protein 1 (Adenosine
           5'-monophosphoramidase).>pir|B39977|B39977 histidine
           triad protein YDL125c - yeast (Saccharomyces
           cerevisiae)>gb:SCCDC48_1706652 S. cerevisiae CDC48 gene
           for cell cycle protein CDC48p.>gb:SCYDL125C_1711693
           S.cerevisiae chromosome IV reading frame ORF YDL125c.
          Length = 158

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 43/120 (35%), Positives = 57/120 (47%), Gaps = 6/120 (5%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D+  IF KII  EIP+  + E     AF DI P A  H L+IPK        +K  +   
Sbjct: 22  DAACIFCKIIKSEIPSFKLIETKYSYAFLDIQPTAEGHALIIPKYHG-----AKLHDIPD 76

Query: 257 EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI------GGRQLNWP 418
           E L   +  AK +AK   LD   + ++ N+GK   Q V H+H HLI       G  + WP
Sbjct: 77  EFLTDAMPIAKRLAKAMKLDT--YNVLQNNGKIAHQEVDHVHFHLIPKRDEKSGLIVGWP 134



>gb:MLU15187_149040 Mycobacterium leprae cosmid L296.
          Length = 155

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +2

Query: 44  TPMASGNAVPSDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGL 223
           T  A  +A      TIF KIIN+E+P   VYEDD V+AF  I+P    H L++P  +   
Sbjct: 10  TQTALRHAYAEAMATIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPCAE--- 66

Query: 224 TGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDG----GQTVFHIHLHL 391
             + + +     I GR++  ++L+ K       G     N  + G    G  V H+H+H+
Sbjct: 67  --IDQWQNVDPAIFGRVIAVSQLIGK-------GVCRAFNAERAGVIIAGFEVPHLHIHV 117

Query: 392 IGGRQLN 412
                L+
Sbjct: 118 FPTHSLS 124



>pir|E84369|E84369 histidine triad protein [imported] -
           Halobacterium sp. NRC-1>gb:AE005106_63481 Halobacterium
           sp. NRC-1 section 137 of 170 of the complete
           genome.>gb:AE004437_888400 Halobacterium sp. NRC-1
           complete genome.
          Length = 142

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 36/104 (34%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC--EI 262
           +F +II  EIPA +V+ED   LAF D  P AP H L+IPK        +  ++     E 
Sbjct: 6   VFCQIIADEIPARVVHEDADTLAFLDATPMAPGHTLVIPKTHAATLADTPGDDATAVFET 65

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           L  L  T      +  +D +   +  N+G   GQ V H+H H+I
Sbjct: 66  LHALAPTV-----EAAVDADATTIGFNNGTAAGQEVPHVHGHII 104



>pir|D71092|D71092 hypothetical protein PH1001 - Pyrococcus
           horikoshii>gb:BA000001_649660 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 150

 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 35/93 (37%), Positives = 53/93 (56%)
 Frame = +2

Query: 116 IPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLV 295
           I  NI+YEDD +    D  P  P H+L++P+    +T L +  E     L R +  A + 
Sbjct: 9   IKENILYEDDTIRILLDNYPANPGHLLIVPRRH--VTKLEELSEGEKASLLRGIEIA-IE 65

Query: 296 AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           A ++ L+ +GF + IN GK  GQTV H+H+H+I
Sbjct: 66  ALKKTLNPDGFNVGINIGKAAGQTVEHLHIHVI 98



>gb:BX572603_802753 Rhodopseudomonas palustris CGA009 complete
           genome; segment 11/16.
          Length = 156

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKV-KDGLTGLSKAEERH 253
           D   IF KI+  EIP + +YEDD V AF DI P++  H L+IPK     +  ++  +  H
Sbjct: 19  DPENIFAKILRGEIPCHKIYEDDHVFAFLDIMPRSTGHTLVIPKAPARNILDITPEDFAH 78

Query: 254 -CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
                 ++ + A    K +G+    F          GQ V+H+H+H++
Sbjct: 79  VARGAHKIAHAAMKAFKADGIVVQQF-----SEPAAGQVVYHLHMHVM 121



>gb:AE009914_257343 Pyrobaculum aerophilum strain IM2 section 169 of
           201 of the complete genome.>gb:AE009441_899969
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 137

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 45/116 (38%), Positives = 58/116 (50%), Gaps = 7/116 (6%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-----VKDGLTGLSKAEERH 253
           IF KII  E PA  VYED++ +   D  P +  H+L++ K     + D    LS    R 
Sbjct: 4   IFCKIIRGEAPAWKVYEDEEFVVILDKYPASYGHVLVVSKKHFTNIVDAPVELSA---RG 60

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI--GGRQLNW 415
            EI  RL   AK  AK   L   G  +V N G+  GQ VFH+H+H+I   G  L W
Sbjct: 61  FEIAIRL---AKAWAK---LGAPGVNIVTNAGRSAGQAVFHLHIHVIPRWGDPLRW 110



>sp|P71816|YHI1_MYCTU Hypothetical HIT-like protein
           Rv0759c/MT0784/Mb0782c.>gb:AE000516_20796 Mycobacterium
           tuberculosis CDC1551, complete genome.
          Length = 133

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 2/111 (1%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           +IF KIIN+E+P   VYEDD V+AF  I+P    H L++P+ +     +   +     + 
Sbjct: 2   SIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPRAE-----IDHWQNVDPALF 56

Query: 266 GRLLYTAKLVAKQ--EGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
           GR++  ++L+ K            ++I      G  V H+H+H+   R L+
Sbjct: 57  GRVMSVSQLIGKAVCRAFSTQRAGMII-----AGLEVPHLHIHVFPTRSLS 102



>sp|P49774|YHI1_MYCLE Hypothetical HIT-like protein
           ML2237.>pir|A87189|A87189 conserved hypothetical protein
           (HIT family) ML2237 [imported] - Mycobacterium
           leprae>gb:MLCB5_145133 Mycobacterium leprae cosmid
           B5.>gb:MLEPRTN8_148042 Mycobacterium leprae strain TN
           complete genome; segment 8/10.
          Length = 134

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 36/113 (31%), Positives = 56/113 (49%), Gaps = 4/113 (3%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEIL 265
           TIF KIIN+E+P   VYEDD V+AF  I+P    H L++P  +     + + +     I 
Sbjct: 3   TIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPCAE-----IDQWQNVDPAIF 57

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDG----GQTVFHIHLHLIGGRQLN 412
           GR++  ++L+ K       G     N  + G    G  V H+H+H+     L+
Sbjct: 58  GRVIAVSQLIGK-------GVCRAFNAERAGVIIAGFEVPHLHIHVFPTHSLS 103



>gb:BX248338_758649 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 5/14.
          Length = 144

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 44/138 (31%), Positives = 63/138 (45%), Gaps = 4/138 (2%)
 Frame = +2

Query: 83  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKD-GLTGLSKAEERHCE 259
           P +F  II  E PA  +YED   LA  DI P    H L++PK     LT           
Sbjct: 2   PCVFCAIIAGEAPAIRIYEDGGYLAILDIRPFTRGHTLVLPKRHTVDLTDTPPEALADMV 61

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI---GGRQLNWPPG*L 430
            +G+ +  A    K      +   + INDG+   QTVFH+HLH++    G +L+   G  
Sbjct: 62  AIGQRIARAARATKL----ADATHIAINDGRAAFQTVFHVHLHVLPRRNGDKLSVAKG-- 115

Query: 431 DLSNCRDPEDRCPSRIIQ 484
            +   RDP+     RI++
Sbjct: 116 -MMLRRDPDREATGRILR 132



>gb:BA000028_695541 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 142

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 37/109 (33%), Positives = 52/109 (47%), Gaps = 2/109 (1%)
 Frame = +2

Query: 74  SDSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERH 253
           S    IF KII  +IP+  VYED+ V AF DI      H L+IPK            E  
Sbjct: 2   SHEDCIFCKIIQGDIPSAKVYEDEHVYAFLDISQVTKGHTLIIPK-----EHTKNIYETS 56

Query: 254 CEILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            E+   L     ++A   ++  +  G  ++ N+     Q+VFH+HLHLI
Sbjct: 57  PEVAKELFARVPIIANAIKKSYNPLGMNVLNNNESAAEQSVFHLHLHLI 105



>sp|Q11066|YHI2_MYCTU Hypothetical HIT-like protein
           Rv1262c/MT1300.>pir|F70753|F70753 hypothetical protein
           Rv1262c - Mycobacterium tuberculosis  (strain
           H37RV)>gb:BX842576_819324 Mycobacterium tuberculosis
           H37Rv complete genome; segment 5/13.
          Length = 144

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 44/138 (31%), Positives = 63/138 (45%), Gaps = 4/138 (2%)
 Frame = +2

Query: 83  PTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKD-GLTGLSKAEERHCE 259
           P +F  II  E PA  +YED   LA  DI P    H L++PK     LT           
Sbjct: 2   PCVFCAIIAGEAPAIRIYEDGGYLAILDIRPFTRGHTLVLPKRHTVDLTDTPPEALADMV 61

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI---GGRQLNWPPG*L 430
            +G+ +  A    K      +   + INDG+   QTVFH+HLH++    G +L+   G  
Sbjct: 62  AIGQRIARAARATKL----ADATHIAINDGRAAFQTVFHVHLHVLPPRNGDKLSVAKG-- 115

Query: 431 DLSNCRDPEDRCPSRIIQ 484
            +   RDP+     RI++
Sbjct: 116 -MMLRRDPDREATGRILR 132



>gb:AY316120_608569 Uncultured crenarchaeote DeepAnt-EC39 genomic
           sequence.
          Length = 136

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 37/103 (35%), Positives = 56/103 (54%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KI NKEIP+ I+ E +  +AF D  P +  H L+IPK         K ++       
Sbjct: 4   LFCKIANKEIPSRIITETENSIAFLDAFPVSRGHTLVIPK-----NHYEKVQDVTDVDNN 58

Query: 269 RLLYTA-KLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            L  T  K+++K + L  +   L I++GKD GQ + H+H+HLI
Sbjct: 59  DLFDTVHKVISKVDKLTGSTL-LAIHNGKDSGQEIPHVHVHLI 100



>gb:AE017229_411298 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 3 of 16 of the complete
           genome.>gb:AE016958_1054702 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 134

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 1/110 (0%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERHCEI 262
           +IF KIIN+E+P   VYEDD V+AF  I+P    H L++P+ + D    +  A      +
Sbjct: 3   SIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPREEIDNWQDVDSAAFN--RV 60

Query: 263 LGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLN 412
           +G      K V K    + +G  L+I      G  V H+H+H+   R L+
Sbjct: 61  MGVSQLIGKAVCKAFRTERSG--LII-----AGLEVPHLHVHVFPTRSLS 103



>gb:CP000033_89817 Lactobacillus acidophilus NCFM, complete genome.
          Length = 143

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 35/102 (34%), Positives = 51/102 (50%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F KII  EIP+  V+E+D V AF DI    P H L++PK K  +      +E   + L 
Sbjct: 9   LFCKIIRGEIPSYTVFENDDVKAFLDISQVNPGHTLMVPK-KHIVNLFDYTKEDAQQYLQ 67

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +   A  + K+   +  G  +  N+GK   Q V H H+H I
Sbjct: 68  YIPVIANAI-KKAFPNVTGMNITTNNGKSANQVVMHSHIHFI 108



>sp|P95937|YHIT_SULSO Hypothetical hit-like protein
           SSO2163.>pir|S74070|S74070 histidine triad (HIT) protein
           c0139 - Sulfolobus solfataricus>gb:SS100KBFR_190342
           S.solfataricus 100 kbp DNA fragment.>gb:AE006822_222953
           Sulfolobus solfataricus P2 section 181 of 272 of the
           complete genome.>gb:AE006641_1108801 Sulfolobus
           solfataricus P2, complete genome.
          Length = 139

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF  I+       IVY +D+V+AF D  P  P H L++P+     T      E   +++ 
Sbjct: 3   IFCNIVEGRDHGYIVYSNDRVVAFLDKFPITPGHTLVVPR-----THYENFLEISEDVIP 57

Query: 269 RLLYTAKLV--AKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            L    + +  A ++ L  +G R++ N GK  GQ VFH H H++
Sbjct: 58  YLCTAVRKISIAVKKALKADGIRILTNIGKSAGQVVFHSHFHIV 101



>gb:AE017343_1755258 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 140

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 36/102 (35%), Positives = 53/102 (51%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  EIP+  + E + V AF D+ P A  H L+IPK +   T     +E   +IL 
Sbjct: 8   IFCKIIKGEIPSMKLLETESVFAFMDVGPIARGHCLVIPK-QHAATFTELPDEAMVDILP 66

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
               T K +A   G +   + ++ N+G+   Q V H+H H+I
Sbjct: 67  ----TCKKLAAATGAE--NYNILQNNGRPAHQVVDHVHFHVI 102



>gb:AY568724_1615482 Lycopersicon esculentum histidine triad family
           protein mRNA, complete cds.
          Length = 150

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 33/99 (33%), Positives = 49/99 (49%), Gaps = 1/99 (1%)
 Frame = +2

Query: 101 IINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG-RLL 277
           I+ ++ PA  VYEDD  L   D +P    H L+IPK     T L +        +  +L 
Sbjct: 2   IVRRKTPALKVYEDDVCLCILDANPLCFGHSLVIPK--SHFTSLQETPSSVVAAMSSKLP 59

Query: 278 YTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             +  V K  G D   F L++N+G   GQ ++H H+H+I
Sbjct: 60  LISSAVMKATGCDS--FNLLVNNGAAAGQVIYHTHIHII 96



>gb:AE017236_413215 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 10 of 16 of the complete
           genome.>gb:AE016958_1056619 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 144

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 36/107 (33%), Positives = 51/107 (47%), Gaps = 2/107 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F  I+  E PA  +YEDD  LA  DI P    H L++PK            +   E L 
Sbjct: 4   VFCAIVAGEAPAIRIYEDDDYLAILDIRPFTRGHTLVLPKRHS-----VDLTDTPPETLA 58

Query: 269 RLLYTAKLVAKQEGLDE--NGFRLVINDGKDGGQTVFHIHLHLIGGR 403
            ++   + +A+     E  +   + INDG    QTVFHIHLH++  R
Sbjct: 59  GMVTLGQRIARAARSTELADATNIAINDGSAAFQTVFHIHLHVLPRR 105



>gb:AE016949_364769 Enterococcus faecalis V583, section 3 of 11 of
           the complete genome.>gb:AE016830_991257 Enterococcus
           faecalis V583, complete genome.
          Length = 141

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 36/102 (35%), Positives = 54/102 (52%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KIIN EIP+  VYED++V AF DI      H L+IPK +         +    ++  
Sbjct: 5   IFCKIINGEIPSYKVYEDEKVYAFLDITQVTKGHTLMIPK-QHVADIFEYNDVLASDVFA 63

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+   A+ + K    +  G  ++ N+ +   Q+VFH H+HLI
Sbjct: 64  RIPKVARALEKAFP-EMEGLNILNNNKEVAYQSVFHSHVHLI 104



>gb:AE017283_431158 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 136

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F  I   +IPA I+  DD  +AF DI+P    H L+IP+ +   + L    E     LG
Sbjct: 4   LFCSIAAGDIPATIIDSDDASVAFLDIEPFQDGHTLVIPR-RHVTSVLDDDGE-----LG 57

Query: 269 RLLYTAKLVAKQ--EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           R+      VA++  + L  +G  +V N G+  GQ+V H+H+H+I
Sbjct: 58  RISPMVTKVARRLVDSLGASGVNVVSNAGEVAGQSVHHLHVHVI 101



>pir|D82911|D82911 probable HIT protein UU272 [imported] -
           Ureaplasma urealyticum>gb:AE002124_43144 Ureaplasma
           parvum serovar 3 str. ATCC 700970 section 25 of 59 of
           the complete genome.>gb:AF222894_1114515 Ureaplasma
           parvum serovar 3 str. ATCC 700970, complete genome.
          Length = 152

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 31/102 (30%), Positives = 51/102 (50%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  EI + I+ E++  +A  DI P +  H+L+IP  K      S  +  + + + 
Sbjct: 5   IFCKILKGEIISKIIDENEFAIAILDIQPASDGHMLIIP--KKHYRNFSLTDPIYLDGMM 62

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           RL      V ++   +  GF  ++N     GQ + H HLH+I
Sbjct: 63  RLAKNMTFVLEEVFPNVLGFNYLMNSNSSAGQVIMHTHLHII 104



>gb:AY657766_2146776 Synthetic construct Peudomonas aeruginosa clone
           FLH033707.01F PA1306 gene, partial cds.
          Length = 154

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 32/110 (29%), Positives = 51/110 (46%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F  I     PA+ ++ED+  +   DI P  P H+L++   ++    LS       + L 
Sbjct: 9   VFCAIAGGREPAHRLFEDEHFIVLLDIFPLRPAHVLIV--AREHALHLSDLSAAARDALL 66

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
            L        ++ G    G  L++NDG    Q V H+HLHLI  R+ + P
Sbjct: 67  ALAERIGRALRRAGFGVEGINLLLNDGVAANQHVAHLHLHLIPRRRGDLP 116



>pir|F83481|F83481 probable HIT family protein PA1306 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004560_55542
           Pseudomonas aeruginosa PAO1, section 121 of 529 of the
           complete genome.>gb:AE004091_969642 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 153

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 32/110 (29%), Positives = 51/110 (46%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F  I     PA+ ++ED+  +   DI P  P H+L++   ++    LS       + L 
Sbjct: 9   VFCAIAGGREPAHRLFEDEHFIVLLDIFPLRPAHVLIV--AREHALHLSDLSAAARDALL 66

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
            L        ++ G    G  L++NDG    Q V H+HLHLI  R+ + P
Sbjct: 67  ALAERIGRALRRAGFGVEGINLLLNDGVAANQHVAHLHLHLIPRRRGDLP 116



>gb:BX571966_795150 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_867648
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 138

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-VKDGLTGLSKAEERH 253
           D   IF KI+  E+P   + E D  LAF DI P++  H L++PK   +    LS+A    
Sbjct: 4   DQSNIFAKILRGEVPCIRLCETDTTLAFMDIMPQSRGHALVVPKEAAETFYELSEAAAAE 63

Query: 254 C-EILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             ++  R+    +   + EGL    F     +G   GQTV H+H H+I
Sbjct: 64  AMKMTKRVALALRRTLEPEGLFIGQF-----NGAAAGQTVPHVHFHVI 106



>gb:BA000031_707276 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 138

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 43/116 (37%), Positives = 61/116 (52%), Gaps = 6/116 (5%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI- 262
           TI ++I+N+EI + IVYE DQV+AF D DP    HIL+ PK +   T +   E    EI 
Sbjct: 8   TIVEQIVNREIDSVIVYESDQVIAFADHDPINFGHILICPKTQ-YRTFIDLPESVFFEIT 66

Query: 263 -LGRLLYTAKLVAKQEGLDENGFRLVINDGK-DGGQTVFHIHLHL---IGGRQLNW 415
            + R LY  ++ AK    + NG   + N+G+      + H HLH+     G Q  W
Sbjct: 67  DVARDLY-KRIEAK---FNPNGIGFMQNNGEAPHFNELDHYHLHIFPRFHGDQYGW 118



>sp|P47378|YHIT_MYCGE Hypothetical HIT-like protein
           MG132.>pir|F64214|F64214 histidine triad protein MG132 -
           Mycoplasma genitalium>gb:U39693_205542 Mycoplasma
           genitalium G-37 section 15 of 51 of the complete
           genome.>gb:L43967_1100694 Mycoplasma genitalium G-37,
           complete genome.
          Length = 141

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/105 (31%), Positives = 49/105 (46%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF  I+   I +  + E++  +AF D  P A  H L+IPK        S  +++  +
Sbjct: 7   SSCIFCDIVQGSITSYKIGENEHAIAFLDAFPVADGHTLVIPKKH--AVDFSSTDQKELQ 64

Query: 260 ILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +  L     L  K   L  +G   V N+G   GQ VFH HLH++
Sbjct: 65  AVSLLAKQIALKLKMT-LKPSGLNYVSNEGAIAGQVVFHFHLHIV 108



>gb:AE017318_441089 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 10 of 12 of the complete
           genome.>gb:AE017285_1074250 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 142

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 34/99 (34%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +2

Query: 125 NIVYEDDQVLAFRDIDPKAPTHILLIPKVK-DGLTGLSKAEERHCEILGRLLYTAKLVAK 301
           ++V E+    A RD       H+L+IPK   +    L++AE+R  + L R L   +L + 
Sbjct: 20  HMVRENATCYAIRDKYAVTEGHLLIIPKRHTEDYFSLTQAEKRDADALLRELRD-ELASA 78

Query: 302 QEGLDENGFRLVINDGKDGGQTVFHIHLHLIGGRQLNWP 418
              +  +GF + +N G+D GQT+FH H+HLI  R+ + P
Sbjct: 79  DASI--SGFNVGVNCGEDAGQTIFHAHIHLIPRRKGDTP 115



>gb:CR555306_106223 Azoarcus sp. EbN1 complete genome.
          Length = 136

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 7/117 (5%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F +I   E+PA+ V+ED   LAF D+    P H L++  VK     + + ++   ++  
Sbjct: 5   VFCRIAKGELPASKVFEDASTLAFMDLQSVNPGHALVV--VKPHRANIYELDD---DLAS 59

Query: 269 RLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI-----GGRQLNWP 418
            +  TA  VA+  ++     G  L+  +   G QTVFH H+H++      G  L WP
Sbjct: 60  AVFRTAARVARAVKKAYGCEGVTLLQANEPAGAQTVFHFHIHVLPRWEGDGLALAWP 116



>gb:AP006627_566069 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 134

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 22/40 (55%), Positives = 30/40 (75%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK 208
           +F  I NKE+ ++IVYED+Q +AF DI P  P H+L+IPK
Sbjct: 4   LFCAIANKEVKSHIVYEDEQAIAFLDIQPINPGHMLVIPK 43



>gb:TACID4_196897 Thermoplasma acidophilum complete genome; segment
           4/5.
          Length = 147

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 37/107 (34%), Positives = 52/107 (48%), Gaps = 1/107 (0%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEER-H 253
           DS  +F   I  +  A IV E+D V++F D  P  P HIL+IP  K+    +   + R +
Sbjct: 4   DSSCVFCNEIITKRNAAIVAENDMVISFMDNAPVEPGHILVIP--KEHFENIFDIDSRYY 61

Query: 254 CEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            E+       AK V K  G D  G  +  N+G    Q V H H+H+I
Sbjct: 62  IEVQLMAKRVAKAVMKAMGAD--GINIGQNNGWCANQRVMHFHVHVI 106



>sp|P75504|YHIT_MYCPN Hypothetical 16.1 kDa HIT-like protein
           (A65_orf144).>pir|S73888|S73888 histidine triad protein
           A65_orf144 - Mycoplasma pneumoniae  (strain ATCC
           29342)>gb:AE000055_19453 Mycoplasma pneumoniae M129
           section 25 of 63 of the complete
           genome.>gb:U00089_1101313 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 144

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 31/102 (30%), Positives = 48/102 (47%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF  I+   + +  V E++   AF D  P A  H L+IPK        S  ++   + + 
Sbjct: 13  IFCGIVEGNVKSFKVGENEHAFAFLDAFPVADGHTLVIPKKH--AVNYSSTDDESLKAVS 70

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            LL     +  Q+ L   G   V+N+G   GQ VFH H+H++
Sbjct: 71  -LLAKEMALKLQQRLQPAGLNYVVNEGAKAGQEVFHYHMHVV 111



>gb:BX640423_808313 Bordetella parapertussis strain 12822, complete
           genome; segment 1/14.>gb:BX640437_812715 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           1/16.
          Length = 145

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 4/106 (3%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           +F +I  +EIPA+++++D ++LAF DI P  P H+L+IP+           E+   ++ G
Sbjct: 6   LFCRISREEIPAHVIHQDSRLLAFLDIHPVRPGHVLIIPR-----QHYPYFEDMPADLAG 60

Query: 269 RLLYTAKLVAKQ----EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +L   + +A+       ++  GF          G  V H H HLI
Sbjct: 61  HILNLGQRLARHMKRLYSVERVGFAFT-------GIHVAHAHAHLI 99



>gb:BA000037_722594 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 138

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 42/116 (36%), Positives = 61/116 (52%), Gaps = 6/116 (5%)
 Frame = +2

Query: 86  TIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEI- 262
           TI ++I+N+EI + IVYE DQV+AF D DP    HIL+ PK +   T +   E    EI 
Sbjct: 8   TIVEQIVNREIDSVIVYESDQVIAFADHDPINFGHILICPKAQ-YRTFIDLPESVLFEIT 66

Query: 263 -LGRLLYTAKLVAKQEGLDENGFRLVINDGK-DGGQTVFHIHLHL---IGGRQLNW 415
            + R LY  ++ AK    + +G   + N+G+      + H HLH+     G Q  W
Sbjct: 67  DVARDLY-KRIEAK---FNPDGIGFMQNNGEAPHFNELDHYHLHIFPRFHGDQYGW 118



>gb:AF393466_506960 Uncultured crenarchaeote 74A4 partial genomic
           sequence.
          Length = 135

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPK-VKDGLTGLSKAEERHCEIL 265
           IF KII+++IPA I++E    + F D  P    H+L+IPK     +  +S +E      L
Sbjct: 4   IFCKIISRQIPAKILHETSHSICFLDAFPLTKGHVLVIPKNHHKKIQDMSSSENSDLFSL 63

Query: 266 GRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             +     +++K + +  +   + I++G+  GQ + H+H+HL+
Sbjct: 64  VHV-----MMSKVDSITGSTL-IAIHNGETAGQEIPHVHVHLV 100



>gb:LMFP1295_1388687 Leishmania major Friedlin chromosome 14 PAC
           P1295.
          Length = 142

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 1/103 (0%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KII  +IP   V E  + LAF DI+P +  H+L+IP  K+  + L +        +G
Sbjct: 6   IFCKIIKGDIPCAKVAETSKALAFMDINPLSRGHMLVIP--KEHASCLHELGMEDAADVG 63

Query: 269 RLLYTA-KLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            LL  A + VA  +G  +  + ++ N+G    Q V H+H H+I
Sbjct: 64  VLLAKASRAVAGPDGSMQ--YNVLQNNGSLAHQEVPHVHFHII 104



>gb:AE017261_419481 Picrophilus torridus DSM 9790, complete genome.
          Length = 141

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 33/108 (30%), Positives = 53/108 (49%), Gaps = 2/108 (1%)
 Frame = +2

Query: 77  DSPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHC 256
           D   +F + I K+  A  VYEDD V+AF D  P    HIL+IP  ++    +   +    
Sbjct: 3   DDSCVFCREIIKKRNAAFVYEDDDVVAFMDNAPIDNGHILVIP--REHYQDIFSIDN--- 57

Query: 257 EILGRLLYTAKLVAKQ--EGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
           ++  ++  T K +A      L+  G  +  N+G+   Q V H H+H+I
Sbjct: 58  DLYIKIYKTVKKLAPVLISSLNAQGLNISQNNGRAANQVVMHYHVHMI 105



>pir|T40979|T40979 hypothetical HIT-family protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC1442_1720906 S.pombe
           chromosome III cosmid c1442.
          Length = 133

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 37/116 (31%), Positives = 52/116 (44%), Gaps = 6/116 (5%)
 Frame = +2

Query: 89  IFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILG 268
           IF KI+  +IP   + E    LAF DI P +  H L+IPK        +K  E   E   
Sbjct: 4   IFCKIVKGDIPCVKLAETALSLAFLDIAPTSKGHALVIPK-----EHAAKMHELSDESCA 58

Query: 269 RLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLIG------GRQLNWP 418
            +L   K V K  G     + ++ N+G+   Q V H+H H+I       G  + WP
Sbjct: 59  DILPLVKKVTKAIG--PENYNVLQNNGRIAHQFVDHVHFHIIPKPNEEYGLGVGWP 112



>gb:CR555306_105585 Azoarcus sp. EbN1 complete genome.
          Length = 129

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 33/92 (35%), Positives = 47/92 (51%)
 Frame = +2

Query: 119 PANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYTAKLVA 298
           P  I + +   +  RD  P +P H L+IP+         + EER  + L  LL  AK   
Sbjct: 13  PERIEFSNMHGVVIRDGYPVSPGHTLVIPRRHMASYFDLEGEER--DALLALLDEAKR-R 69

Query: 299 KQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
             + L  +G+ + INDG   GQTV H+H+HLI
Sbjct: 70  LDKALHPDGYNIGINDGAAAGQTVPHLHIHLI 101



>sp|Q7YRZ1|APTX_PIG Aprataxin homolog (Forkhead-associated domain
           histidine-triad like protein)
           (FHA-HIT).>gb:AY040779_1424266 Sus scrofa
           forkhead-associated domain histidine-triad like protein
           mRNA, complete cds.
          Length = 356

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 2/99 (2%)
 Frame = +2

Query: 104 INKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCEILGRLLYT 283
           I+ E P   VY+DDQV+  +D  PKA  H L++P     ++ L      H E+L R ++T
Sbjct: 187 ISMEDPKMQVYKDDQVVVIKDKYPKARYHWLVLPWA--SISSLKAVTREHLELL-RHMHT 243

Query: 284 A--KLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
              K++A   G  +  FRL    G     ++ H+HLH+I
Sbjct: 244 VGEKVIADFAGSSKLRFRL----GYHAIPSMSHVHLHVI 278



>gb:AJ627420_527882 Uncultured crenarchaeote genomic fragment 6a13.
          Length = 146

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 2/107 (1%)
 Frame = +2

Query: 80  SPTIFDKIINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVKDGLTGLSKAEERHCE 259
           S  IF  I      A I+ E++  +AF D  P    H L+  K+        K +E + +
Sbjct: 8   SSCIFCNIAKYITKARIISENEHAVAFLDAFPLRRGHTLVATKMH-----WVKLQEINSD 62

Query: 260 ILGRLLYTAKLVAK--QEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
            +  L     LVA   ++G+D N   + I++GK  GQ + H+H+H++
Sbjct: 63  EIVALFGLVSLVADALEKGMDANATLIAIHNGKQAGQEIPHLHVHIL 109



>gb:BA000011_664691 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 158

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 11/124 (8%)
 Frame = +2

Query: 68  VPSDSPTIFDK-----------IINKEIPANIVYEDDQVLAFRDIDPKAPTHILLIPKVK 214
           VP    T+FD+           II+ +I +N+VY D+  +AF D  P    H LL+P+  
Sbjct: 3   VPGKQLTLFDEENEVVKCKFCDIISGKIASNVVYSDEHFIAFLDHKPLFKGHTLLVPR-- 60

Query: 215 DGLTGLSKAEERHCEILGRLLYTAKLVAKQEGLDENGFRLVINDGKDGGQTVFHIHLHLI 394
                     E   E   +L++  +L+++   +  +     I       Q+V H+H+H++
Sbjct: 61  ---KHFENIYEMDEETSSKLMHEVQLISRAVEIATSSDGTFIAINNKVSQSVPHVHVHIV 117

Query: 395 GGRQ 406
             +Q
Sbjct: 118 PRKQ 121


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 715,233,623
Number of Sequences: 1806583
Number of extensions: 15874885
Number of successful extensions: 37582
Number of sequences better than 10.0: 380
Number of HSP's better than 10.0 without gapping: 36070
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 37297
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35417417455
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)