BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2498
         (841 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:PMA534442_1700702 Plantago major macronuclear mRNA for sucros...   247   2e-64   
gb:AF166498_1774021 Lycopersicon esculentum sucrose transporter-...   245   7e-64   
gb:AF021809_1761736 Vitis vinifera putative sucrose transporter ...   243   3e-63   
gb:AC135288_1742204 Solanum demissum chromosome 5 BAC PGEC219 ge...   242   7e-63   
gb:AY291289_1595620 Solanum tuberosum sucrose transporter-like p...   241   1e-62   
gb:AC139840_1744055 Solanum demissum chromosome 5 BAC PGEC323D8 ...   231   1e-59   
gb:AY098894_1576500 Citrus sinensis sucrose transporter 2 mRNA, ...   230   2e-59   
gb:AY137242_1582010 Oryza sativa (japonica cultivar-group) sucro...   224   1e-57   
pir|G84441|G84441 probable sucrose-proton symporter [imported] -...   224   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AY581895_1616086 Zea mays sucrose transporter 2 (SUT2) mRNA, ...   223   3e-57   
gb:AB091673_1525058 Oryza sativa (japonica cultivar-group) OsSUT...   221   2e-56   
gb:AY830138_1629346 Ipomoea batatas cultivar Beauregard clone BA...   115   1e-50   
gb:AY780256_1628296 Saccharum hybrid cultivar sucrose transporte...   180   3e-44   
gb:AB008464_1510521 Zea mays mRNA for Sucrose Transporter, compl...   180   3e-44   
gb:AF408843_1797008 Triticum aestivum sucrose transporter SUT1B ...   178   1e-43   
gb:AF408842_1797007 Triticum aestivum sucrose transporter SUT1A ...   177   2e-43   
gb:AF280050_1782867 Oryza sativa (indica cultivar-group) sucrose...   177   2e-43   
gb:AC073556_1541099 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...   177   2e-43   
gb:AF408844_1797009 Triticum aestivum sucrose transporter SUT1D ...   177   2e-43   
gb:HVU272309_1682609 Hordeum vulgare mRNA for sucrose transporte...   176   6e-43   
pir|T02982|T02982 probable sucrose transport protein - rice>gb:D...   174   1e-42   Oryza sativa Japonica Group [Japonica rice]
gb:AF419298_1798405 Oryza sativa (indica cultivar-group) sucrose...   153   3e-36   
gb:AC090487_1734363 Genomic Sequence for Oryza sativa, Nipponbar...   151   1e-35   
gb:AB071809_1522942 Oryza sativa (japonica cultivar-group) OsSUT...   151   1e-35   
gb:AE016959_1022490 Oryza sativa (japonica cultivar-group) chrom...   151   1e-35   
gb:AY445915_1606542 Malus x domestica sucrose transporter (SUT1)...   144   2e-33   
gb:AY639018_1618838 Zea mays sucrose transport protein (SUT2) mR...   142   1e-32   
gb:AB091672_1525057 Oryza sativa (japonica cultivar-group) OsSUT...   142   1e-32   
gb:AY603492_1617461 Zea mays sucrose transporter SUT4 mRNA, comp...   141   2e-32   
gb:AJ781069_1813984 Datisca glomerata mRNA for putative sucrose-...   139   5e-32   
gb:AF176950_1774627 Lycopersicon esculentum sucrose transporter ...   138   1e-31   
gb:AY375329_1178063 Gossypium barbadense fiber sucrose transport...   138   1e-31   
gb:AF237780_1779684 Solanum tuberosum sucrose transporter SUT4 m...   136   6e-31   
gb:AY725473_1624500 Ricinus communis putative sucrose carrier (S...   135   7e-31   
gb:HVU272308_1682608 Hordeum vulgare mRNA for sucrose transporte...   134   2e-30   
pir|S38657|S38657 sucrose transport protein ptp1 - common planta...   134   2e-30   Plantago major [cart-track plant]
pir|S48789|S48789 sucrose transport protein - common tobacco>gb:...   134   3e-30   Nicotiana tabacum [American tobacco]
gb:AF182445_1774966 Vitis vinifera sucrose transporter mRNA, com...   133   5e-30   
gb:AF109922_1768711 Pisum sativum sucrose transport protein SUT1...   133   5e-30   
gb:AF021808_1761735 Vitis vinifera putative sucrose transporter ...   133   5e-30   
gb:LJA538041_1684983 Lotus japonicus mRNA for sucrose transporte...   133   5e-30   
gb:AY091774_1574734 Arabidopsis thaliana At1g22710/T22J18_12 mRN...   133   5e-30   
pir|G86360|G86360 probable sucrose-proton symporter SUC2 protein...   133   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AP006070_1860924 Oryza sativa (japonica cultivar-group) genom...   132   6e-30   
gb:AB091674_1525059 Oryza sativa (japonica cultivar-group) OsSUT...   132   6e-30   
gb:GMA563364_1680377 Glycine max mRNA for sucrose transporter (s...   132   8e-30   
gb:AX306541_1465637 Sequence 1 from Patent WO0188139.                 132   1e-29   
pir|S38196|S38196 sucrose transport protein SUC2 - Arabidopsis t...   131   1e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T14339|T14339 sucrose-proton transport protein - carrot>gb:D...   131   1e-29   Daucus carota [carrots]
pir|S38197|S38197 sucrose transport protein SUC1 - Arabidopsis t...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF167415_1774081 Apium graveolens sucrose transporter SUT2A (...   130   2e-29   
gb:AB036758_1519045 Daucus carota cSUT mRNA for sucrose transpor...   130   2e-29   
pir|T12198|T12198 sucrose transport protein - fava bean>gb:VFZ93...   130   3e-29   Vicia faba [broad bean]
pir|S43142|S43142 sucrose transport protein - castor bean>gb:RCS...   130   4e-29   Ricinus communis
gb:MTR459790_1687657 Medicago truncatula partial mRNA for putati...   129   5e-29   
sp|Q03411|SUT_SPIOL|SUT_SPIOL Sucrose transport protein (Sucrose permease)...   129   5e-29   Spinacia oleracea
gb:AF175321_1774498 Arabidopsis thaliana sucrose transporter SUT...   129   9e-29   
gb:AF063400_1765411 Apium graveolens sucrose transporter (SUT1) ...   129   9e-29   
gb:DCA303199_1675625 Daucus carota sut2 gene for sucrose/proton ...   129   9e-29   
gb:ATH289166_1552314 Arabidopsis thaliana mRNA for sucrose trans...   129   9e-29   
pir|JQ2389|JQ2389 sucrose transport protein - potato>gb:STSUCTR_...   129   9e-29   Solanum tuberosum [potatoes]
pir|T14340|T14340 sucrose-proton transport protein - carrot>gb:D...   129   9e-29   Daucus carota [carrots]
gb:AY065839_1566578 Brassica oleracea sucrose transporter SUC1 (...   128   2e-28   
gb:AY065840_1566579 Brassica oleracea sucrose transporter SUC2 (...   127   2e-28   
pir|S51114|S51114 sucrose-proton symporter - beet>gb:BVSUT1_1643...   127   3e-28   Beta vulgaris subsp. vulgaris [field beet]
gb:AF191024_1775459 Asarina barclaiana sucrose transporter 1 (SU...   127   3e-28   
gb:AY504969_1609835 Juglans regia sucrose transporter mRNA, comp...   126   4e-28   
gb:BVU64967_1643232 Beta vulgaris sucrose-proton symporter (Bv8-...   126   6e-28   
gb:AF242307_1780137 Euphorbia esula sucrose transport protein mR...   125   8e-28   
gb:AF191025_1775460 Alonsoa meridionalis sucrose transporter 1 (...   125   1e-27   
gb:AP002544_1822664 Arabidopsis thaliana genomic DNA, chromosome...   122   6e-27   
gb:AF021810_1761737 Vitis vinifera putative sucrose transporter ...   121   1e-26   
pir|A84520|A84520 probable sucrose-proton symporter [imported] -...   119   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AB016875_1512964 Arabidopsis thaliana genomic DNA, chromosome...   119   7e-26   
gb:AY098891_1576497 Citrus sinensis citrus sucrose transporter 1...   119   9e-26   
gb:AF149981_1772545 Nicotiana tabacum sucrose transporter-like p...   116   5e-25   
pir|F96741|F96741 probable sucrose transport protein F17M19.4 [i...   116   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb:ATH252133_1552194 Arabidopsis thaliana mRNA for sucrose trasp...   115   8e-25   
gb:AK176510_1818498 Arabidopsis thaliana mRNA for hypothetical p...   115   1e-24   
pir|E96691|E96691 probable sucrose-proton symporter T12I7.2 [imp...   115   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AJ604565_1811879 Arabidopsis thaliana mRNA for sucrose transp...   113   4e-24   
pir|S52377|S52377 sucrose transport protein SUC1 - common planta...   113   5e-24   Plantago major [cart-track plant]
gb:AB025006_1516087 Cicer arietinum mRNA for sucrose transport p...    89   1e-16   
gb:AC074025_1541169 Arabidopsis thaliana chromosome 1 BAC F28G11...    86   7e-16   
pir|A86234|A86234 hypothetical protein [imported] - Arabidopsis ...    71   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AX172633_1463038 Sequence 123 from Patent WO0144476.                69   1e-10   
gb:LESUT1_1684648 L.esculentum SUT1 mRNA for sucrose transporter.      56   1e-06   
pir|S48788|S48788 sucrose transport protein - tomato (fragment)        55   1e-06   Solanum lycopersicum
gb:AC117076_1207860 Dictyostelium discoideum chromosome 2 map 33...    55   2e-06   
gb:AY646366_1619851 Malus xiaojinensis sucrose transporter (Sut1...    47   4e-04   
gb:CR555306_106926 Azoarcus sp. EbN1 complete genome.                  42   0.011   
pir|A40678|A40678 T-cell adhesion receptor CD2 homolog - African...    24   0.014   African swine fever virus
gb:AX172631_1463037 Sequence 121 from Patent WO0144476.                42   0.019   
gb:AF050111_2185796 African swine fever virus c-type lectin prot...    22   0.023   
gb:AF439321_1799968 Vitis vinifera sucrose transporter gene, com...    41   0.032   
gb:AF309805_1785023 Pneumocystis carinii f. sp. carinii glutathi...    40   0.055   
gb:AL935257_551496 Lactobacillus plantarum strain WCFS1 complete...    40   0.072   
gb:AB049419_1196089 Physarum polycephalum Glom mRNA for histone-...    37   0.36    
gb:SCO939105_173993 Streptomyces coelicolor A3(2) complete genom...    37   0.46    
gb:BA000030_703484 Streptomyces avermitilis MA-4680 genomic DNA,...    36   0.79    
gb:AC115684_1206034 Dictyostelium discoideum chromosome 2 map 31...    35   1.4     
gb:AY078067_587873 Saccharopolyspora erythraea red pigment gene ...    35   1.4     
gb:SCO939121_178564 Streptomyces coelicolor A3(2) complete genom...    35   1.4     
gb:AF272150_1257594 Dictyostelium discoideum deliriumA (dlrA) ge...    35   1.8     
gb:BC081922_2108164 Rattus norvegicus cDNA clone MGC:93898 IMAGE...    35   2.3     
gb:BX950851_838806 Erwinia carotovora subsp. atroseptica SCRI104...    35   2.3     
gb:AL935262_553045 Lactobacillus plantarum strain WCFS1 complete...    35   2.3     
pir|E72453|E72453 hypothetical protein APE2273 - Aeropyrum perni...    35   2.3     Aeropyrum pernix
gb:AE014185_937656 Plasmodium falciparum 3D7 chromosome 10 compl...    34   3.0     
gb:SCO939131_180975 Streptomyces coelicolor A3(2) complete genom...    34   3.0     
gb:AP005816_1858346 Oryza sativa (japonica cultivar-group) genom...    34   3.9     
gb:PFMAL13_1191570 Plasmodium falciparum 3D7 chromosome 13, *** ...    34   3.9     
gb:BA000030_703558 Streptomyces avermitilis MA-4680 genomic DNA,...    34   3.9     
gb:AE017241_414529 Mycobacterium avium subsp. paratuberculosis s...    34   3.9     
gb:SME591782_184232 Sinorhizobium meliloti 1021 complete chromos...    34   3.9     
gb:SCO939107_174689 Streptomyces coelicolor A3(2) complete genom...    34   3.9     
gb:AP003824_1833835 Oryza sativa (japonica cultivar-group) genom...    33   5.1     
gb:AP003248_1826232 Oryza sativa (japonica cultivar-group) genom...    33   5.1     
gb:AB091780_1525067 Solanum tuberosum StMEK1 mRNA for mitogen-ac...    33   5.1     
gb:AF067611_1238006 Caenorhabditis elegans cosmid C45G7, complet...    33   5.1     
gb:AC116977_1207001 Dictyostelium discoideum chromosome 2 map 55...    33   5.1     
gb:BA000040_731449 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   5.1     
gb:AE008759_243064 Salmonella typhimurium LT2, section 63 of 220...    33   5.1     
gb:CP000026_76305 Salmonella enterica subsp. enterica serovar Pa...    33   5.1     
pir|T33135|T33135 hypothetical protein C45G7.5 - Caenorhabditis ...    33   5.1     Caenorhabditis elegans [roundworm]
pir|AD0703|AD0703 probable transporter STY1755 [imported] - Salm...    33   5.1     Salmonella enterica subsp. enterica serovar Typhi
gb:AP006162_1861143 Oryza sativa (japonica cultivar-group) genom...    33   6.7     
gb:CP000010_866673 Burkholderia mallei ATCC 23344 chromosome 1, ...    33   6.7     
gb:BX571965_792793 Burkholderia pseudomallei strain K96243, chro...    33   6.7     
gb:BX248335_757657 Mycobacterium bovis subsp. bovis AF2122/97 co...    33   6.7     
gb:AP006627_566062 Bacillus clausii KSM-K16 DNA, complete genome.      33   6.7     
gb:AE017340_457107 Idiomarina loihiensis L2TR, complete genome.        33   6.7     
pir|H70836|H70836 hypothetical protein Rv0290 - Mycobacterium tu...    33   6.7     Mycobacterium tuberculosis
gb:RATNMDARA_2133150 Rattus norvegicus mRNA for N-methyl-D-aspar...    33   8.8     
gb:AF001423_2050038 Rattus norvegicus N-methyl-D-aspartate recep...    33   8.8     
gb:CR380948_1649356 Candida glabrata strain CBS138 chromosome B ...    33   8.8     
gb:PFA929358_1393480 Plasmodium falciparum strain 3D7, chromosom...    33   8.8     
gb:DDI277590_1376938 Dictyostelium discoideum iplA gene for inos...    33   8.8     
gb:AF092449_1240263 Heterodera glycines mucin-like protein (svg-...    33   8.8     
gb:BX571875_789737 Photorhabdus luminescens subsp. laumondii TTO...    33   8.8     
gb:AP006618_558822 Nocardia farcinica IFM 10152 DNA, complete ge...    33   8.8     
gb:AJ830893_533218 Photobacterium damselae subsp. damselae hutZ ...    33   8.8     
gb:AE016946_364019 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   8.8     
gb:AE015938_319971 Clostridium tetani E88, section 3 of 10 of th...    33   8.8     
gb:AE012358_281698 Xanthomonas campestris pv. campestris str. AT...    33   8.8     
gb:PDA582082_157499 Photobacterium damselae subsp. piscicida hut...    33   8.8     
pir|T14004|T14004 trfA protein - slime mold (Dictyostelium disco...    33   8.8     Dictyostelium discoideum
pir|T35091|T35091 hypothetical protein SC4G6.31c - Streptomyces ...    33   8.8     Streptomyces coelicolor
sp|P75465|Y223_MYCPN|Y223_MYCPN Hypothetical protein MG223 homolog (F10_orf...    33   8.8     Mycoplasma pneumoniae
sp|P16385|THTR_SACER|THTR_SACER Putative thiosulfate sulfurtransferase (EC ...    33   8.8     Saccharopolyspora erythraea
sp|Q00959|NME1_RAT|NME1_RAT Glutamate [NMDA] receptor subunit epsilon 1 p...    33   8.8     Rattus norvegicus [brown rat]


>gb:PMA534442_1700702 Plantago major macronuclear mRNA for sucrose
           transporter (suc3 gene).
          Length = 599

 Score =  247 bits (631), Expect = 2e-64
 Identities = 117/160 (73%), Positives = 143/160 (89%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +GARLVWA S+F+V +CMAGT +IS+VSL + S GVQ VIGA+E+TK+ASL++
Sbjct: 439 IEPMCKRMGARLVWASSNFIVFVCMAGTAIISFVSLRQMSDGVQDVIGANETTKIASLVI 498

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F LLG PLA+TYSVPFSVTA+LTAD+GGGQGLAIGVLNLAIVVPQM++SLGAGPWDALFG
Sbjct: 499 FTLLGFPLAVTYSVPFSVTAELTADSGGGQGLAIGVLNLAIVVPQMIVSLGAGPWDALFG 558

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGN+PAFALAS+ +L AGVIA  KLP LS ++F+STG HF
Sbjct: 559 GGNVPAFALASVASLAAGVIAVHKLPVLSSDSFKSTGFHF 598



>gb:AF166498_1774021 Lycopersicon esculentum sucrose
           transporter-like protein (SUT2) mRNA, complete cds.
          Length = 604

 Score =  245 bits (626), Expect = 7e-64
 Identities = 119/160 (74%), Positives = 145/160 (90%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ IG+RLVWAVS+F+V +CMA T +IS VS++ ++QGVQHVIGA+ ST++A+L+V
Sbjct: 445 IEPMCKWIGSRLVWAVSNFIVFVCMACTAIISVVSISANTQGVQHVIGATRSTQIAALVV 504

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLGIPLA+TYSVPFS+TA+LTADAGGGQGLAIGVLNLAIVVPQMV+SLGAGPWDALFG
Sbjct: 505 FSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAIVVPQMVVSLGAGPWDALFG 564

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGNIPAFALAS+ AL AG+ A L+LP LS N F+STG HF
Sbjct: 565 GGNIPAFALASLAALAAGIFAMLRLPNLSSN-FKSTGFHF 603



>gb:AF021809_1761736 Vitis vinifera putative sucrose transporter
           (VvSUC12) mRNA, complete cds.
          Length = 612

 Score =  243 bits (621), Expect = 3e-63
 Identities = 115/161 (71%), Positives = 143/161 (88%), Gaps = 1/161 (0%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES-SQGVQHVIGASESTKVASLI 662
           I+P+CQ +GARLVWA+S+F+V  CMAGT +IS VS+NE  ++G+QH IG + + K+ASL+
Sbjct: 444 IEPMCQRMGARLVWAMSNFIVFACMAGTAIISLVSVNEYITEGIQHAIGENRAIKIASLV 503

Query: 661 VFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALF 482
           VFALLG PL+ITYSVPFS+TA+LTAD GGGQGLAIGVLNLAIV+PQM++SLGAGPWDALF
Sbjct: 504 VFALLGFPLSITYSVPFSITAELTADTGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDALF 563

Query: 481 GGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGGNIPAF LA++FAL AGVIATLKLP LS ++++S+G HF
Sbjct: 564 GGGNIPAFVLAALFALAAGVIATLKLPNLSSSSYKSSGFHF 604



>gb:AC135288_1742204 Solanum demissum chromosome 5 BAC PGEC219
           genomic sequence, complete sequence.
          Length = 603

 Score =  242 bits (617), Expect = 7e-63
 Identities = 117/160 (73%), Positives = 143/160 (89%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ IG+RLVWAVS+F+V +CMA T +IS VS++  ++GVQHVIGA+ ST++A+L+V
Sbjct: 444 IEPMCKWIGSRLVWAVSNFIVFVCMACTAIISVVSISAHTEGVQHVIGATRSTQIAALVV 503

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLGIPLA+TYSVPFS+TA+LTADAGGGQGLAIGVLNLAIVVPQMV+SLGAGPWDALFG
Sbjct: 504 FSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAIVVPQMVVSLGAGPWDALFG 563

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGNIPAF LAS+ AL AG+ A L+LP LS N F+STG HF
Sbjct: 564 GGNIPAFVLASLAALAAGIFAMLRLPNLSSN-FKSTGFHF 602



>gb:AY291289_1595620 Solanum tuberosum sucrose transporter-like
           protein (SUT2) mRNA, complete cds.
          Length = 605

 Score =  241 bits (615), Expect = 1e-62
 Identities = 116/160 (72%), Positives = 144/160 (90%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ IG+RLVWAVS+F+V +CMA T +IS VS++  ++GVQHVIGA++ST++A+L+V
Sbjct: 446 IEPMCKWIGSRLVWAVSNFIVFVCMACTAIISVVSISAHTEGVQHVIGATKSTQIAALVV 505

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLGIPLA+TYSVPFS+TA+LTADAGGGQGLAIGVLNLAIV+PQMV+SLGAGPWDALFG
Sbjct: 506 FSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAIVLPQMVVSLGAGPWDALFG 565

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGNIPAF LAS+ AL AG+ A L+LP LS N F+STG HF
Sbjct: 566 GGNIPAFVLASLAALAAGIFAMLRLPNLSSN-FKSTGFHF 604



>gb:AC139840_1744055 Solanum demissum chromosome 5 BAC PGEC323D8
           genomic sequence, complete sequence.
          Length = 647

 Score =  231 bits (589), Expect = 1e-59
 Identities = 114/161 (70%), Positives = 140/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ IG+RLVWAVS+F+V +CMA T +IS VS++  ++GVQHVIGA+ ST++A+L+V
Sbjct: 464 IEPMCKWIGSRLVWAVSNFIVFVCMACTAIISVVSISAHTEGVQHVIGATRSTQIAALVV 523

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLGIPLA+TYSVPFS+TA+LTADAGGGQGLAIGVLNLAIVVPQMV+SLGAGPWDALFG
Sbjct: 524 FSLLGIPLAVTYSVPFSITAELTADAGGGQGLAIGVLNLAIVVPQMVVSLGAGPWDALFG 583

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLS--RNAFRSTGLH 362
           GGNIPAF LAS+ AL AG+ A L+LP LS    A   +GLH
Sbjct: 584 GGNIPAFVLASLAALAAGIFAMLRLPNLSIYIGAPTKSGLH 624



>gb:AY098894_1576500 Citrus sinensis sucrose transporter 2 mRNA,
           complete cds.
          Length = 607

 Score =  230 bits (587), Expect = 2e-59
 Identities = 109/161 (67%), Positives = 138/161 (85%), Gaps = 1/161 (0%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESS-QGVQHVIGASESTKVASLI 662
           I+P+C+ IG+RLVWA+S+F+V  CMA T +IS +S+  +  +G++H IGA+++ KVASL+
Sbjct: 446 IEPMCRWIGSRLVWAISNFIVFACMATTAIISVISVRRNILEGIEHGIGANQAIKVASLV 505

Query: 661 VFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALF 482
           VF LLG PLAITYSVPF++T +LTAD+GGGQGLAIGVLNLAIV+PQM++SLGAGPWDALF
Sbjct: 506 VFTLLGFPLAITYSVPFAITGELTADSGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDALF 565

Query: 481 GGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF 359
           GGGNIPAF LAS+ AL  GV+ATLKLP LS N+F S+G HF
Sbjct: 566 GGGNIPAFGLASLSALAGGVVATLKLPHLSSNSFTSSGFHF 606



>gb:AY137242_1582010 Oryza sativa (japonica cultivar-group) sucrose
           transporter SUT2 mRNA, complete cds.
          Length = 595

 Score =  224 bits (572), Expect = 1e-57
 Identities = 106/159 (66%), Positives = 137/159 (86%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           +DPLC+++GARLVWA+S+F V +CM  T ++S++S +  S  + H+IGA+++ K ++LIV
Sbjct: 435 VDPLCRLMGARLVWAISNFTVFICMLATAILSWISFDLYSSKLHHIIGANKTVKNSALIV 494

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLG+PL+ITYSVPFSVTA+LTA  GGGQGLA GVLNLAIVVPQ+V+SLGAGPWDALFG
Sbjct: 495 FSLLGLPLSITYSVPFSVTAELTAGTGGGQGLATGVLNLAIVVPQIVVSLGAGPWDALFG 554

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           GGN+PAFALAS+F+LGAGV+A LKLP L  N++RS G H
Sbjct: 555 GGNVPAFALASVFSLGAGVLAVLKLPKLP-NSYRSAGFH 592



>pir|G84441|G84441 probable sucrose-proton symporter [imported] -
           Arabidopsis thaliana>gb:AC004138_1531470 Arabidopsis
           thaliana chromosome 2 clone T17M13 map CIC11A04,
           complete sequence.>gb:ATH289165_1552313 Arabidopsis
           thaliana mRNA for sucrose transporter (suc3 gene).
          Length = 594

 Score =  224 bits (571), Expect = 2e-57
 Identities = 106/159 (66%), Positives = 137/159 (86%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+CQ +GAR+VWA+S+F V  CMAGT VIS +SL++   G+++++  +E+T+ A++IV
Sbjct: 435 IEPMCQRMGARVVWALSNFTVFACMAGTAVISLMSLSDDKNGIEYIMRGNETTRTAAVIV 494

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FALLG PLAITYSVPFSVTA++TAD+GGGQGLAIGVLNLAIV+PQM++SLGAGPWD LFG
Sbjct: 495 FALLGFPLAITYSVPFSVTAEVTADSGGGQGLAIGVLNLAIVIPQMIVSLGAGPWDQLFG 554

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           GGN+PAF LAS+ A  AGVIA  +LPTLS ++F+STG H
Sbjct: 555 GGNLPAFVLASVAAFAAGVIALQRLPTLS-SSFKSTGFH 592



>gb:AY581895_1616086 Zea mays sucrose transporter 2 (SUT2) mRNA,
           complete cds.
          Length = 592

 Score =  223 bits (569), Expect = 3e-57
 Identities = 105/159 (66%), Positives = 136/159 (85%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           +DPLC+MIGARLVWA+S+F V +CM  TT++S++S +  S  + H+IGA+++ K+ +L+V
Sbjct: 432 VDPLCRMIGARLVWAISNFTVFICMMATTILSWISSDLYSSKLHHIIGANKTVKITALVV 491

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLG+PL+ITYSVPFSVTA+LTA  GGGQGLA GVLNLAIVVPQ+V+SLGAGPWDAL+G
Sbjct: 492 FSLLGLPLSITYSVPFSVTAELTAGTGGGQGLATGVLNLAIVVPQIVVSLGAGPWDALYG 551

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           GGN PAF LAS+F+L AGV+A LKLP LS N+++S G H
Sbjct: 552 GGNTPAFVLASVFSLAAGVLAVLKLPKLS-NSYQSAGFH 589



>gb:AB091673_1525058 Oryza sativa (japonica cultivar-group) OsSUT4
           mRNA for sucrose transporter, complete cds.
          Length = 595

 Score =  221 bits (562), Expect = 2e-56
 Identities = 104/159 (65%), Positives = 135/159 (84%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           +DPLC+++GARLVWA+S+F V +CM  T ++S++S +  S  + H+IGA+++ K ++LIV
Sbjct: 435 VDPLCRLMGARLVWAISNFTVFICMLATAILSWISFDLYSSKLHHIIGANKTVKNSALIV 494

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F+LLG+PL+ITY VPFSVTA+LTA  G GQGLA GVLNLAIVVPQ+V+SLGAGPWDALFG
Sbjct: 495 FSLLGLPLSITYGVPFSVTAELTAGTGSGQGLATGVLNLAIVVPQIVVSLGAGPWDALFG 554

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           GGN+PAFALAS+F+LGAGV+A LKLP L  N++RS G H
Sbjct: 555 GGNVPAFALASVFSLGAGVLAVLKLPKLP-NSYRSAGFH 592



>gb:AY830138_1629346 Ipomoea batatas cultivar Beauregard clone
           BAC117E14, complete sequence.
          Length = 511

 Score =  115 bits (289), Expect(2) = 1e-50
 Identities = 58/64 (90%), Positives = 64/64 (100%)
 Frame = -1

Query: 760 GTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADA 581
           GTTVIS+VSLNESS+GVQHVIGAS++TKVASL+VFALLGIPLAITYSVPFSVTA+LTADA
Sbjct: 351 GTTVISFVSLNESSEGVQHVIGASKATKVASLVVFALLGIPLAITYSVPFSVTAELTADA 410

Query: 580 GGGQ 569
           GGGQ
Sbjct: 411 GGGQ 414



 Score =  107 bits (267), Expect(2) = 1e-50
 Identities = 54/75 (72%), Positives = 56/75 (74%), Gaps = 7/75 (9%)
 Frame = -3

Query: 524 DGYLTWCGSMGRLIWRREHTRVCPGLYIRTWGWCHCYTQTAYSLEKRV*INRPSFLI--- 354
           D YLTWCGSMGRLIWRREHT +CPGLYIRT GW H  TQTA SLEK + INR  FLI   
Sbjct: 415 DDYLTWCGSMGRLIWRREHTSICPGLYIRTRGWYHRNTQTAKSLEKLIQINRLPFLITRD 474

Query: 353 ----TDEPRKLAIHN 321
               TDE RKLAIHN
Sbjct: 475 SAHTTDERRKLAIHN 489



>gb:AY780256_1628296 Saccharum hybrid cultivar sucrose transporter
           (SUT1) mRNA, complete cds.
          Length = 517

 Score =  180 bits (456), Expect = 3e-44
 Identities = 88/155 (56%), Positives = 113/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+FMV + MA T +ISY SL +    VQ  I AS + K   L++
Sbjct: 357 IEPMCRKLGPRVVWVTSNFMVCVAMAATALISYWSLKDYHGYVQDAITASTNIKAVCLVL 416

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLAI YSVPF+VTA L A  GGGQGL  GVLN++IV+PQ++I+LGAGPWDALFG
Sbjct: 417 FAFLGVPLAILYSVPFAVTAQLAATKGGGQGLCTGVLNISIVIPQVIIALGAGPWDALFG 476

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS FAL  GV+    LP +S+  FR+
Sbjct: 477 KGNIPAFGVASGFALIGGVVGVFLLPKISKRQFRA 511



>gb:AB008464_1510521 Zea mays mRNA for Sucrose Transporter, complete
           cds.
          Length = 521

 Score =  180 bits (456), Expect = 3e-44
 Identities = 88/155 (56%), Positives = 113/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+FMV + MA T +IS+ SL +    VQ  I AS S K   L++
Sbjct: 361 IEPMCRKVGPRVVWVTSNFMVCVAMAATALISFWSLKDYHGYVQDAITASTSIKAVCLVL 420

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLAI YSVPF+VTA L A  GGGQGL  GVLN++IV+PQ++I+LGAGPWDALFG
Sbjct: 421 FAFLGVPLAILYSVPFAVTAQLAATKGGGQGLCTGVLNISIVIPQVIIALGAGPWDALFG 480

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS FAL  GV+    LP +S+  FR+
Sbjct: 481 KGNIPAFGVASGFALIGGVVGVFLLPKISKRQFRA 515



>gb:AF408843_1797008 Triticum aestivum sucrose transporter SUT1B
           mRNA, complete cds.
          Length = 522

 Score =  178 bits (451), Expect = 1e-43
 Identities = 84/155 (54%), Positives = 113/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+PLC+ +G R+VW  S+F+V + MA   +IS+ +  +    +QH I AS+  K+ SL +
Sbjct: 362 IEPLCKRLGPRVVWVSSNFLVCLSMAAICIISWWATQDMHGYIQHAITASKEIKIVSLAL 421

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLAI YSVPF+VTA L A+ GGGQGL  GVLN+AIV+PQ++I++GAGPWD LFG
Sbjct: 422 FAFLGVPLAILYSVPFAVTAQLAANRGGGQGLCTGVLNIAIVIPQVIIAVGAGPWDELFG 481

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS FAL  G++    LP +SR  FR+
Sbjct: 482 KGNIPAFGMASAFALIGGIVGIFLLPKISRRQFRA 516



>gb:AF408842_1797007 Triticum aestivum sucrose transporter SUT1A
           mRNA, complete cds.
          Length = 522

 Score =  177 bits (450), Expect = 2e-43
 Identities = 85/155 (54%), Positives = 113/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+PLC+ +G R+VW  S+F+V + MA   +IS+ +  +    +QH I AS+  K+ SL +
Sbjct: 362 IEPLCKRLGPRVVWVSSNFLVCLSMAAICIISWWATQDLHGYIQHAITASKEIKIVSLAL 421

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LGIPLAI YSVPF+VTA L A+ GGGQGL  GVLN+AIV+PQ++I++GAGPWD LFG
Sbjct: 422 FAFLGIPLAILYSVPFAVTAQLAANRGGGQGLCTGVLNIAIVIPQVIIAVGAGPWDELFG 481

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS FAL  G++    LP +SR  FR+
Sbjct: 482 KGNIPAFGVASAFALIGGIVGIFLLPKISRRQFRA 516



>gb:AF280050_1782867 Oryza sativa (indica cultivar-group) sucrose
           transporter (SUT1) gene, complete cds.
          Length = 538

 Score =  177 bits (450), Expect = 2e-43
 Identities = 87/158 (55%), Positives = 112/158 (70%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+F+V + MA T +IS+ SL +    VQ  I A +S K   L++
Sbjct: 377 IEPMCRKVGPRVVWVTSNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVL 436

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLA+ YSVPF+VTA L A  GGGQGL  GVLN++IV+PQ+VI+LGAGPWD LFG
Sbjct: 437 FAFLGVPLAVLYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDELFG 496

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGL 365
            GNIPAF LAS FAL  GV     LP +S+  FRS  +
Sbjct: 497 KGNIPAFGLASGFALIGGVAGIFLLPKISKRQFRSVSM 534



>gb:AC073556_1541099 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 297

 Score =  177 bits (450), Expect = 2e-43
 Identities = 87/158 (55%), Positives = 112/158 (70%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+F+V + MA T +IS+ SL +    VQ  I A +S K   L++
Sbjct: 136 IEPMCRKVGPRVVWVTSNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVL 195

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLA+ YSVPF+VTA L A  GGGQGL  GVLN++IV+PQ+VI+LGAGPWD LFG
Sbjct: 196 FAFLGVPLAVLYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDELFG 255

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGL 365
            GNIPAF LAS FAL  GV     LP +S+  FRS  +
Sbjct: 256 KGNIPAFGLASGFALIGGVAGIFLLPKISKRQFRSVSM 293



>gb:AF408844_1797009 Triticum aestivum sucrose transporter SUT1D
           mRNA, complete cds.>gb:AF408845_1797010 Triticum
           aestivum sucrose transporter SUT1D gene, complete cds.
          Length = 523

 Score =  177 bits (449), Expect = 2e-43
 Identities = 85/155 (54%), Positives = 112/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+PLC+ +G R+VW  S+F+V + MA   +IS+ +  +    +QH I AS+  K+ SL +
Sbjct: 363 IEPLCKRLGPRVVWVSSNFLVCLSMAAICIISWWATQDLHGYIQHAITASKEIKIVSLAL 422

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LGIPLAI YSVPF+VTA L A  GGGQGL  GVLN+AIV+PQ++I++GAGPWD LFG
Sbjct: 423 FAFLGIPLAILYSVPFAVTAQLAAKRGGGQGLCTGVLNIAIVIPQVIIAVGAGPWDELFG 482

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS FAL  G++    LP +SR  FR+
Sbjct: 483 KGNIPAFGMASAFALIGGIVGIFLLPKISRRQFRA 517



>gb:HVU272309_1682609 Hordeum vulgare mRNA for sucrose transporter 1
           (sut1 gene).
          Length = 523

 Score =  176 bits (445), Expect = 6e-43
 Identities = 84/155 (54%), Positives = 112/155 (72%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+ +V + MA   +IS+ +  +    +QH I AS+  K  SL +
Sbjct: 363 IEPMCKRLGPRVVWVSSNMLVCLSMAAICIISWWATQDLHGYIQHAITASKEIKAVSLAL 422

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LGIPLAI YSVPF+VTA L A+ GGGQGL  GVLN+AIV+PQ++I++GAGPWD LFG
Sbjct: 423 FAFLGIPLAILYSVPFAVTAQLAANKGGGQGLCTGVLNIAIVIPQVIIAVGAGPWDELFG 482

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
            GNIPAF +AS+FAL  GV+    LP +SR  FR+
Sbjct: 483 KGNIPAFGMASVFALIGGVVGIFLLPKISRRQFRA 517



>pir|T02982|T02982 probable sucrose transport protein -
           rice>gb:D87819_1675072 Oryza sativa (japonica
           cultivar-group) mRNA for sucrose transporter, complete
           cds.
          Length = 537

 Score =  174 bits (442), Expect = 1e-42
 Identities = 86/158 (54%), Positives = 111/158 (70%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I+P+C+ +G R+VW  S+F+V + MA T +IS+ SL +    VQ  I A +S K   L++
Sbjct: 376 IEPMCRKVGPRVVWVTSNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVL 435

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA LG+PLA+ YSVPF+VTA L A  GGGQGL  GVLN++IV+PQ+VI+LGAGPWD LFG
Sbjct: 436 FAFLGVPLAVLYSVPFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDELFG 495

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGL 365
            GNIPAF LAS FAL  GV     LP +S+  F S  +
Sbjct: 496 KGNIPAFGLASGFALIGGVAGIFLLPKISKRQFWSVSM 533



>gb:AF419298_1798405 Oryza sativa (indica cultivar-group) sucrose
           transporter gene, complete cds.
          Length = 506

 Score =  153 bits (387), Expect = 3e-36
 Identities = 79/162 (48%), Positives = 104/162 (64%), Gaps = 3/162 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASES---TKVAS 668
           I+P+C+ +GAR VW +S  +V + MA  +V+S  SL +    VQ    A       + ++
Sbjct: 345 IEPMCRRLGARAVWVMSSAVVCVAMAAVSVLSAWSLGDFGGSVQDAARAPAEEGGVRASA 404

Query: 667 LIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDA 488
           L +F  LG+P A+  SVPF+VTA LTA  GGGQGL  GVLN++IVVPQM I+LGAGPWD 
Sbjct: 405 LALFVFLGLPFAVLCSVPFAVTAQLTASRGGGQGLCTGVLNISIVVPQMAIALGAGPWDE 464

Query: 487 LFGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           LFG GNIPAFA+AS+FA  A     + LP +S  +    G H
Sbjct: 465 LFGEGNIPAFAMASVFAAAAAAAGVVLLPKVSVRSVSMAGGH 506



>gb:AC090487_1734363 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBb0044I14, from Chromosome 10,
           complete sequence.
          Length = 344

 Score =  151 bits (382), Expect = 1e-35
 Identities = 78/162 (48%), Positives = 103/162 (63%), Gaps = 3/162 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASES---TKVAS 668
           I+P+C+ +GAR VW +S  +V + MA  +V+S  SL +    VQ    A       + ++
Sbjct: 183 IEPMCRRLGARAVWVMSSAVVCVAMAAVSVLSAWSLGDFGGSVQDAARAPAEEGGVRASA 242

Query: 667 LIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDA 488
           L +F  LG+P A+  SVPF+VTA L A  GGGQGL  GVLN++IVVPQM I+LGAGPWD 
Sbjct: 243 LALFVFLGLPFAVLCSVPFAVTAQLAASRGGGQGLCTGVLNISIVVPQMAIALGAGPWDE 302

Query: 487 LFGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           LFG GNIPAFA+AS+FA  A     + LP +S  +    G H
Sbjct: 303 LFGEGNIPAFAMASVFAAAAAAAGVVLLPKVSVRSVSMAGGH 344



>gb:AB071809_1522942 Oryza sativa (japonica cultivar-group) OsSUT3
           mRNA for sucrose transporter, complete cds.
          Length = 506

 Score =  151 bits (382), Expect = 1e-35
 Identities = 78/162 (48%), Positives = 103/162 (63%), Gaps = 3/162 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASES---TKVAS 668
           I+P+C+ +GAR VW +S  +V + MA  +V+S  SL +    VQ    A       + ++
Sbjct: 345 IEPMCRRLGARAVWVMSSAVVCVAMAAVSVLSAWSLGDFGGSVQDAARAPAEEGGVRASA 404

Query: 667 LIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDA 488
           L +F  LG+P A+  SVPF+VTA L A  GGGQGL  GVLN++IVVPQM I+LGAGPWD 
Sbjct: 405 LALFVFLGLPFAVLCSVPFAVTAQLAASRGGGQGLCTGVLNISIVVPQMAIALGAGPWDE 464

Query: 487 LFGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           LFG GNIPAFA+AS+FA  A     + LP +S  +    G H
Sbjct: 465 LFGEGNIPAFAMASVFAAAAAAAGVVLLPKVSVRSVSMAGGH 506



>gb:AE016959_1022490 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017092_1752309
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 46 of 77 of the complete sequence.
          Length = 299

 Score =  151 bits (382), Expect = 1e-35
 Identities = 78/162 (48%), Positives = 103/162 (63%), Gaps = 3/162 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASES---TKVAS 668
           I+P+C+ +GAR VW +S  +V + MA  +V+S  SL +    VQ    A       + ++
Sbjct: 138 IEPMCRRLGARAVWVMSSAVVCVAMAAVSVLSAWSLGDFGGSVQDAARAPAEEGGVRASA 197

Query: 667 LIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDA 488
           L +F  LG+P A+  SVPF+VTA L A  GGGQGL  GVLN++IVVPQM I+LGAGPWD 
Sbjct: 198 LALFVFLGLPFAVLCSVPFAVTAQLAASRGGGQGLCTGVLNISIVVPQMAIALGAGPWDE 257

Query: 487 LFGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLH 362
           LFG GNIPAFA+AS+FA  A     + LP +S  +    G H
Sbjct: 258 LFGEGNIPAFAMASVFAAAAAAAGVVLLPKVSVRSVSMAGGH 299



>gb:AY445915_1606542 Malus x domestica sucrose transporter (SUT1)
           mRNA, complete cds.
          Length = 499

 Score =  144 bits (364), Expect = 2e-33
 Identities = 69/146 (47%), Positives = 105/146 (71%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S  ++ +C     VI++V+    S GV+      +   +A+L+V
Sbjct: 346 MEKLCRKWGAGFVWGISSILMTLCFFAMLVITFVN---KSIGVRGHDLPPDGIVIAALVV 402

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA+LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++SLG+GPWD LFG
Sbjct: 403 FAVLGIPLAITYSVPYALVSSRIESLGLGQGLSMGVLNLAIVIPQVIVSLGSGPWDQLFG 462

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN+PAFA+A++ +L +G++A L +P
Sbjct: 463 GGNVPAFAVAAVASLASGLVAILAIP 488



>gb:AY639018_1618838 Zea mays sucrose transport protein (SUT2) mRNA,
           complete cds.
          Length = 501

 Score =  142 bits (357), Expect = 1e-32
 Identities = 76/164 (46%), Positives = 106/164 (64%), Gaps = 5/164 (3%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES--SQGVQHVIGASESTKVASL 665
           ++ LC+  GA LVW VS+ ++ +C     VI+YV+ N    S G            VASL
Sbjct: 342 LEKLCRKWGAGLVWGVSNILMTLCFLAMLVITYVAKNMDYPSSGAPPT-----GIVVASL 396

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           +VF +LG PLAITYS+P+++ A    + G GQGLA+G+LNLAIV+PQ+++SLG+GPWD L
Sbjct: 397 VVFTILGAPLAITYSIPYAMAASRVENLGPGQGLAMGILNLAIVIPQVIVSLGSGPWDQL 456

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLP---TLSRNAFRSTGLH 362
           FGGGN PAFA+A+  +   G++A L LP     S ++ R  G H
Sbjct: 457 FGGGNAPAFAVAAGASFIGGLVAILGLPRARIASSSSRRRGGTH 500



>gb:AB091672_1525057 Oryza sativa (japonica cultivar-group) OsSUT2
           mRNA for sucrose transporter, complete cds.
          Length = 501

 Score =  142 bits (357), Expect = 1e-32
 Identities = 75/159 (47%), Positives = 105/159 (66%), Gaps = 2/159 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES--SQGVQHVIGASESTKVASL 665
           ++ LC+  GA LVW VS+ ++ +C     VI+YV+ N      GV           +ASL
Sbjct: 347 LEKLCRKWGAGLVWGVSNILMALCFVAMLVITYVAKNMDYPPSGVPPT-----GIVIASL 401

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           +VF +LG PLAITYS+P+++ A    + G GQGLA+G+LNLAIV+PQ+++SLG+GPWD L
Sbjct: 402 VVFTILGAPLAITYSIPYAMAASRVENLGLGQGLAMGILNLAIVIPQVIVSLGSGPWDQL 461

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTG 368
           FGGGN PAFA+A+  +   G++A L LP  +R A R  G
Sbjct: 462 FGGGNAPAFAVAAAASFIGGLVAILGLPR-ARIASRRRG 499



>gb:AY603492_1617461 Zea mays sucrose transporter SUT4 mRNA,
           complete cds.
          Length = 501

 Score =  141 bits (355), Expect = 2e-32
 Identities = 76/164 (46%), Positives = 106/164 (64%), Gaps = 5/164 (3%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES--SQGVQHVIGASESTKVASL 665
           ++ LC+  GA LVW VS+ ++ +C     VI+YV+ N    S G            VASL
Sbjct: 342 LEKLCRKWGAGLVWGVSNILMTLCFLAMLVITYVAKNMDYPSSGAPPT-----GIVVASL 396

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           +VF +LG PLAITYS+P+++ A    + G GQGLA+G+LNLAIV+PQ+++SLG+GPWD L
Sbjct: 397 VVFTILGAPLAITYSIPYAMAASRVENLGLGQGLAMGILNLAIVIPQVIVSLGSGPWDQL 456

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLP---TLSRNAFRSTGLH 362
           FGGGN PAFA+A+  +   G++A L LP     S ++ R  G H
Sbjct: 457 FGGGNAPAFAVAAGASFIGGLVAILGLPRARIASSSSRRRGGTH 500



>gb:AJ781069_1813984 Datisca glomerata mRNA for putative sucrose-H+
           symporter (sut4 gene).
          Length = 498

 Score =  139 bits (351), Expect = 5e-32
 Identities = 69/146 (47%), Positives = 103/146 (70%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW VS+ ++ +C     V+++V+      G  H +   +   VA+L++
Sbjct: 345 MEKLCRYWGAGFVWGVSNILMSLCFLAMLVVTFVAKRIDYIG--HKL-PPDVIVVAALVI 401

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA+LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+V+SLG+GPWD LFG
Sbjct: 402 FAILGIPLAITYSVPYALISTRIESLGLGQGLSMGVLNLAIVIPQVVVSLGSGPWDQLFG 461

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN PAFA+A++ A  +G++A L +P
Sbjct: 462 GGNSPAFAVAAVAAFASGLVAILAIP 487



>gb:AF176950_1774627 Lycopersicon esculentum sucrose transporter
           (SUT4) mRNA, complete cds.
          Length = 500

 Score =  138 bits (347), Expect = 1e-31
 Identities = 70/148 (47%), Positives = 101/148 (68%), Gaps = 1/148 (0%)
 Frame = -1

Query: 841 FIDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLN-ESSQGVQHVIGASESTKVASL 665
           F++ LC+  GA   W VS+ ++ +C     +I+ V  N +  QG+       +   +A+L
Sbjct: 347 FMEKLCRKWGAGFTWGVSNVVMSLCFIAMLIITAVRSNIDIGQGLP-----PDGIVIAAL 401

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           +VF++LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV PQ+V+SLG+GPWD L
Sbjct: 402 VVFSILGIPLAITYSVPYALVSSRIEALGLGQGLSMGVLNLAIVFPQIVVSLGSGPWDEL 461

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLP 401
           FGGGN PAF +A++ A  AG+IA L +P
Sbjct: 462 FGGGNSPAFVVAALSAFAAGLIAILAIP 489



>gb:AY375329_1178063 Gossypium barbadense fiber sucrose transporter
           mRNA, partial cds.
          Length = 301

 Score =  138 bits (347), Expect = 1e-31
 Identities = 66/155 (42%), Positives = 105/155 (67%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC   GA  +W VS+ ++ +C     ++SYV+  +    + H +  +    +A+L++
Sbjct: 148 MEKLCSKWGAGFIWGVSNIVMALCFLSMLILSYVT--DHMDYIGHDLPPA-GIMIAALLI 204

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F++LG PLA+TYSVP+++ +      G GQGL++GVLNLAIV+PQ+V+S+G+GPWD LFG
Sbjct: 205 FSILGFPLAVTYSVPYALISTRIESLGLGQGLSMGVLNLAIVIPQVVVSMGSGPWDELFG 264

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFRS 374
           GGN PAFA+A + +L +G+IA L +P  S    R+
Sbjct: 265 GGNSPAFAVAGVASLTSGLIAILAIPRSSPQKIRA 299



>gb:AF237780_1779684 Solanum tuberosum sucrose transporter SUT4
           mRNA, partial cds.
          Length = 488

 Score =  136 bits (342), Expect = 6e-31
 Identities = 69/148 (46%), Positives = 100/148 (67%), Gaps = 1/148 (0%)
 Frame = -1

Query: 841 FIDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLN-ESSQGVQHVIGASESTKVASL 665
           F++ LC+  GA   W VS+ ++ +C     +I+ V  N +  QG+       +   +A+L
Sbjct: 340 FMEKLCRKWGAGFTWGVSNVVMSLCFIAMLIITAVRSNIDIGQGLP-----PDGIVIAAL 394

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           +VF++LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV PQ+V+SLG+GPWD L
Sbjct: 395 VVFSILGIPLAITYSVPYALVSSRIDALGLGQGLSMGVLNLAIVFPQIVVSLGSGPWDEL 454

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLP 401
           FGGGN PAF +A++ A   G+IA L +P
Sbjct: 455 FGGGNSPAFVVAALSAFAGGLIAILAIP 482



>gb:AY725473_1624500 Ricinus communis putative sucrose carrier
           (SUC4) mRNA, complete cds.
          Length = 509

 Score =  135 bits (341), Expect = 7e-31
 Identities = 66/146 (45%), Positives = 100/146 (68%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  +W +S+ ++ +C     + SY++ +    G  H +  S    +A++I+
Sbjct: 356 MEKLCRKWGAGFMWGISNILMALCFLAMLITSYIANHIGYLG--HDLPPS-GIVIAAIII 412

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA+LG PLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++SLG+GPWD LFG
Sbjct: 413 FAVLGFPLAITYSVPYALISSRIEPLGLGQGLSMGVLNLAIVIPQVIVSLGSGPWDQLFG 472

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN PAF + ++ A  AGVIA L +P
Sbjct: 473 GGNSPAFVVGALAAFAAGVIAILGIP 498



>gb:HVU272308_1682608 Hordeum vulgare mRNA for sucrose transporter 2
           (sut2 gene).
          Length = 506

 Score =  134 bits (338), Expect = 2e-30
 Identities = 66/148 (44%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKV--ASL 665
           ++ LC+  GA LVW VS+ ++ +C     +I+YV+     Q + +    +  T +  ASL
Sbjct: 351 MEKLCRKWGAGLVWGVSNIIMALCFVAMLIITYVA-----QNLDYGPSGAPPTGIVAASL 405

Query: 664 IVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDAL 485
           IVF +LG PL+ITYS+P+++ A    + G GQGLA+G+LNL+IV+PQ+++SLG+GPWD L
Sbjct: 406 IVFTILGAPLSITYSIPYAMAASRVENLGLGQGLAMGILNLSIVIPQIIVSLGSGPWDQL 465

Query: 484 FGGGNIPAFALASIFALGAGVIATLKLP 401
           FGGGN P+F +A+  +   G++A L LP
Sbjct: 466 FGGGNAPSFWVAAAASFVGGLVAILGLP 493



>pir|S38657|S38657 sucrose transport protein ptp1 - common
           plantain>gb:PMSUC2_1700804 P.major SUC2 mRNA for sucrose
           transport protein.
          Length = 510

 Score =  134 bits (338), Expect = 2e-30
 Identities = 61/139 (43%), Positives = 96/139 (69%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           G + +W V +F++ +C+  T VI+ V+ +        +     S K+ +L+VF+ LGIPL
Sbjct: 357 GVKRLWGVVNFILAICLCMTIVITKVASHHRPYSNGVLQTPESSVKIGALVVFSALGIPL 416

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+SVPF++ +  +   G GQGL++GVLNLAIV+PQM++S+ +GPWDA+FGGGN+PAF 
Sbjct: 417 AITFSVPFALASIYSTTTGSGQGLSLGVLNLAIVIPQMIVSVASGPWDAMFGGGNLPAFV 476

Query: 454 LASIFALGAGVIATLKLPT 398
           + ++ A  +G+ A   LP+
Sbjct: 477 VGAVAAAASGIFAFTMLPS 495



>pir|S48789|S48789 sucrose transport protein - common
           tobacco>gb:NTSUT1A_1691781 N.tabacum SUT1a mRNA for
           sucrose transporter.
          Length = 507

 Score =  134 bits (336), Expect = 3e-30
 Identities = 63/150 (42%), Positives = 106/150 (70%), Gaps = 2/150 (1%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQH--VIGASESTKVASLIVFALLGI 641
           G + +W + +F++ +CMA T +++ ++  +S Q   H  ++  +   K+ +L +FA+LGI
Sbjct: 353 GVKRLWGILNFVLAVCMALTVLVTKMA-EKSRQYDAHGTLMAPTSGVKIGALTLFAVLGI 411

Query: 640 PLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPA 461
           PLA+T+SVPF++ +  +++AG GQGL++GVLNLAIVVPQM++S+  GPWD LFGGGN+P 
Sbjct: 412 PLAVTFSVPFALASIFSSNAGSGQGLSLGVLNLAIVVPQMLVSIAGGPWDDLFGGGNLPG 471

Query: 460 FALASIFALGAGVIATLKLPTLSRNAFRST 371
           F + ++ A  +G++A   LP+   +A  +T
Sbjct: 472 FIVGAVAAAASGILALTMLPSPPADAKPAT 501



>gb:AF182445_1774966 Vitis vinifera sucrose transporter mRNA,
           complete cds.
          Length = 501

 Score =  133 bits (334), Expect = 5e-30
 Identities = 68/154 (44%), Positives = 104/154 (67%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C     ++S V  +    G  H +  S    +A+LIV
Sbjct: 348 MEKLCRKWGAGFVWGLSNILMSLCFLLMLILSAVVKHMDFLG--HDLPPS-GVVIAALIV 404

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F++LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++SLG+GPWD LFG
Sbjct: 405 FSILGIPLAITYSVPYALISTRIESLGLGQGLSMGVLNLAIVIPQVIVSLGSGPWDQLFG 464

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFR 377
           GGN P+ A+A++ A  +G++A L +P  S +  R
Sbjct: 465 GGNSPSLAVAAVAAFASGLVAILAIPRSSADKSR 498



>gb:AF109922_1768711 Pisum sativum sucrose transport protein SUT1
           mRNA, complete cds.
          Length = 524

 Score =  133 bits (334), Expect = 5e-30
 Identities = 59/144 (40%), Positives = 103/144 (71%), Gaps = 5/144 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNE-----SSQGVQHVIGASESTKVASLIVFAL 650
           G + +W + +F++ +C+  T +++ ++ +       + G+Q  +  S   K  +L +F++
Sbjct: 364 GVKRLWGIVNFLLAICLGLTVLVTKLAQHSRQYAPGTGGLQDPLPPSGGIKAGALTLFSV 423

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LGIPLAITYS+PF++ +  ++ +G GQGL++GVLNLAIV+PQM +S+ +GPWDALFGGGN
Sbjct: 424 LGIPLAITYSIPFALASIFSSTSGAGQGLSLGVLNLAIVIPQMFVSVLSGPWDALFGGGN 483

Query: 469 IPAFALASIFALGAGVIATLKLPT 398
           +PAF + ++ AL +G+++ + LP+
Sbjct: 484 LPAFVVGAVAALASGILSMILLPS 507



>gb:AF021808_1761735 Vitis vinifera putative sucrose transporter
           (VvSUC11) mRNA, complete cds.
          Length = 501

 Score =  133 bits (334), Expect = 5e-30
 Identities = 68/154 (44%), Positives = 104/154 (67%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C     ++S V  +    G  H +  S    +A+LIV
Sbjct: 348 MEKLCRKWGAGFVWGLSNILMSLCFLLMLILSAVVKHMDFLG--HDLPPS-GVVIAALIV 404

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F++LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++SLG+GPWD LFG
Sbjct: 405 FSILGIPLAITYSVPYALISTRIESLGLGQGLSMGVLNLAIVIPQVIVSLGSGPWDQLFG 464

Query: 478 GGNIPAFALASIFALGAGVIATLKLPTLSRNAFR 377
           GGN P+ A+A++ A  +G++A L +P  S +  R
Sbjct: 465 GGNSPSLAVAAVAAFASGLVAILAIPRSSADKSR 498



>gb:LJA538041_1684983 Lotus japonicus mRNA for sucrose transporter 4
           protein (sut4 gene).
          Length = 511

 Score =  133 bits (334), Expect = 5e-30
 Identities = 65/146 (44%), Positives = 98/146 (67%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C     V++YV+      G            +A+LI+
Sbjct: 358 MEKLCRKRGAGFVWGISNILMAVCFLAMLVVTYVANTIGYVGKDL---PPTGIVIAALII 414

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F +LG PLAITYSVP+++ +  T   G GQGL++GVLNLAIV+PQ+V+SLG+GPWD LFG
Sbjct: 415 FTILGFPLAITYSVPYALISKHTEPLGLGQGLSMGVLNLAIVIPQIVVSLGSGPWDQLFG 474

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN  AFA+ ++ A+ +G++A L +P
Sbjct: 475 GGNSAAFAVGAVAAIMSGLLAVLAIP 500



>gb:AY091774_1574734 Arabidopsis thaliana At1g22710/T22J18_12 mRNA,
           complete cds.
          Length = 512

 Score =  133 bits (334), Expect = 5e-30
 Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 3/154 (1%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W + +F++ +C+A T V++  + N          G   +    +L +FA+LGIP 
Sbjct: 359 GAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQ 418

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S+PF++ +  + ++G GQGL++GVLNLAIVVPQMVIS+G GP+D LFGGGNIPAF 
Sbjct: 419 AITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFV 478

Query: 454 LASIFALGAGVIATLKLPTLSRN--AFRST-GLH 362
           L +I A  +GV+A   LP+   +  AF++T G H
Sbjct: 479 LGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH 512



>pir|G86360|G86360 probable sucrose-proton symporter SUC2 protein
           T22J18.12 - Arabidopsis thaliana>gb:AE005172_891224
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AY048256_1561717 Arabidopsis thaliana
           At1g22710/T22J18_12 mRNA, complete
           cds.>gb:AY050986_1562466 Arabidopsis thaliana putative
           sucrose transport protein SUC2 (At1g22710) mRNA,
           complete cds.>gb:AY088566_1573583 Arabidopsis thaliana
           clone 7894 mRNA, complete sequence.>gb:AY113946_1578357
           Arabidopsis thaliana putative sucrose transport protein
           SUC2 (At1g22710) mRNA, complete cds.>gb:BT000684_1634960
           Arabidopsis thaliana clone RAFL08-12-P05 (R11198)
           putative sucrose transport protein, SUC2 (At1g22710)
           mRNA, complete cds.>gb:T22J18_1723817 Arabidopsis
           thaliana chromosome 1 BAC T22J18 sequence, complete
           sequence.
          Length = 512

 Score =  133 bits (334), Expect = 5e-30
 Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 3/154 (1%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W + +F++ +C+A T V++  + N          G   +    +L +FA+LGIP 
Sbjct: 359 GAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQ 418

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S+PF++ +  + ++G GQGL++GVLNLAIVVPQMVIS+G GP+D LFGGGNIPAF 
Sbjct: 419 AITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFV 478

Query: 454 LASIFALGAGVIATLKLPTLSRN--AFRST-GLH 362
           L +I A  +GV+A   LP+   +  AF++T G H
Sbjct: 479 LGAIAAAVSGVLALTVLPSPPPDAPAFKATMGFH 512



>gb:AP006070_1860924 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1342F01.
          Length = 535

 Score =  132 bits (333), Expect = 6e-30
 Identities = 67/147 (45%), Positives = 98/147 (66%), Gaps = 1/147 (0%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQH-VIGASESTKVASLI 662
           I  LC+ + +++VW++S+F+V   MA    +  VS+      +   + G   + K  +L+
Sbjct: 374 IPKLCRRLTSKVVWSISNFLVFALMAVMVAVGMVSMRGYRPSLAAGLTGPDPTLKAVALV 433

Query: 661 VFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALF 482
           VFAL+GIP A+ +SVP++V +++TA+ GGGQGLAIGVLN+AIVVPQ+VI+L AGP D  F
Sbjct: 434 VFALIGIPQAVLFSVPWAVASEVTAEEGGGQGLAIGVLNIAIVVPQLVIALTAGPIDGAF 493

Query: 481 GGGNIPAFALASIFALGAGVIATLKLP 401
             GN PAF +   FA   GV+A + LP
Sbjct: 494 NKGNTPAFGIGGAFAFICGVLALIWLP 520



>gb:AB091674_1525059 Oryza sativa (japonica cultivar-group) OsSUT5
           mRNA for sucrose transporter, complete cds.
          Length = 535

 Score =  132 bits (333), Expect = 6e-30
 Identities = 67/147 (45%), Positives = 98/147 (66%), Gaps = 1/147 (0%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQH-VIGASESTKVASLI 662
           I  LC+ + +++VW++S+F+V   MA    +  VS+      +   + G   + K  +L+
Sbjct: 374 IPKLCRRLTSKVVWSISNFLVFALMAVMVAVGMVSMRGYRPSLAAGLTGPDPTLKAVALV 433

Query: 661 VFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALF 482
           VFAL+GIP A+ +SVP++V +++TA+ GGGQGLAIGVLN+AIVVPQ+VI+L AGP D  F
Sbjct: 434 VFALIGIPQAVLFSVPWAVASEVTAEEGGGQGLAIGVLNIAIVVPQLVIALTAGPIDGAF 493

Query: 481 GGGNIPAFALASIFALGAGVIATLKLP 401
             GN PAF +   FA   GV+A + LP
Sbjct: 494 NKGNTPAFGIGGAFAFICGVLALIWLP 520



>gb:GMA563364_1680377 Glycine max mRNA for sucrose transporter (sut1
           gene).
          Length = 520

 Score =  132 bits (332), Expect = 8e-30
 Identities = 59/144 (40%), Positives = 102/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGV-----QHVIGASESTKVASLIVFAL 650
           G + +W + +F++ +C+A T +++ ++ +     +     Q  +    + K  +L +F+L
Sbjct: 360 GVKRLWGIVNFLLAVCLAMTVLVTKMAQHSRQYTLLPNAHQEPLPPPAAVKAGALALFSL 419

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LGIPLAITYS+PF++ +  ++ +G GQGL++GVLNLAIV+PQMV+S+ +GPWDALFGGGN
Sbjct: 420 LGIPLAITYSIPFALASIFSSTSGAGQGLSLGVLNLAIVIPQMVVSVISGPWDALFGGGN 479

Query: 469 IPAFALASIFALGAGVIATLKLPT 398
           +PAF + ++ A  +G+++ + LP+
Sbjct: 480 LPAFVVGAVAAAASGILSIILLPS 503



>gb:AX306541_1465637 Sequence 1 from Patent WO0188139.
          Length = 521

 Score =  132 bits (331), Expect = 1e-29
 Identities = 59/144 (40%), Positives = 102/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGV-----QHVIGASESTKVASLIVFAL 650
           G + +W + +F++ +C+A T +++ ++ +     +     Q  +    + K  +L +F+L
Sbjct: 361 GVKKLWGIVNFLLAVCLAMTVLVTKMAQHPRQYTLLPNAHQEPLPPPAAVKAGALALFSL 420

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LGIPLAITYS+PF++ +  ++ +G GQGL++GVLNLAIV+PQMV+S+ +GPWDALFGGGN
Sbjct: 421 LGIPLAITYSIPFALASIFSSTSGAGQGLSLGVLNLAIVIPQMVVSVISGPWDALFGGGN 480

Query: 469 IPAFALASIFALGAGVIATLKLPT 398
           +PAF + ++ A  +G+++ + LP+
Sbjct: 481 LPAFVVGAVAAAASGILSIILLPS 504



>pir|S38196|S38196 sucrose transport protein SUC2 - Arabidopsis
           thaliana>gb:ATSUC2S_1554184 A.thaliana SUC2 mRNA for
           sucrose-proton symporter.
          Length = 512

 Score =  131 bits (330), Expect = 1e-29
 Identities = 69/154 (44%), Positives = 103/154 (66%), Gaps = 3/154 (1%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W + +F++ +C+A T V++  + N          G   +    +L +FA+LGIP 
Sbjct: 359 GAKRLWGIVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAILGIPQ 418

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S+PF++ +  + ++G GQGL++GVLNLAIVVPQMVIS+G GP+D LFGGGNIPAF 
Sbjct: 419 AITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVISVGGGPFDELFGGGNIPAFV 478

Query: 454 LASIFALGAGVIATLKLPTLSRN--AFRST-GLH 362
           L +I A  +GV+    LP+   +  AF++T G H
Sbjct: 479 LGAIAAAVSGVLGLTVLPSPPPDAPAFKATMGFH 512



>pir|T14339|T14339 sucrose-proton transport protein -
           carrot>gb:DCA303198_1675624 Daucus carota sut1a gene for
           sucrose/proton symporter, exons 1-6.>gb:DCSUT1A_1675735
           Daucus carota mRNA for sucrose-H+ symporter,
           SUT1a.>gb:DCSUT1B_1675736 Daucus carota mRNA for
           sucrose-H+ symporter, SUT1b.
          Length = 501

 Score =  131 bits (330), Expect = 1e-29
 Identities = 64/145 (44%), Positives = 100/145 (68%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC++ G+  +W +S+ ++ +C     +I++++ N    G            +++LIV
Sbjct: 349 MEKLCRIWGSGFMWGLSNILMTICFFAMLLITFIAKN-MDYGTNP---PPNGIVISALIV 404

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA+LGIPLAITYSVP+++ +      G GQGL++GVLNLAIVVPQ+++SLG+GPWD LFG
Sbjct: 405 FAILGIPLAITYSVPYALVSTRIESLGLGQGLSMGVLNLAIVVPQVIVSLGSGPWDQLFG 464

Query: 478 GGNIPAFALASIFALGAGVIATLKL 404
           GGN PAF +A++ A  AG+IA + +
Sbjct: 465 GGNSPAFVVAALSAFAAGLIALIAI 489



>pir|S38197|S38197 sucrose transport protein SUC1 - Arabidopsis
           thaliana>gb:AE005173_894735 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC021665_1538731 Arabidopsis thaliana
           chromosome 1 BAC F17M19 genomic sequence, complete
           sequence.>gb:ATSUCIS_1554185 A.thaliana SUC1 mRNA for
           sucrose-proton symporter.>gb:AY049275_1561917
           Arabidopsis thaliana At1g71880/F17M19_3 mRNA, complete
           cds.>gb:BT020416_1642811 Arabidopsis thaliana At1g71880
           mRNA, complete cds.
          Length = 513

 Score =  131 bits (329), Expect = 2e-29
 Identities = 66/148 (44%), Positives = 105/148 (70%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W + +F++   +A T +++  +  +  +    + G S S K  +L +FA+LGIPL
Sbjct: 361 GAKRLWGIVNFILAAGLAMTVLVTKFA-EDHRKTAGDLAGPSASVKAGALSLFAVLGIPL 419

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S PF++ +  ++ +G GQGL++GVLNLAIV+PQM++SLG GP+DALFGGGN+PAF 
Sbjct: 420 AITFSTPFALASIFSSCSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFI 479

Query: 454 LASIFALGAGVIATLKLPTLSRNAFRST 371
           +A+I A  +GV+A   LP+   +A ++T
Sbjct: 480 VAAIAAAISGVLALTVLPSPPPDAPKAT 507



>gb:AF167415_1774081 Apium graveolens sucrose transporter SUT2A
           (SUT2A) mRNA, complete cds.>gb:AF167416_1774082 Apium
           graveolens sucrose transporter SUT2B (SUT2B) mRNA,
           complete cds.
          Length = 512

 Score =  130 bits (328), Expect = 2e-29
 Identities = 62/145 (42%), Positives = 105/145 (72%), Gaps = 1/145 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIP 638
           G +++W + +F++ + +  T V+S V+ ++   G    ++  S   K  +L +F++LGIP
Sbjct: 357 GVKILWGLVNFLLAIGLVMTVVVSKVAQHQRQHGANGQLLPPSAGVKAGALSLFSILGIP 416

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           L+IT+S+PF++ +  ++ +G GQGL++GVLNLAIVVPQM++S+ AGP+D+LFGGGN+PAF
Sbjct: 417 LSITFSIPFALASIYSSGSGAGQGLSLGVLNLAIVVPQMIVSVLAGPFDSLFGGGNLPAF 476

Query: 457 ALASIFALGAGVIATLKLPTLSRNA 383
            + +I A  +GV+A + LP  S++A
Sbjct: 477 VVGAISAAISGVLAIVLLPKPSKDA 501



>gb:AB036758_1519045 Daucus carota cSUT mRNA for sucrose transporter
           protein, complete cds.
          Length = 515

 Score =  130 bits (328), Expect = 2e-29
 Identities = 63/145 (43%), Positives = 104/145 (71%), Gaps = 1/145 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIP 638
           G +++W V +F++ + +  T V+S V+ ++        ++  S   K  +L +F++LGIP
Sbjct: 360 GVKILWGVVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFSILGIP 419

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           L+ITYS+PF++ +  ++ +G GQGL++GVLNLAIVVPQM++S+ AGP+D+LFGGGN+PAF
Sbjct: 420 LSITYSIPFALASIYSSGSGAGQGLSLGVLNLAIVVPQMIVSVLAGPFDSLFGGGNLPAF 479

Query: 457 ALASIFALGAGVIATLKLPTLSRNA 383
            + +I A  +GV+A + LP  S++A
Sbjct: 480 VVGAISAAISGVLAIVLLPKPSKDA 504



>pir|T12198|T12198 sucrose transport protein - fava
           bean>gb:VFZ93774_1727209 V.faba mRNA for sucrose
           transporter.
          Length = 523

 Score =  130 bits (327), Expect = 3e-29
 Identities = 57/144 (39%), Positives = 102/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNE-----SSQGVQHVIGASESTKVASLIVFAL 650
           G + +W + +F++ +C+  T +++ ++ +       +  +   +  SE  K  +L +F++
Sbjct: 363 GVKRLWGIVNFLLAICLGLTVLVTKLAQHSRQYAPGTGALGDPLPPSEGIKAGALTLFSV 422

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LG+PLAITYS+PF++ +  ++ +G GQGL++GVLNLAIV+PQM +S+ +GPWDALFGGGN
Sbjct: 423 LGVPLAITYSIPFALASIFSSTSGAGQGLSLGVLNLAIVIPQMFVSVLSGPWDALFGGGN 482

Query: 469 IPAFALASIFALGAGVIATLKLPT 398
           +PAF + ++ AL +G+++ + LP+
Sbjct: 483 LPAFVVGAVAALASGILSIILLPS 506



>pir|S43142|S43142 sucrose transport protein - castor
           bean>gb:RCSCR1R_1703397 R.communis (Carmencita) Scr1
           mRNA for sucrose carrier.
          Length = 533

 Score =  130 bits (326), Expect = 4e-29
 Identities = 60/146 (41%), Positives = 101/146 (69%), Gaps = 7/146 (4%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASE-------STKVASLIVF 656
           G + +W + +F++ +C+A T +++  +  ES++    V G ++         K  +L +F
Sbjct: 374 GVKRLWGIVNFVLAVCLAMTVLVTKQA--ESTRRFATVSGGAKVPLPPPSGVKAGALALF 431

Query: 655 ALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGG 476
           A++G+P AITYS+PF++ +  +  +G GQGL++GVLNL+IV+PQM++S+ AGPWDALFGG
Sbjct: 432 AVMGVPQAITYSIPFALASIFSNTSGAGQGLSLGVLNLSIVIPQMIVSVAAGPWDALFGG 491

Query: 475 GNIPAFALASIFALGAGVIATLKLPT 398
           GN+PAF + ++ AL +G+ A   LP+
Sbjct: 492 GNLPAFVVGAVAALASGIFALTMLPS 517



>gb:MTR459790_1687657 Medicago truncatula partial mRNA for putative
           sucrose-H+ symporter (sut1 gene).
          Length = 286

 Score =  129 bits (325), Expect = 5e-29
 Identities = 58/142 (40%), Positives = 101/142 (71%), Gaps = 3/142 (2%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQG-VQHV--IGASESTKVASLIVFALLG 644
           G + +W + +F++ +C+A T +++ ++ +        H   +  S      +L +F++LG
Sbjct: 128 GVKRLWGIVNFLLAICLAMTVLVTKLAQHSRVYADASHTDPLPPSGGITAGALALFSVLG 187

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAITYS+PF++ +  ++ +G GQGL++GVLNLAIV+PQM++S+ +GPWDALFGGGN+P
Sbjct: 188 IPLAITYSIPFALASIFSSSSGAGQGLSLGVLNLAIVIPQMIVSVLSGPWDALFGGGNLP 247

Query: 463 AFALASIFALGAGVIATLKLPT 398
           AF + ++ AL +G+++ + LP+
Sbjct: 248 AFVVGAVAALASGILSVVLLPS 269



>sp|Q03411|SUT_SPIOL Sucrose transport protein (Sucrose permease)
           (Sucrose-proton symporter).>pir|S28052|S28052 sucrose
           transport protein - spinach>gb:SOS21_1715889 S.oleraceae
           mRNA for sucrose permease.
          Length = 525

 Score =  129 bits (325), Expect = 5e-29
 Identities = 63/154 (40%), Positives = 107/154 (69%), Gaps = 7/154 (4%)
 Frame = -1

Query: 838 IDPLCQMIG-ARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGAS------EST 680
           I+ L +M+G A+ +W + + ++ +C+A T +++  +  E  +   H++G++         
Sbjct: 360 IEGLARMVGGAKRLWGIVNIILAVCLAMTVLVTKSA--EHFRDSHHIMGSAVPPPPPAGV 417

Query: 679 KVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAG 500
           K  +L +FA+LGIPLAIT+S+PF++ +  +A +G GQGL++GVLNLAIVVPQM +S+ +G
Sbjct: 418 KGGALAIFAVLGIPLAITFSIPFALASIFSASSGSGQGLSLGVLNLAIVVPQMFVSVTSG 477

Query: 499 PWDALFGGGNIPAFALASIFALGAGVIATLKLPT 398
           PWDA+FGGGN+PAF + ++ A  + V++   LP+
Sbjct: 478 PWDAMFGGGNLPAFVVGAVAATASAVLSFTLLPS 511



>gb:AF175321_1774498 Arabidopsis thaliana sucrose transporter SUT4
           (SUT4) mRNA, complete cds.>gb:AF175322_1774499
           Arabidopsis thaliana sucrose transporter SUT4 (SUT4)
           gene, complete cds.
          Length = 510

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/146 (42%), Positives = 96/146 (65%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C  G  + S+V+ +    G +       S   A++++
Sbjct: 357 MEKLCRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQ---PPASIVFAAVLI 413

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F +LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++S+G+GPWD LFG
Sbjct: 414 FTILGIPLAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFG 473

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN PA A+ +      G++A L LP
Sbjct: 474 GGNSPALAVGAATGFIGGIVAILALP 499



>gb:AF063400_1765411 Apium graveolens sucrose transporter (SUT1)
           mRNA, complete cds.
          Length = 512

 Score =  129 bits (323), Expect = 9e-29
 Identities = 61/145 (42%), Positives = 104/145 (71%), Gaps = 1/145 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIP 638
           G +++W + +F++ + +  T V+S V+ ++   G    ++  S   K  +L +F++LGIP
Sbjct: 357 GVKILWGLVNFLLAIGLVMTVVVSKVAQHQRQHGANGQLLPPSAGVKAGALSLFSILGIP 416

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           L+IT+S+PF++ +  ++ +G GQGL++GVLNLAIVVPQM++S+ AGP+D+LFGGGN+PAF
Sbjct: 417 LSITFSIPFALASIYSSGSGAGQGLSLGVLNLAIVVPQMIVSVLAGPFDSLFGGGNLPAF 476

Query: 457 ALASIFALGAGVIATLKLPTLSRNA 383
            + +I A  +GV+A + LP   ++A
Sbjct: 477 VVGAISAAISGVLAIVLLPKPCKDA 501



>gb:DCA303199_1675625 Daucus carota sut2 gene for sucrose/proton
           symporter, exons 1-4.
          Length = 515

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/145 (42%), Positives = 103/145 (71%), Gaps = 1/145 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIP 638
           G +++W   +F++ + +  T V+S V+ ++        ++  S   K  +L +F++LGIP
Sbjct: 360 GVKILWGFVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFSILGIP 419

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           L+ITYS+PF++ +  ++ +G GQGL++GVLNLAIVVPQM++S+ AGP+D+LFGGGN+PAF
Sbjct: 420 LSITYSIPFALASIYSSGSGAGQGLSLGVLNLAIVVPQMIVSVLAGPFDSLFGGGNLPAF 479

Query: 457 ALASIFALGAGVIATLKLPTLSRNA 383
            + +I A  +GV+A + LP  S++A
Sbjct: 480 VVGAISAAISGVLAIVLLPKPSKDA 504



>gb:ATH289166_1552314 Arabidopsis thaliana mRNA for sucrose
           transporter (suc4 gene).>gb:AY072092_1566987 Arabidopsis
           thaliana putative sucrose/H+ symporter protein
           (At1g09960) mRNA, complete cds.>gb:BT004418_1637490
           Arabidopsis thaliana clone U19248 putative sucrose/H+
           symporter protein (At1g09960) mRNA, complete cds.
          Length = 510

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/146 (42%), Positives = 96/146 (65%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C  G  + S+V+ +    G +       S   A++++
Sbjct: 357 MEKLCRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQ---PPASIVFAAVLI 413

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F +LGIPLAITYSVP+++ +      G GQGL++GVLNLAIV+PQ+++S+G+GPWD LFG
Sbjct: 414 FTILGIPLAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFG 473

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN PA A+ +      G++A L LP
Sbjct: 474 GGNSPALAVGAATGFIGGIVAILALP 499



>pir|JQ2389|JQ2389 sucrose transport protein -
           potato>gb:STSUCTR_1722927 S.tuberosum mRNA for sucrose
           transporter.
          Length = 516

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/144 (43%), Positives = 102/144 (70%), Gaps = 5/144 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQH-----VIGASESTKVASLIVFAL 650
           GA+ +W + +F++ +C+A T +++ ++  E S+  QH     ++G +   K+ +L++FA 
Sbjct: 361 GAKRLWGILNFVLAICLAMTILVTKMA--EKSR--QHDPAGTLMGPTPGVKIGALLLFAA 416

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LGIPLA T+S+PF++ +  +++ G GQGL++GVLNLAIVVPQM++SL  GPWD LFGGGN
Sbjct: 417 LGIPLAATFSIPFALASIFSSNRGSGQGLSLGVLNLAIVVPQMLVSLVGGPWDDLFGGGN 476

Query: 469 IPAFALASIFALGAGVIATLKLPT 398
           +P F + ++ A  + V+A   LP+
Sbjct: 477 LPGFVVGAVAAAASAVLALTMLPS 500



>pir|T14340|T14340 sucrose-proton transport protein -
           carrot>gb:DCSUT2_1675737 Daucus carota mRNA for
           sucrose-H+ symporter, SUT2.
          Length = 515

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/145 (42%), Positives = 103/145 (71%), Gaps = 1/145 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIP 638
           G +++W   +F++ + +  T V+S V+ ++        ++  S   K  +L +F++LGIP
Sbjct: 360 GVKILWGFVNFILAIGLVMTVVVSKVAQHQREHSANGQLLPPSAGVKAGALSLFSILGIP 419

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           L+ITYS+PF++ +  ++ +G GQGL++GVLNLAIVVPQM++S+ AGP+D+LFGGGN+PAF
Sbjct: 420 LSITYSIPFALASIYSSGSGAGQGLSLGVLNLAIVVPQMIVSVLAGPFDSLFGGGNLPAF 479

Query: 457 ALASIFALGAGVIATLKLPTLSRNA 383
            + +I A  +GV+A + LP  S++A
Sbjct: 480 VVGAISAAISGVLAIVLLPKPSKDA 504



>gb:AY065839_1566578 Brassica oleracea sucrose transporter SUC1
           (SUC1) mRNA, complete cds.
          Length = 513

 Score =  128 bits (321), Expect = 2e-28
 Identities = 61/139 (43%), Positives = 100/139 (71%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W + +F++ + +A T +++ ++ +       +  G S   +  +L +FA+LGIPL
Sbjct: 360 GAKRLWGIVNFILAIGLAMTVLVTKLAADYRKVAGPYA-GPSPGIRAGALSLFAVLGIPL 418

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S+PF++ +  ++ +G GQGL++GVLNLAIV+PQM++SLG GP+DALFGGGN+PAF 
Sbjct: 419 AITFSIPFALASIFSSSSGAGQGLSLGVLNLAIVIPQMIVSLGGGPFDALFGGGNLPAFI 478

Query: 454 LASIFALGAGVIATLKLPT 398
           + +I A  +GV+A   LP+
Sbjct: 479 VGAIAAAISGVLAITVLPS 497



>gb:AY065840_1566579 Brassica oleracea sucrose transporter SUC2
           (SUC2) mRNA, complete cds.
          Length = 508

 Score =  127 bits (320), Expect = 2e-28
 Identities = 63/142 (44%), Positives = 96/142 (67%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   +F++ +C+A T V++  + N          G   +    +L +FA+LG
Sbjct: 351 KMGGAKRLWGAVNFILAICLAMTVVVTKQAENHRRDHGGAKTGPPGNVTAGALTLFAVLG 410

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IP AIT+S+PF++ +  + ++G GQGL++GVLNLAIVVPQMV+S+G GP+D LF GGNIP
Sbjct: 411 IPQAITFSIPFALASIFSTNSGAGQGLSLGVLNLAIVVPQMVVSVGGGPFDELFHGGNIP 470

Query: 463 AFALASIFALGAGVIATLKLPT 398
           AF L +I A  +G++A   LP+
Sbjct: 471 AFVLGAIAAAVSGILALTVLPS 492



>pir|S51114|S51114 sucrose-proton symporter - beet>gb:BVSUT1_1643167
           B.vulgaris mRNA for sucrose/proton-symporter.
          Length = 523

 Score =  127 bits (319), Expect = 3e-28
 Identities = 63/153 (41%), Positives = 103/153 (67%), Gaps = 7/153 (4%)
 Frame = -1

Query: 838 IDPLCQMIGA-RLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGA------SEST 680
           I+ L +++G  + +W + + ++ +C+A T +++  +  E  +   HV GA          
Sbjct: 358 IEKLARLVGGVKRLWGIVNLILAVCLAMTILVTKSA--EHYRATHHVPGAIGPPLPPPGV 415

Query: 679 KVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAG 500
           K  +L +FA+LGIPLAIT+S+PF++ +  +A +G GQGL++GVLNLAIVVPQM +S+ +G
Sbjct: 416 KGGALAIFAVLGIPLAITFSIPFALASIFSASSGSGQGLSLGVLNLAIVVPQMFVSVTSG 475

Query: 499 PWDALFGGGNIPAFALASIFALGAGVIATLKLP 401
           PWDALFGGGN+PAF + ++ A  + +++   LP
Sbjct: 476 PWDALFGGGNLPAFVVGAVAATASAILSFTLLP 508



>gb:AF191024_1775459 Asarina barclaiana sucrose transporter 1 (SUT1)
           mRNA, complete cds.
          Length = 510

 Score =  127 bits (318), Expect = 3e-28
 Identities = 62/149 (41%), Positives = 101/149 (67%), Gaps = 5/149 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNE-----SSQGVQHVIGASESTKVASLIVFAL 650
           G + +W   +F++ +C+A T VI+  + +       + GVQ ++      K+++L +  +
Sbjct: 351 GPKRLWGGVNFLLAVCLALTVVITKQAEHSRLYTVGADGVQILLPPVPGVKISALALSGV 410

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           LGIPLA+T+S+PF++ +  +++ G GQGL++GVLNLAIV+PQMV+S+ +GP DALFGGGN
Sbjct: 411 LGIPLAVTFSIPFALASIYSSNYGAGQGLSLGVLNLAIVIPQMVVSVASGPLDALFGGGN 470

Query: 469 IPAFALASIFALGAGVIATLKLPTLSRNA 383
           IPAF + ++ A  +G+ A   LP L  +A
Sbjct: 471 IPAFVMGAVAAAVSGIFAVTMLPALPADA 499



>gb:AY504969_1609835 Juglans regia sucrose transporter mRNA,
           complete cds.
          Length = 516

 Score =  126 bits (317), Expect = 4e-28
 Identities = 62/144 (43%), Positives = 98/144 (68%), Gaps = 6/144 (4%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASE------STKVASLIVFA 653
           G + +W + +F++ +CMA T +I+   L ES++      G +         K  +L +FA
Sbjct: 354 GVKRLWGIVNFLLALCMAMTVLIT--KLAESARHTAAANGGATLSPPPAGVKAGALALFA 411

Query: 652 LLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGG 473
           +LGIPLA+TYS+PF++ +  +  +G GQGL++GVLNLAIV PQM++S+ +GP+DALFGGG
Sbjct: 412 VLGIPLAVTYSIPFALASIFSHASGAGQGLSLGVLNLAIVFPQMLVSVASGPFDALFGGG 471

Query: 472 NIPAFALASIFALGAGVIATLKLP 401
           N+PAF + +I A  +G+++   LP
Sbjct: 472 NLPAFVVGAISAAASGILSLTMLP 495



>gb:BVU64967_1643232 Beta vulgaris sucrose-proton symporter (Bv8-6)
           mRNA, complete cds.
          Length = 539

 Score =  126 bits (316), Expect = 6e-28
 Identities = 63/157 (40%), Positives = 105/157 (66%), Gaps = 7/157 (4%)
 Frame = -1

Query: 838 IDPLCQMIGA-RLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGA------SEST 680
           I+ L +++G  + +W + + ++ +C+A T +++  +  E  +   HV GA          
Sbjct: 359 IEKLARLVGGVKRLWGIVNLILAVCLAMTILVTKSA--EHYRATHHVPGAIGPPLPPPGF 416

Query: 679 KVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAG 500
           K  +L +F++LGIPLAIT+S+PF++ +  +A +G GQGL++GVLNLAIVVPQM +S+ +G
Sbjct: 417 KGGALAIFSVLGIPLAITFSIPFALASIFSASSGSGQGLSLGVLNLAIVVPQMFVSVTSG 476

Query: 499 PWDALFGGGNIPAFALASIFALGAGVIATLKLPTLSR 389
           PWDALFGGGN+PAF + ++ A  + +++   LP+  R
Sbjct: 477 PWDALFGGGNLPAFVVGAVAATASAILSFTLLPSPHR 513



>gb:AF242307_1780137 Euphorbia esula sucrose transport protein mRNA,
           complete cds.
          Length = 530

 Score =  125 bits (315), Expect = 8e-28
 Identities = 63/143 (44%), Positives = 99/143 (69%), Gaps = 8/143 (5%)
 Frame = -1

Query: 802 VWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASEST--------KVASLIVFALL 647
           +W + +F++ +C+A T +I+   L ES +    V G   +T        K  +L +FA++
Sbjct: 375 LWGIVNFLLAICLALTILIT--KLAESGRHYPTVNGVVSTTPSPPSSGIKAGALTLFAVM 432

Query: 646 GIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNI 467
           GIP AITYSVPF++ +  + D+G GQGL++GVLNL+IV+PQM++S+ +GP+DALFGGGN+
Sbjct: 433 GIPQAITYSVPFALASIFSNDSGAGQGLSLGVLNLSIVIPQMLVSVASGPFDALFGGGNL 492

Query: 466 PAFALASIFALGAGVIATLKLPT 398
           PAF + ++ A  +GV+A   LP+
Sbjct: 493 PAFVVGAVAAAASGVLALTYLPS 515



>gb:AF191025_1775460 Alonsoa meridionalis sucrose transporter 1
           (SUT1) mRNA, complete cds.
          Length = 502

 Score =  125 bits (313), Expect = 1e-27
 Identities = 59/147 (40%), Positives = 100/147 (68%), Gaps = 8/147 (5%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVIS--------YVSLNESSQGVQHVIGASESTKVASLIV 659
           G + +W   + ++ +C+A T +I+        Y S+  ++  +Q  +      K+ +L +
Sbjct: 346 GVKRLWGSVNLLLAICLAMTVLITKMAQHHREYASVGGAAPTLQPPV---HGVKIGALAL 402

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F++LGIPLA T+S+PF++ +  ++++G GQGL++GVLNLAIV+PQM +S+ +GPWDALFG
Sbjct: 403 FSVLGIPLAATFSIPFALASIYSSNSGAGQGLSLGVLNLAIVIPQMFVSVASGPWDALFG 462

Query: 478 GGNIPAFALASIFALGAGVIATLKLPT 398
           GGN+PAF + ++ A  +G+IA   LP+
Sbjct: 463 GGNLPAFVVGAVAATVSGIIALTALPS 489



>gb:AP002544_1822664 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBL20.
          Length = 491

 Score =  122 bits (307), Expect = 6e-27
 Identities = 59/146 (40%), Positives = 100/146 (68%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           I  + + IGA+ +W   + ++ +C+A T +++  +  E  +    +   + + +  +L +
Sbjct: 347 IGVISKKIGAKRLWGAVNIILAVCLAMTVLVTKKA-EEHRKIAGRMALPTNAIRDGALSL 405

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           FA+LGIPLAIT+S+PF++ + +++ +G GQGL++GVLN+AIV+PQM++S G GP DALFG
Sbjct: 406 FAILGIPLAITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFG 465

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN+P F + +I AL + V+A   LP
Sbjct: 466 GGNLPGFVVGAIAALISSVVALTVLP 491



>gb:AF021810_1761737 Vitis vinifera putative sucrose transporter
           (VvSUC27) mRNA, complete cds.
          Length = 505

 Score =  121 bits (304), Expect = 1e-26
 Identities = 62/140 (44%), Positives = 92/140 (65%), Gaps = 2/140 (1%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYV--SLNESSQGVQHVIGASESTKVASLIVFALLGI 641
           G + +W   +F++ +C+A T ++S +  S   S  G  H        K  +L +FA++G+
Sbjct: 350 GVKRLWGGVNFLLALCLALTVLVSKLAASWRHSLGGELHP--PPIGIKAGALSLFAVMGV 407

Query: 640 PLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPA 461
           PLAITYS+PF++ +     +G GQGL++GVLNLAIVVPQM++S+ +GPWDA FGGGN+PA
Sbjct: 408 PLAITYSIPFALASIFCHSSGAGQGLSLGVLNLAIVVPQMMVSVASGPWDARFGGGNLPA 467

Query: 460 FALASIFALGAGVIATLKLP 401
           F + +  A   GV+A   LP
Sbjct: 468 FVVGAFAAALNGVLALTMLP 487



>pir|A84520|A84520 probable sucrose-proton symporter [imported] -
           Arabidopsis thaliana>gb:AC005398_1532685 Arabidopsis
           thaliana chromosome 2 clone T6B13 map mi398, complete
           sequence.
          Length = 492

 Score =  119 bits (299), Expect = 5e-26
 Identities = 57/138 (41%), Positives = 95/138 (68%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPL 635
           GA+ +W   + ++ +C+A T +++  +  E  +    +   ++  +  +L +FALLGIPL
Sbjct: 356 GAKRLWGAVNIILAVCLAMTVLVTKKA-EEHRRIAGPMALPTDGIRAGALTLFALLGIPL 414

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFA 455
           AIT+S+PF++ + +++ +G GQGL++GVLN+AIV+PQM++S G GP DALFGGGN+P F 
Sbjct: 415 AITFSIPFALASIISSSSGAGQGLSLGVLNMAIVIPQMIVSFGVGPIDALFGGGNLPRFV 474

Query: 454 LASIFALGAGVIATLKLP 401
           + +I A  + V+A   LP
Sbjct: 475 VGAIAAAISSVVAFTVLP 492



>gb:AB016875_1512964 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9D7.
          Length = 492

 Score =  119 bits (298), Expect = 7e-26
 Identities = 58/141 (41%), Positives = 96/141 (68%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   + ++ +C+A T +++  +  E  +    +   ++  +  +L +FALLG
Sbjct: 353 KMGGAKRLWGAVNIILAVCLAMTVLVTKKA-EEHRRIAGPMALPTDGIRAGALTLFALLG 411

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAIT+S+PF++ + +++ +G GQGL++GVLN+ IV+PQMV+S G GP DALFGGGN+P
Sbjct: 412 IPLAITFSIPFALASIISSSSGAGQGLSLGVLNMTIVIPQMVVSFGVGPIDALFGGGNLP 471

Query: 463 AFALASIFALGAGVIATLKLP 401
            F + +I A  + V+A   LP
Sbjct: 472 GFVVGAIAAAISSVVAFSVLP 492



>gb:AY098891_1576497 Citrus sinensis citrus sucrose transporter 1
           mRNA, complete cds.
          Length = 528

 Score =  119 bits (297), Expect = 9e-26
 Identities = 60/153 (39%), Positives = 104/153 (67%), Gaps = 6/153 (3%)
 Frame = -1

Query: 838 IDPLCQMIGA-RLVWAVSHFMVLMCMAGTTVISYVSLNE-----SSQGVQHVIGASESTK 677
           ++ L ++IG  + +W V +F++ + +A T +I+ ++ +      ++ G  H++      K
Sbjct: 353 VEVLAKLIGGVKRLWGVVNFLLAVSLAFTFLITKLAESNRRSVTTAGGATHILPPPVGVK 412

Query: 676 VASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGP 497
           V +L +F +LGIP AIT+SVPF++ +  +  +  GQGL++GVLNLAIVVPQM++SL +GP
Sbjct: 413 VGALAIFTVLGIPQAITFSVPFAMASIFSRTSAAGQGLSLGVLNLAIVVPQMLVSLLSGP 472

Query: 496 WDALFGGGNIPAFALASIFALGAGVIATLKLPT 398
           +DA+ GGGN+PAF + ++ A  +G++A   LP+
Sbjct: 473 FDAVCGGGNMPAFMVGAVAAALSGIVALTLLPS 505



>gb:AF149981_1772545 Nicotiana tabacum sucrose transporter-like
           protein (SUT3) mRNA, complete cds.
          Length = 521

 Score =  116 bits (291), Expect = 5e-25
 Identities = 53/140 (37%), Positives = 96/140 (68%), Gaps = 1/140 (0%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVS-LNESSQGVQHVIGASESTKVASLIVFALLGIP 638
           GA+ +W + +F++ +C+A T  ++ ++  +    G   ++   +  K+++L++ A+ GIP
Sbjct: 355 GAKRLWGIVNFILAICLAMTVFVTKMADKSRRYDGDGELLPPDQGVKISALLLNAVTGIP 414

Query: 637 LAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAF 458
           LA+ YS+PF++ +  +++ G GQGL+ GV+NLAIVVPQ ++S+   P+DALFGGGN+PAF
Sbjct: 415 LAVLYSIPFAMASIYSSNVGAGQGLSQGVINLAIVVPQTLVSISGRPFDALFGGGNLPAF 474

Query: 457 ALASIFALGAGVIATLKLPT 398
              ++ A  +G++A   LP+
Sbjct: 475 VAGAVAAAVSGILALTLLPS 494



>pir|F96741|F96741 probable sucrose transport protein F17M19.4
           [imported] - Arabidopsis thaliana>gb:AE005173_894736
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC021665_1538732 Arabidopsis thaliana
           chromosome 1 BAC F17M19 genomic sequence, complete
           sequence.
          Length = 512

 Score =  116 bits (290), Expect = 6e-25
 Identities = 57/142 (40%), Positives = 93/142 (65%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   +F++ + +A T +++  S     +    + G S   K     +F +LG
Sbjct: 357 KMGGAKRLWGCVNFILAIGLAMTVLVTK-SAEHHREIAGPLAGPSSGIKAGVFSLFTVLG 415

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAITYS+PF++ +  + ++G GQGL++GVLN+AI +PQM++S  +GP DA FGGGN+P
Sbjct: 416 IPLAITYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLP 475

Query: 463 AFALASIFALGAGVIATLKLPT 398
           +F + +I A  +GV+A   LP+
Sbjct: 476 SFVVGAIAAAVSGVLALTVLPS 497



>gb:ATH252133_1552194 Arabidopsis thaliana mRNA for sucrose
           trasporter (suc5 gene).
          Length = 509

 Score =  115 bits (289), Expect = 8e-25
 Identities = 57/142 (40%), Positives = 93/142 (65%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   +F++ + +A T +++  S     +    + G S   K     +F +LG
Sbjct: 357 KMGGAKRLWGCVNFILAIGLAMTVLVTK-SAEHHREIAGPLAGPSSGIKAGVFSLFTVLG 415

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAITYS+PF++ +  + ++G GQGL++GVLN+AI +PQM++S  +GP DA FGGGN+P
Sbjct: 416 IPLAITYSIPFALASIFSTNSGAGQGLSLGVLNIAICIPQMIVSFSSGPLDAQFGGGNLP 475

Query: 463 AFALASIFALGAGVIATLKLPT 398
           +F + +I A  +GV+A   LP+
Sbjct: 476 SFVVGAIAAAISGVLALTVLPS 497



>gb:AK176510_1818498 Arabidopsis thaliana mRNA for hypothetical
           protein, complete cds, clone: RAFL25-03-A02.
          Length = 491

 Score =  115 bits (287), Expect = 1e-24
 Identities = 55/141 (39%), Positives = 95/141 (67%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   + ++ +C+A T +++  +  E  +    +   ++  +  +L +FALLG
Sbjct: 352 KMGGAKRLWGAVNIILAVCLAMTVLVTKKA-EEHRRIAGPMALPTDGIRAGALTLFALLG 410

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAIT+S+PF++ + +++ +G GQ L++GVLN+AIV+PQM++S G GP DALFG GN+P
Sbjct: 411 IPLAITFSIPFALASIISSSSGAGQRLSLGVLNMAIVIPQMIVSFGVGPIDALFGDGNLP 470

Query: 463 AFALASIFALGAGVIATLKLP 401
            F + +I A  + ++A   LP
Sbjct: 471 GFVVGAIAAAVSSIVAFTVLP 491



>pir|E96691|E96691 probable sucrose-proton symporter T12I7.2
           [imported] - Arabidopsis thaliana>gb:AE005173_894305
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC079285_1732488 Arabidopsis thaliana
           chromosome 1 BAC T12I7 genomic sequence, complete
           sequence.
          Length = 491

 Score =  115 bits (287), Expect = 1e-24
 Identities = 55/141 (39%), Positives = 95/141 (67%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   + ++ +C+A T +++  +  E  +    +   ++  +  +L +FALLG
Sbjct: 352 KMGGAKRLWGAVNIILAVCLAMTVLVTKKA-EEHRRIAGPMALPTDGIRAGALTLFALLG 410

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPLAIT+S+PF++ + +++ +G GQ L++GVLN+AIV+PQM++S G GP DALFG GN+P
Sbjct: 411 IPLAITFSIPFALASIISSSSGAGQRLSLGVLNMAIVIPQMIVSFGVGPIDALFGDGNLP 470

Query: 463 AFALASIFALGAGVIATLKLP 401
            F + +I A  + ++A   LP
Sbjct: 471 GFVVGAIAAAVSSIVAFTVLP 491



>gb:AJ604565_1811879 Arabidopsis thaliana mRNA for sucrose
           transporter (suc6 gene), ecotype C24.
          Length = 492

 Score =  113 bits (283), Expect = 4e-24
 Identities = 57/141 (40%), Positives = 92/141 (65%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLG 644
           +M GA+ +W   + ++ +C+A T +++  +  E  +    +   ++  +  +L +FA LG
Sbjct: 353 KMGGAKRLWGAVNIILAVCLAMTVLVTKKA-GEHRKIAGPMALPTDGIRAGALTLFAFLG 411

Query: 643 IPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIP 464
           IPL IT+S+PF +    ++ +G GQGL++GVLN+AIV+PQMV+S G GP DALFGGGN+P
Sbjct: 412 IPLVITFSIPFVLAFINSSSSGAGQGLSLGVLNMAIVIPQMVVSFGVGPIDALFGGGNLP 471

Query: 463 AFALASIFALGAGVIATLKLP 401
            F + +I A  + V+A   LP
Sbjct: 472 GFVVGAITAAISSVVAFSVLP 492



>pir|S52377|S52377 sucrose transport protein SUC1 - common
           plantain>gb:PMSUC1_1700803 P.major mRNA for
           sucrose-proton symporter.
          Length = 503

 Score =  113 bits (282), Expect = 5e-24
 Identities = 58/142 (40%), Positives = 93/142 (65%), Gaps = 5/142 (3%)
 Frame = -1

Query: 811 ARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQ-HVIGASESTKVASLIVFALLGIPL 635
           A+  W   + ++ + +AGT  +SY + +    G     +  S   K ++L +FA+LGIPL
Sbjct: 344 AKTWWLGVNIVLAVGLAGTVWVSYHAKSVRQLGASGEALPPSFEVKASALAIFAILGIPL 403

Query: 634 AITYSVPFSVTADL----TADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNI 467
           A+T+SVPF++ A      T   G GQGL++GV+NL+IV+PQ+++SL +GP D  FGGGN+
Sbjct: 404 AVTFSVPFALAAIYCSRNTNTGGAGQGLSLGVMNLSIVIPQIIVSLSSGPLDKAFGGGNL 463

Query: 466 PAFALASIFALGAGVIATLKLP 401
           PAF + ++ A+ +GV+A + LP
Sbjct: 464 PAFIMGAVGAVFSGVLAFILLP 485



>gb:AB025006_1516087 Cicer arietinum mRNA for sucrose transport
           protein, partial cds.
          Length = 78

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 42/69 (60%), Positives = 55/69 (79%)
 Frame = -1

Query: 580 GGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFALASIFALGAGVIATLKLP 401
           G GQGL++GVLNLAIVVPQ+V+SLG+GPWD +FGGGN PAFA+A++ AL +G++A L +P
Sbjct: 8   GLGQGLSMGVLNLAIVVPQIVVSLGSGPWDQIFGGGNSPAFAVAAVAALMSGLLALLAIP 67

Query: 400 TLSRNAFRS 374
                  RS
Sbjct: 68  RTGTQKPRS 76



>gb:AC074025_1541169 Arabidopsis thaliana chromosome 1 BAC F28G11
           genomic sequence, complete sequence.
          Length = 77

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 37/77 (48%), Positives = 58/77 (75%)
 Frame = -1

Query: 631 ITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGNIPAFAL 452
           IT+S+PF++ + +++ +G GQ L++GVLN+AIV+PQM++S G GP DALFG GN+P F +
Sbjct: 1   ITFSIPFALASIISSSSGAGQRLSLGVLNMAIVIPQMIVSFGVGPIDALFGDGNLPGFVV 60

Query: 451 ASIFALGAGVIATLKLP 401
            +I A  + ++A   LP
Sbjct: 61  GAIAAAVSSIVAFTVLP 77



>pir|A86234|A86234 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890000 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F21M12_1677873 Sequence of BAC F21M12 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 474

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 41/146 (28%), Positives = 68/146 (46%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S+ ++ +C  G  + S+V+ +    G +       S   A++++
Sbjct: 357 MEKLCRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQ---PPASIVFAAVLI 413

Query: 658 FALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           F +LGIPLA+                                    ++S+G+GPWD LFG
Sbjct: 414 FTILGIPLAV------------------------------------IVSVGSGPWDQLFG 437

Query: 478 GGNIPAFALASIFALGAGVIATLKLP 401
           GGN PA A+ +      G++A L LP
Sbjct: 438 GGNSPALAVGAATGFIGGIVAILALP 463



>gb:AX172633_1463038 Sequence 123 from Patent WO0144476.
          Length = 70

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 5/64 (7%)
 Frame = -1

Query: 547 NLAIVVPQMVISLGAGPWDALFGGGNIPAFALASIFALGAGVIATLKLPT-----LSRNA 383
           NLA+V PQMV+S+G+GPWD LFGGGN+PAF   ++ A   G+ A L LP       +RN 
Sbjct: 1   NLAVVAPQMVVSVGSGPWDELFGGGNMPAFLFGAVAAFIGGIAAVLLLPRPPPDFTTRNR 60

Query: 382 FRST 371
            R T
Sbjct: 61  LRRT 64



>gb:LESUT1_1684648 L.esculentum SUT1 mRNA for sucrose transporter.
          Length = 429

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 25/75 (33%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQG---VQHVIGASESTKVASLIVFALLG 644
           GA+ +W + +F++ +C+A T +++ ++  E S+G      ++G +   K+ +L++FA LG
Sbjct: 357 GAKRLWGILNFVLAICLAMTILVTKMA--EKSRGHDAAGTLMGPTPGVKIGALLLFAALG 414

Query: 643 IPLAITYSVPFSVTA 599
           IPLA+T+S+PF++ +
Sbjct: 415 IPLAVTFSIPFALAS 429



>pir|S48788|S48788 sucrose transport protein - tomato (fragment)
          Length = 428

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 51/73 (69%), Gaps = 3/73 (4%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQG---VQHVIGASESTKVASLIVFALLG 644
           GA+ +W + +F++ +C+A T +++ ++  E S+G      ++G +   K+ +L++FA LG
Sbjct: 357 GAKRLWGILNFVLAICLAMTILVTKMA--EKSRGHDAAGTLMGPTPGVKIGALLLFAALG 414

Query: 643 IPLAITYSVPFSV 605
           IPLA+T+S+PF++
Sbjct: 415 IPLAVTFSIPFAL 427



>gb:AC117076_1207860 Dictyostelium discoideum chromosome 2 map
           3323568-3470138 strain AX4, complete sequence.
          Length = 754

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 28/61 (45%), Positives = 39/61 (63%)
 Frame = -1

Query: 682 TKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGA 503
           +K+ SL++ A  GIP AI   +PFS+   +  +     GL IG LN+ +VVPQMV+SLG 
Sbjct: 540 SKIGSLLLIASTGIPWAIVMILPFSIVG-MGVEDNESSGLNIGTLNIFVVVPQMVVSLGI 598

Query: 502 G 500
           G
Sbjct: 599 G 599



>gb:AY646366_1619851 Malus xiaojinensis sucrose transporter (Sut1)
           gene, partial cds.
          Length = 90

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 26/70 (37%), Positives = 41/70 (58%)
 Frame = -1

Query: 838 IDPLCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIV 659
           ++ LC+  GA  VW +S  ++ +C     VI++V+    S GV       +   +A+L+V
Sbjct: 24  MEKLCRKWGAGFVWGISSILMTLCFFAMLVITFVN---KSIGVGGHDLPPDGIVIAALVV 80

Query: 658 FALLGIPLAI 629
           FA+LGIPLAI
Sbjct: 81  FAVLGIPLAI 90



>gb:CR555306_106926 Azoarcus sp. EbN1 complete genome.
          Length = 321

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 44/147 (29%), Positives = 61/147 (41%), Gaps = 6/147 (4%)
 Frame = -1

Query: 817 IGARLVWAVSHFMVLMCMAGTTVISYVSLNES---SQGVQHVIGASESTKVASLIVFALL 647
           +G   V A + F+    +AG  V+  V         QG    +GA   T +A   V A L
Sbjct: 28  LGPEYVLAQAAFVFTYAIAGLGVVLVVGQCGQIPLGQGALLGLGAYAETLLALHGVPAPL 87

Query: 646 GIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGG-- 473
            +PLAI         A L A   GG   A+  L  A++V + ++      W++L GG   
Sbjct: 88  SLPLAIVLGAAGGWFASLPAQRLGGLYFAMSTLAFALIVEEALVR-----WESLTGGAAG 142

Query: 472 -NIPAFALASIFALGAGVIATLKLPTL 395
             +P   L S  A  A   ATL L  L
Sbjct: 143 LAVPTMTLGSWSADTAAAQATLSLVAL 169



>pir|A40678|A40678 T-cell adhesion receptor CD2 homolog - African
           swine fever virus>gb:ASU18466_2281032 African swine
           fever virus, complete genome.>gb:ASVEP402R_2281179
           African swine fever virus cd2 homologue protein (EP402R)
           gene, complete cds.
          Length = 402

 Score = 23.9 bits (50), Expect(6) = 0.014
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P+ KPCPPP
Sbjct: 299 PLPKPCPPP 307



 Score = 22.3 bits (46), Expect(6) = 0.014
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 347 PPPKPCPPP 355



 Score = 22.3 bits (46), Expect(6) = 0.014
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 317 PPPKPCPPP 325



 Score = 22.3 bits (46), Expect(6) = 0.014
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 311 PPPKPCPPP 319



 Score = 22.3 bits (46), Expect(6) = 0.014
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 305 PPPKPCPPP 313



 Score = 21.2 bits (43), Expect(6) = 0.014
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 555 PMAKPCPPPAS 587
           P +KPCP P S
Sbjct: 359 PPSKPCPSPES 369



>gb:AX172631_1463037 Sequence 121 from Patent WO0144476.
          Length = 53

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 21/47 (44%), Positives = 26/47 (55%), Gaps = 5/47 (10%)
 Frame = -1

Query: 496 WDALFGGGNIPAFALASIFALGAGVIATLKLPT-----LSRNAFRST 371
           WD LFGGGN+PAF   ++ A   G+ A L LP       +RN  R T
Sbjct: 1   WDELFGGGNMPAFLFGAVAAFIGGIAAVLLLPRPPPDFTTRNRLRRT 47



>gb:AF050111_2185796 African swine fever virus c-type lectin protein
           (8CR) and T-lymphocyte surface antigen CD2 homolog (8DR)
           genes, complete cds.
          Length = 406

 Score = 22.3 bits (46), Expect(6) = 0.023
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 357 PPPKPCPPP 365



 Score = 22.3 bits (46), Expect(6) = 0.023
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 351 PPPKPCPPP 359



 Score = 22.3 bits (46), Expect(6) = 0.023
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 345 PPPKPCPPP 353



 Score = 22.3 bits (46), Expect(6) = 0.023
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 339 PPPKPCPPP 347



 Score = 22.3 bits (46), Expect(6) = 0.023
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P  KPCPPP
Sbjct: 327 PPPKPCPPP 335



 Score = 21.9 bits (45), Expect(6) = 0.023
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = +3

Query: 555 PMAKPCPPP 581
           P+  PCPPP
Sbjct: 321 PLPNPCPPP 329



>gb:AF439321_1799968 Vitis vinifera sucrose transporter gene,
           complete cds.
          Length = 445

 Score = 40.8 bits (94), Expect = 0.032
 Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 3/76 (3%)
 Frame = -1

Query: 838 IDPLCQMIGA-RLVWAVSHFMVLMCMAGTTVISYV--SLNESSQGVQHVIGASESTKVAS 668
           I+P  +++G  + VW + +F++ +C+  T  ++ +  S +E++      +    + K+ +
Sbjct: 352 IEPAARLMGGVKRVWGIGNFILAICLGLTVAVTKMQSSRHEAAAAEGRSLMLPANVKIFA 411

Query: 667 LIVFALLGIPLAITYS 620
           L +FALLGIP A++ S
Sbjct: 412 LTIFALLGIPQAVSPS 427



>gb:AF309805_1785023 Pneumocystis carinii f. sp. carinii glutathione
           synthetase Gsh1 (gsh1) gene, partial cds; putative
           a-factor pheromone receptor Ste3 (ste3) gene, complete
           cds, alternatively spliced; and Ydr124wp-like protein,
           helix-loop-helix DNA binding protein, Yer049wp-like
           protein, protein kinase Ste20 (ste20), putative sucrose
           carrier Sca1 (sca1), putative Na+/H+ exchanger Nhx1
           (nhx1), putative 26S protease regulatory subunit 4
           (mts2), hypothetical protein, glycyl tRNA synthetase,
           and coiled-coil protein genes, complete cds.
          Length = 566

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 28/112 (25%), Positives = 47/112 (41%), Gaps = 2/112 (1%)
 Frame = -1

Query: 829 LCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFAL 650
           + Q I  + +W   HF+  +CM  T ++  ++                     + I+ AL
Sbjct: 417 ILQNINIQFLWTFGHFIFTLCMLSTILVKSIT--------------------QATIIIAL 456

Query: 649 LGIPLAITYSVPFSVTADLTADAG--GGQGLAIGVLNLAIVVPQMVISLGAG 500
            G+  AIT   PFS+ A   +        G  +GV N+ I VPQ++  +  G
Sbjct: 457 CGLSWAITLWAPFSLIAIQLSSNNQLHRSGTILGVHNIFITVPQVLSIIMVG 508



>gb:AL935257_551496 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 6/11.
          Length = 448

 Score = 39.7 bits (91), Expect = 0.072
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 1/90 (1%)
 Frame = -1

Query: 673 ASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPW 494
           A ++ F L+G+  A   + P ++  +  A +G   G  +G+ N +I +PQ+V SL +   
Sbjct: 356 ALVVSFILVGMAWAAMNTYPLTMVTN--ALSGEHMGTYLGLFNGSICLPQIVASLLSFAL 413

Query: 493 DALFGGGNIPAFALASI-FALGAGVIATLK 407
             LFG      F  A I  A+GAG +  +K
Sbjct: 414 YPLFGNSQANMFIFAGIVLAVGAGTVGLIK 443



>gb:AB049419_1196089 Physarum polycephalum Glom mRNA for
           histone-like protein, complete cds.
          Length = 362

 Score = 37.4 bits (85), Expect = 0.36
 Identities = 28/86 (32%), Positives = 36/86 (41%)
 Frame = +3

Query: 417 AMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPPASAVK 596
           A+TPA  A     A  G  PPP K S  P P+       T+   + P AK  PPP     
Sbjct: 41  AVTPAKKAPPPPPARKGTPPPPAKKSTPPPPTGKKPAQNTVV-AKKPAAKTPPPPVKKPS 99

Query: 597 SAVTEKGTL*VIARGMPRRAKTINEA 674
                KGT+ V A+    + K   +A
Sbjct: 100 PPQGSKGTVVVKAQQQAAKEKAKEKA 125



>gb:SCO939105_173993 Streptomyces coelicolor A3(2) complete genome;
           segment 2/29.
          Length = 420

 Score = 37.0 bits (84), Expect = 0.46
 Identities = 34/105 (32%), Positives = 48/105 (45%)
 Frame = -1

Query: 715 GVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAI 536
           G+  ++ +     V  L+  AL G    I        TA       G QG AIG+  LA+
Sbjct: 89  GLPALVQSLSDHLVPILVTTALRGAGFGIV--TVCGATAAAALAPRGRQGAAIGLYGLAV 146

Query: 535 VVPQMVISLGAGPWDALFGGGNIPAFALASIFALGAGVIATLKLP 401
            +PQ++++  A PW  L G      FAL +I A   GV+  L LP
Sbjct: 147 ALPQVILT-PAAPW--LMG-----TFALPAIVA--CGVLPVLALP 181



>gb:BA000030_703484 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 421

 Score = 36.2 bits (82), Expect = 0.79
 Identities = 25/96 (26%), Positives = 46/96 (47%)
 Frame = -1

Query: 694 ASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVI 515
           A+  T   +++  A+LG+   +  SV F++  D+   A   +G  +GV+N+A  +PQ+  
Sbjct: 324 AAWQTWPGAVVAAAVLGVGFGVFASVDFALMTDVLPKALD-RGKDLGVINVANALPQVAA 382

Query: 514 SLGAGPWDALFGGGNIPAFALASIFALGAGVIATLK 407
              A P     GG  +     A I   GA ++  ++
Sbjct: 383 PALAAPIVTYLGGYRVLYLVAAVIGLAGAVLVGRIR 418



>gb:AC115684_1206034 Dictyostelium discoideum chromosome 2 map
           3108975-3191114 strain AX4, complete sequence.
          Length = 1723

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 25/103 (24%), Positives = 38/103 (36%)
 Frame = +2

Query: 530 YNDGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRPNNML 709
           YN+    N+Y    +T S +S    N       ++  N   + NN   N +     NN  
Sbjct: 141 YNNSN-NNNYNNNNNTHSNNSNNNNNNNNSNYWNNNNNNNNNNNNNNNNNNNNNNNNNNN 199

Query: 710 NSL*RFIKRNIANNSSPCHAHKHHKMAHSPNQSSTNHLAQRIN 838
           N+       N  NN++  H H HH+    P     N +    N
Sbjct: 200 NNS----NNNNNNNNNNNHHHHHHQQQSQPTSPYNNPIQHNPN 238



>gb:AY078067_587873 Saccharopolyspora erythraea red pigment gene
           cluster, partial sequence.
          Length = 409

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 32/104 (30%), Positives = 51/104 (49%), Gaps = 2/104 (1%)
 Frame = -1

Query: 742 YVSLNESSQGVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGL 563
           YV L+ +   V  ++ A   T  A+L+   LLG    I ++V  ++   +   A   +  
Sbjct: 296 YVLLSCALMAVAALLLAVWPTWAAALMAAPLLGAGFGIYWAVALALLTQVLP-AAANRAK 354

Query: 562 AIGVLNLAIVVPQMVISLGAGPWDALFGG--GNIPAFALASIFA 437
            +GV+N+A  +PQ+V    A P  A  GG  G   A ALA++ A
Sbjct: 355 DLGVVNIANSLPQVVAPALATPILAHLGGYAGLFTASALATVVA 398



>gb:SCO939121_178564 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 332

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 10/104 (9%)
 Frame = +3

Query: 411 SVAMTPAPSANIEARANAGM-FPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPPAS 587
           SV    AP+ +I+A     + +P   + S GP P      G+   R R+P+A       +
Sbjct: 209 SVFGAAAPAVDIDAEPQPVLRYPTGTEQSPGPLPGAAAPPGSVPGRARSPLASLLGRTRA 268

Query: 588 AVKSAVTEK---------GTL*VIARGMPRRAKTINEATLVDSL 692
           AV SA+ E            L +        A T+ EA L+D++
Sbjct: 269 AVLSAIAENPGCSTKELAALLGIAPPSASEHATTLREARLIDTV 312



>gb:AF272150_1257594 Dictyostelium discoideum deliriumA (dlrA) gene,
           complete cds.
          Length = 817

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 27/100 (27%), Positives = 43/100 (43%), Gaps = 4/100 (4%)
 Frame = +2

Query: 533 NDGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRPNNMLN 712
           N+    N+   + S ++ +S    N   +  +++  N   S NN   N +  +  NN+ N
Sbjct: 51  NNNNNNNNNSNSNSNSNSNSNSNSNSNNNNNNNNNNNNNNSNNNNNNNSNNNSNNNNINN 110

Query: 713 SL*RFIKRNIANNSSPC-HAHKHHKMAHSPN---QSSTNH 820
           S       N  NN+ P  H  +HH   H  N   QSS N+
Sbjct: 111 S----NNNNSNNNNHPINHMQQHHIHQHLQNYHFQSSNNN 146



>gb:BC081922_2108164 Rattus norvegicus cDNA clone MGC:93898
           IMAGE:7112701, complete cds.
          Length = 658

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 28/101 (27%), Positives = 39/101 (38%)
 Frame = +3

Query: 402 GSLSVAMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPP 581
           G L  A+ P P + +   A A   P P      PAP    +  TT A L  PM +P    
Sbjct: 475 GHLESALAPTPPSTLSPTAAAEQAPAPT-----PAPVTSQVPATTTAELSPPMPQP---- 525

Query: 582 ASAVKSAVTEKGTL*VIARGMPRRAKTINEATLVDSLAPIT 704
                   T +      ARG+ R   T  +     ++AP+T
Sbjct: 526 -----KIRTRRNKGPRAARGVIREEGTSGDGPREPNMAPVT 561



>gb:BX950851_838806 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 501

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 5/112 (4%)
 Frame = -1

Query: 805 LVWAVSHFMVLMCMAGTTVISYVSLNES--SQGVQHVIGAS-ESTKVASLIVFALLGIPL 635
           ++ AV+  + L  M G   ++ V++ E    +G+ +  G S + T   S+ V +  G+P+
Sbjct: 388 IIVAVALALSLGTMVGWKRVA-VTIGEKIGKKGMTYAQGVSAQVTAALSIGVASYTGMPV 446

Query: 634 AITYSVPFSVTADLTADAGGGQGLAIGVLNLA--IVVPQMVISLGAGPWDAL 485
           + T+ +  +V   + AD GG QG  I  + LA  + +P  ++  G   W AL
Sbjct: 447 STTHVLSSAVAGTMIADGGGVQGKTIRSILLAWVLTLPVSMLMSGTLYWLAL 498



>gb:AL935262_553045 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 11/11.
          Length = 461

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 20/73 (27%), Positives = 40/73 (54%)
 Frame = -1

Query: 721 SQGVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNL 542
           +  +  +I A+   +  +LI FAL GI      ++P+++    T+  G   G  +G+ N+
Sbjct: 355 ADAISIIIVATTHNQWVALIAFALYGIGNFTINTLPYTMLT--TSLDGRNNGSYLGLFNI 412

Query: 541 AIVVPQMVISLGA 503
           A+ +PQ++ SL +
Sbjct: 413 AVCLPQIIGSLAS 425



>pir|E72453|E72453 hypothetical protein APE2273 - Aeropyrum pernix
           (strain K1)>gb:BA000002_653029 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 399

 Score = 34.7 bits (78), Expect = 2.3
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 10/141 (7%)
 Frame = -1

Query: 760 GTTVI---SYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLT 590
           GTT I   S   +N SSQG   ++  S +  + +  +   +         V +S    L 
Sbjct: 170 GTTEIFGGSATPVNTSSQGA--ILSLSSTVTIMTAFLAGFIAALSPCVLPVLYSYITGLG 227

Query: 589 ADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGG-GNI------PAFALASIFALG 431
             +GG   +       AI++  M+ +LGA    ALF G G++           ASI  + 
Sbjct: 228 VSSGGKPPVH------AIILAPMLAALGAASIGALFLGLGSVLEPFRQALLFAASIVLVS 281

Query: 430 AGVIATLKLPTLSRNAFRSTG 368
           AG++  + +PT +    RS G
Sbjct: 282 AGILELMGIPTYTAIRIRSGG 302



>gb:AE014185_937656 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014830_1228390 Plasmodium falciparum 3D7
            chromosome 10 section 2 of 7 of the complete sequence.
          Length = 3853

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 4/83 (4%)
 Frame = +2

Query: 530  YNDGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQ---RGNFS*FTRPN 700
            Y D  VEN+    LS  +I + +     +      K    KSKN Q    G  +  T  N
Sbjct: 3662 YQDKNVENTRKNALSEGNIYANVDNGKLQKVDGRKKRRYHKSKNTQSINTGELTTLTNSN 3721

Query: 701  NM-LNSL*RFIKRNIANNSSPCH 766
            ++ +N++ +F K NI++N +  H
Sbjct: 3722 SLSINNMDKFNKENISSNMNNNH 3744



>gb:SCO939131_180975 Streptomyces coelicolor A3(2) complete genome;
           segment 28/29.
          Length = 444

 Score = 34.3 bits (77), Expect = 3.0
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 2/103 (1%)
 Frame = -1

Query: 802 VWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGIPLAITY 623
           VWAV     L  +AGT V           GV+ V+          +++ + L   +A+ +
Sbjct: 223 VWAVYKLPALPPLAGTAV--------RRAGVREVVAGFRYIARHKVLLLSFLADIVAMVF 274

Query: 622 SVPFSVTADLTAD--AGGGQGLAIGVLNLAIVVPQMVISLGAG 500
            +P ++   L A+  A  G+GLA+G+L  AI +  +   L +G
Sbjct: 275 GMPRALFPQLAAETYAPYGEGLALGLLFAAIPIGAVAGGLFSG 317



>gb:AP005816_1858346 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:B1168A08.>gb:AP006049_1860464 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0016N23.
          Length = 324

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
 Frame = +3

Query: 366 RPVDLNAFLERVGSLSVAMTPAPSANIEARANAGMFPPPNKAS-HGPAPSEITICGTTMA 542
           RP+ L   L      ++   P  SA   A   A   PPP +     P   E+ +C  + A
Sbjct: 165 RPLRLRLSLSGTTPAALGPLPPLSAARSASTLAAHRPPPGELCLRRPLLGELRLCRRSPA 224

Query: 543 RLRTPMAKPCPPPASA 590
             +TP A+  PPP+ A
Sbjct: 225 LPQTPAARGAPPPSPA 240



>gb:PFMAL13_1191570 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1049

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 28/104 (26%), Positives = 50/104 (48%)
 Frame = +2

Query: 518  NHLWYNDGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRP 697
            N+++  +  V+N     + T+SI+    +    D V D+K N + + N+ +      T P
Sbjct: 737  NNIYTFESNVKNISSTNMITSSINK--LKKWYLDKVKDNKKNVQYNNNDVKK-----TNP 789

Query: 698  NNMLNSL*RFIKRNIANNSSPCHAHKHHKMAHSPNQSSTNHLAQ 829
            N +  +L + IK NI       H   H  + +SPN ++ N+L Q
Sbjct: 790  N-ITKNLNKEIKENINT-----HLKNHKIINNSPNYNNNNYLFQ 827



>gb:BA000030_703558 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 363

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 21/69 (30%), Positives = 28/69 (40%)
 Frame = +3

Query: 402 GSLSVAMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPP 581
           G+L+VA+ P           AG  PP    S  P+    +    T     TP   P PPP
Sbjct: 292 GTLTVAVDPEEEGRGADTVGAGSPPPGGAPSGSPSTGTPSGPSPTATPTVTPGGTPTPPP 351

Query: 582 ASAVKSAVT 608
            SA  ++ T
Sbjct: 352 DSAASASAT 360



>gb:AE017241_414529 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 15 of 16 of the complete
           genome.>gb:AE016958_1057933 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 448

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 3/64 (4%)
 Frame = +3

Query: 408 LSVAMTPAPSANIEARANAGMFPPPNK---ASHGPAPSEITICGTTMARLRTPMAKPCPP 578
           +S+A+   P+AN+    N  +   P +   A+  PAP ++       A    P A P PP
Sbjct: 321 VSLAIAIRPTANVRPSPNQNVVVAPTRPAPAAPAPAPVQVAPVPVPEAPAPAPAAPPPPP 380

Query: 579 PASA 590
           PA A
Sbjct: 381 PAVA 384



>gb:SME591782_184232 Sinorhizobium meliloti 1021 complete
           chromosome; segment 1/12.
          Length = 421

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 36/145 (24%), Positives = 61/145 (42%), Gaps = 9/145 (6%)
 Frame = -1

Query: 811 ARLVWAVSHFMVLMCM---AGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFALLGI 641
           A  +WA++ F+ ++ +   A T +  + S      G + V+           ++    G+
Sbjct: 171 AASMWAMASFIAVLTLPTLAATHIGRHASRPRGRPGFRAVLSNRPLVGGIGFLILYQCGV 230

Query: 640 PLAITYSVPFSVTADL-TADAG---GGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGG 473
            L  +   PF V      A  G   G  G  +G++  A+    +V   G+G   A F   
Sbjct: 231 RLGTSMLSPFMVDIGFPVATIGWVRGAGGAVVGLIG-ALAGAALVQRFGSGRTLAAFAAV 289

Query: 472 NIPAFALASIFALG--AGVIATLKL 404
           N+ AFA  ++FA G   G IA + L
Sbjct: 290 NLLAFAGLALFAFGIWQGDIAAIVL 314



>gb:SCO939107_174689 Streptomyces coelicolor A3(2) complete genome;
           segment 4/29.
          Length = 537

 Score = 33.9 bits (76), Expect = 3.9
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 4/75 (5%)
 Frame = -1

Query: 613 FSVTADLTADAGGGQGLAIGVL-NLAIVVPQMV---ISLGAGPWDALFGGGNIPAFALAS 446
           F+V   +    G   GL +G L  L  ++P +V   + +G GPW AL       A     
Sbjct: 61  FAVFGWVLRGRGWKAGLGLGYLFGLGFLLPLLVWTGVEVGPGPWLAL------AAIEALF 114

Query: 445 IFALGAGVIATLKLP 401
           + A+GAGV A  KLP
Sbjct: 115 VAAVGAGVAAVSKLP 129



>gb:AP003824_1833835 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1343_B12.
          Length = 128

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 2/61 (3%)
 Frame = +3

Query: 411 SVAMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARL--RTPMAKPCPPPA 584
           S A  P P A   AR      PPP  +S  P         T  ARL  RTP A PC PPA
Sbjct: 62  SSAAHPPPPAAAAARLLRHT-PPPLASSAAPRRRSSPPPHTAAARLLRRTPAAAPCRPPA 120

Query: 585 S 587
           S
Sbjct: 121 S 121



>gb:AP003248_1826232 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0431H09.
          Length = 225

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 18/44 (40%), Positives = 19/44 (43%)
 Frame = +3

Query: 450 ARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPP 581
           AR  AG   PP   S  P P+  T   T  A    P   PCPPP
Sbjct: 110 AREQAGAPSPPESTSTAPGPAS-TSAATAAAPNPAPPPPPCPPP 152



>gb:AB091780_1525067 Solanum tuberosum StMEK1 mRNA for
           mitogen-activated protein kinase kinase, complete cds.
          Length = 374

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +3

Query: 426 PAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCP-PPASAVKSA 602
           P P+AN  + A A   PPP+ A     P   T     + +    +A P P PP SA  S+
Sbjct: 7   PPPAANSTSSAAASSMPPPSSAGQRSRPRRRTDLTLPLPQRDVALAVPLPLPPTSAPSSS 66



>gb:AF067611_1238006 Caenorhabditis elegans cosmid C45G7, complete
            sequence.
          Length = 2302

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = -3

Query: 491  RLIWRREHTRVCPGLYIRTWGWCHCYTQTAYSLEKRV*INRPSFLITDEPRKLAIHNGPC 312
            R I++R +TR+ P L+  T  W H    T   LEK   +  P++ I   P+K      P 
Sbjct: 1781 RGIYQRSYTRLLPYLHKETPEW-HSQYWTLQDLEKSDDVESPNYPIQPNPQKFLFDTEPA 1839

Query: 311  TPTINSF 291
               I +F
Sbjct: 1840 ELLITAF 1846



>gb:AC116977_1207001 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 633

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 20/101 (19%), Positives = 42/101 (41%)
 Frame = +2

Query: 515 DNHLWYNDGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTR 694
           +N++  N+    N+     +    ++ +  NG     +++  N   + NN   N +    
Sbjct: 456 NNNMNNNNMNSNNNNNMNNNNMDNNNNMNNNGNNMNNNNNMNNMNNNMNNNNNNMNNMNN 515

Query: 695 PNNMLNSL*RFIKRNIANNSSPCHAHKHHKMAHSPNQSSTN 817
            NN +N+    I  N  NNS+  + +     ++S N +  N
Sbjct: 516 NNNNMNNTNNNINNNNMNNSNTNNNNNSSNSSNSNNNNGAN 556



>gb:BA000040_731449 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 352

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 26/167 (15%)
 Frame = -1

Query: 829 LCQMIGARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTKVASLIVFA- 653
           LC   G   +  +S  + ++   G ++      N +   V  +IGA+   ++AS I F  
Sbjct: 124 LCVSFGLSRLLGLSTRLSILIACGNSICG----NSAIAAVAPIIGANND-EIASSISFTA 178

Query: 652 ------LLGIPLAI-----------------TYSVPFSVTADLTADAGGGQ-GLAIGVLN 545
                 +LG+PL I                  Y+VP  + A + A     Q G  + ++ 
Sbjct: 179 ILGVMMVLGLPLLIPLLQLSATQYGILAGLTVYAVPQVLAATVPAGLVSTQIGTLVKLMR 238

Query: 544 LAIVVPQMV-ISLGAGPWDALFGGGNIPAFALASIFALGAGVIATLK 407
           + ++ P +V +SL A  W +     N+  F L   F LG   +ATL+
Sbjct: 239 VLMLGPVVVGLSLVASRWQSDAKKTNVGFFRLVPWFILGFLALATLR 285



>gb:AE008759_243064 Salmonella typhimurium LT2, section 63 of 220 of
           the complete genome.>gb:AE006468_1000146 Salmonella
           typhimurium LT2, complete genome.
          Length = 448

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 14/95 (14%)
 Frame = -1

Query: 643 IPLAITYSVPFSVT---ADLTADAGG--GQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           IPLAI+    F V    A+++A  G   GQ    G+   AI+V  +  ++G  P    F 
Sbjct: 303 IPLAISAQEKFGVQSTIANISASFGSSMGQNGCAGIYP-AIMVAMIAPTIGIDPLSLHFL 361

Query: 478 GGNIPAFALASIFALGAG---------VIATLKLP 401
              +PA AL SI   G G         V++TL  P
Sbjct: 362 AAMLPAIALGSIGVAGVGGGGTFAALIVLSTLNFP 396



>gb:CP000026_76305 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 448

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 14/95 (14%)
 Frame = -1

Query: 643 IPLAITYSVPFSVT---ADLTADAGG--GQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           IPLAI+    F V    A+++A  G   GQ    G+   AI+V  +  ++G  P    F 
Sbjct: 303 IPLAISAQEKFGVQSTIANISASFGSSMGQNGCAGIYP-AIMVAMIAPTIGIDPLSLHFL 361

Query: 478 GGNIPAFALASIFALGAG---------VIATLKLP 401
              +PA AL SI   G G         V++TL  P
Sbjct: 362 AAMLPAIALGSIGVAGVGGGGTFAALIVLSTLNFP 396



>pir|T33135|T33135 hypothetical protein C45G7.5 - Caenorhabditis
           elegans
          Length = 986

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = -3

Query: 491 RLIWRREHTRVCPGLYIRTWGWCHCYTQTAYSLEKRV*INRPSFLITDEPRKLAIHNGPC 312
           R I++R +TR+ P L+  T  W H    T   LEK   +  P++ I   P+K      P 
Sbjct: 465 RGIYQRSYTRLLPYLHKETPEW-HSQYWTLQDLEKSDDVESPNYPIQPNPQKFLFDTEPA 523

Query: 311 TPTINSF 291
              I +F
Sbjct: 524 ELLITAF 530



>pir|AD0703|AD0703 probable transporter STY1755 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016838_345358 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 5 of 16 of
           the complete genome.>gb:AL627271_541939 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 7/20.>gb:AE014613_982690
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 448

 Score = 33.5 bits (75), Expect = 5.1
 Identities = 31/95 (32%), Positives = 43/95 (45%), Gaps = 14/95 (14%)
 Frame = -1

Query: 643 IPLAITYSVPFSVT---ADLTADAGG--GQGLAIGVLNLAIVVPQMVISLGAGPWDALFG 479
           IPLAI+    F V    A+++A  G   GQ    G+   AI+V  +  ++G  P    F 
Sbjct: 303 IPLAISAQEKFGVQSTIANISASFGSSMGQNGCAGIYP-AIMVAMIAPTIGIDPLSLHFL 361

Query: 478 GGNIPAFALASIFALGAG---------VIATLKLP 401
              +PA AL SI   G G         V++TL  P
Sbjct: 362 AAMLPAIALGSIGVAGVGGGGTFAALIVLSTLNFP 396



>gb:AP006162_1861143 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1331F11.>gb:AP006450_1861834 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1130E07.
          Length = 540

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 23/77 (29%), Positives = 34/77 (44%), Gaps = 9/77 (11%)
 Frame = +3

Query: 417 AMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRT--PMAKPCP----- 575
           A +PAP+ +     +    PPP+ +S  PAP    I  ++ +  RT  P   P P     
Sbjct: 371 ASSPAPTTSASPSTSPSTSPPPSPSSTPPAPRAPAISSSSGSSSRTSCPCTGPRPRSSAC 430

Query: 576 --PPASAVKSAVTEKGT 620
             PPA    S+ T + T
Sbjct: 431 SRPPAPTSGSSPTSEAT 447



>gb:CP000010_866673 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 299

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = -1

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           +G    +  SVP    A  +A  G G GL   +L  A++   +++ +   P DA+  G  
Sbjct: 26  VGAARPLVASVPAVAPARESAPGGMG-GLGRTILGAALLAHGVLLHMTIFPHDAMVFGF- 83

Query: 469 IPAFALASIFALGAGV 422
             AFAL+++F LGAG+
Sbjct: 84  --AFALSAMFWLGAGI 97



>gb:BX571965_792793 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 299

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = -1

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
           +G    +  SVP    A  +A  G G GL   +L  A++   +++ +   P DA+  G  
Sbjct: 26  VGAARPLVASVPAVAPARESAPGGMG-GLGRTILGAALLAHGVLLHMTIFPHDAMVFGF- 83

Query: 469 IPAFALASIFALGAGV 422
             AFAL+++F LGAG+
Sbjct: 84  --AFALSAMFWLGAGI 97



>gb:BX248335_757657 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 2/14.
          Length = 472

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 18/109 (16%)
 Frame = -1

Query: 715 GVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAI 536
           G+ H+    +   +A++I  ALL   L +TY V   V A L A AG     A+  L + I
Sbjct: 122 GIAHI----QRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAGIAVASALAGLLITI 177

Query: 535 VVPQMVISLGA------------------GPWDALFGGGNIPAFALASI 443
             P+  I+L                    GP   L G   + A++L ++
Sbjct: 178 RSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWSLIAL 226



>gb:AP006627_566062 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 287

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 29/141 (20%), Positives = 59/141 (41%), Gaps = 5/141 (3%)
 Frame = -1

Query: 814 GARLVWAVSHFMVLMCMAGTTVISYVSLNESSQGVQHVIGASESTK-----VASLIVFAL 650
           G   +  VS  +    +   T++   S+N+    +  +  AS+  K     V + + F +
Sbjct: 144 GFNAIVVVSFLIGFFPIVSNTLMGLNSVNKQMDELFSLYNASKWQKMWRLRVPAALPFMM 203

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGGN 470
            G+ ++ T S+  ++  +  A  GGG+G     + +A +              A+ G G 
Sbjct: 204 AGLKISATLSIVGAIVGEYVAGVGGGKGGIGYAITVAAIQVNTSFIFALAICGAILGIGF 263

Query: 469 IPAFALASIFALGAGVIATLK 407
             A +L S   LG+   +++K
Sbjct: 264 YLAMSLLSKVVLGSWHESSIK 284



>gb:AE017340_457107 Idiomarina loihiensis L2TR, complete genome.
          Length = 175

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 13/46 (28%), Positives = 27/46 (58%)
 Frame = +3

Query: 480 PNKASHGPAPSEITICGTTMARLRTPMAKPCPPPASAVKSAVTEKG 617
           P K+++     +  + G T+ RL+  + +PCP P ++V+  + E+G
Sbjct: 12  PVKSANKKVAYDGVVPGKTLTRLQESLVEPCPDPEASVEFGIDEQG 57



>pir|H70836|H70836 hypothetical protein Rv0290 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_20296
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX842573_818332 Mycobacterium tuberculosis
           H37Rv complete genome; segment 2/13.
          Length = 472

 Score = 33.1 bits (74), Expect = 6.7
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 18/109 (16%)
 Frame = -1

Query: 715 GVQHVIGASESTKVASLIVFALLGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAI 536
           G+ H+    +   +A++I  ALL   L +TY V   V A L A AG     A+  L + I
Sbjct: 122 GIAHI----QRGALAAVIAVALLATGLTVTYRVATGVLAGLLAVAGIAVASALAGLLITI 177

Query: 535 VVPQMVISLGA------------------GPWDALFGGGNIPAFALASI 443
             P+  I+L                    GP   L G   + A++L ++
Sbjct: 178 RSPRSGIALSIAALVPIGAALALAVPGKFGPAQVLLGAAGVAAWSLIAL 226



>gb:RATNMDARA_2133150 Rattus norvegicus mRNA for N-methyl-D-aspartate
            receptor subunit (NMDAR2A).
          Length = 1464

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +3

Query: 90   YRHSVGRPKSLPFYNRSSISTNGSH-TKNCKEHLANILSLHVFHYMNCNVIIYSTPRTSF 266
            Y+HS+        Y RSS+ +  S+ +++ + H    +S HV  Y      +YSTPR   
Sbjct: 1387 YKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYSTPRVLN 1446

Query: 267  PCQN 278
             C N
Sbjct: 1447 SCSN 1450



>gb:AF001423_2050038 Rattus norvegicus N-methyl-D-aspartate receptor
            NMDAR2A subunit mRNA, complete cds.
          Length = 1464

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +3

Query: 90   YRHSVGRPKSLPFYNRSSISTNGSH-TKNCKEHLANILSLHVFHYMNCNVIIYSTPRTSF 266
            Y+HS+        Y RSS+ +  S+ +++ + H    +S HV  Y      +YSTPR   
Sbjct: 1387 YKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYSTPRVLN 1446

Query: 267  PCQN 278
             C N
Sbjct: 1447 SCSN 1450



>gb:CR380948_1649356 Candida glabrata strain CBS138 chromosome B
           complete sequence.
          Length = 988

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 23/89 (25%), Positives = 35/89 (39%)
 Frame = +2

Query: 551 NSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRPNNMLNSL*RFI 730
           N  G + S +S  S    N  R    +S+    + K  +          NN  N   RF 
Sbjct: 209 NVNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRF- 267

Query: 731 KRNIANNSSPCHAHKHHKMAHSPNQSSTN 817
            +  +  S+  HA  +H+  H PN +S N
Sbjct: 268 -KQTSQESTRAHASNNHQNVHIPNNNSNN 295



>gb:PFA929358_1393480 Plasmodium falciparum strain 3D7, chromosome
           9; segment 4/5.
          Length = 3178

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 3/80 (3%)
 Frame = +2

Query: 527 WYNDGEVENSYGQTLSTASISSQIC---RNGERDTVSDSKGNAEKSKNNQRGNFS*FTRP 697
           ++ND  +E  Y + +S+ S +  +C    N   +  +++  N   + NN   N +     
Sbjct: 656 FFNDDNIEMEY-KNISSLSYNKNVCDASTNYNDNINNNTNNNTSNNTNNNTNNNTSNNTS 714

Query: 698 NNMLNSL*RFIKRNIANNSS 757
           NN  N+   +   N +NN+S
Sbjct: 715 NNTSNNTNNYTNNNTSNNTS 734



>gb:DDI277590_1376938 Dictyostelium discoideum iplA gene for
           inositol 1,4,5-trisphosphate receptor-like protein
           (IplA), exons 1-4.
          Length = 3177

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 19/61 (31%), Positives = 31/61 (50%)
 Frame = +2

Query: 536 DGEVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRPNNMLNS 715
           D  ++ SYG +LS ++I  Q   N   +  S++  N+  + NN  GN S     NN  N+
Sbjct: 348 DNPLKQSYG-SLSNSNILLQNNNNNNNNNNSNNNNNSNNNSNNSNGNNSNGNNNNNNSNN 406

Query: 716 L 718
           +
Sbjct: 407 I 407



>gb:AF092449_1240263 Heterodera glycines mucin-like protein (svg-1)
           mRNA, complete cds.
          Length = 412

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 18/56 (32%), Positives = 25/56 (44%)
 Frame = +3

Query: 417 AMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPPA 584
           A TP PS  ++  A +   P P+     PAPS  T C +   + +TP       PA
Sbjct: 300 ATTPCPSLPVKTPAPSTTTPCPSLPVKTPAPSTTTPCPSLPVKTKTPAPTATKTPA 355



>gb:BX571875_789737 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 17/17.
          Length = 405

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = -1

Query: 619 VPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAGPWDALFGGG--NIPAFALAS 446
           V FS+   +T     G+ LAI VL     +PQ++ISL AG W   +     +I + AL +
Sbjct: 29  VQFSIVWYITLSTSSGEMLAISVL--CAFLPQVLISLFAGVWADTYNRKWLSIASDALIA 86

Query: 445 IFALGAGV 422
           +  LG  +
Sbjct: 87  LVTLGLAI 94



>gb:AP006618_558822 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 529

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 37/99 (37%), Positives = 44/99 (44%), Gaps = 2/99 (2%)
 Frame = +3

Query: 402 GSLSVAMTPAPSANIEAR-ANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCP- 575
           G L+ A T A +AN   R A   M PPP  A+ GPA       G T A L      P P 
Sbjct: 266 GELARAATAALAANTPHRSAPHRMAPPPPSATTGPAGGP----GVTPADL-----SPAPH 316

Query: 576 PPASAVKSAVTEKGTL*VIARGMPRRAKTINEATLVDSL 692
           P ASA     +E G       G PR A+ +  AT V +L
Sbjct: 317 PTASAQPRTPSEPGI--AGPAGPPRSARLLLIATTVAAL 353



>gb:AJ830893_533218 Photobacterium damselae subsp. damselae hutZ
           gene, hutX gene, hutW gene, tonB gene, exbB gene, exbD
           gene, hutB gene, hutC gene and hutD gene.
          Length = 345

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 32/156 (20%), Positives = 66/156 (42%), Gaps = 19/156 (12%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES----------SQGVQHVIGASESTKV 674
           Q +  R ++ +   ++L+ +  + VI  +S++ S          ++   H+       ++
Sbjct: 4   QRLSIRSLYPIGFGLLLLAIVSSIVIGPMSISYSDSIKALLPWHTELPNHISLVINQIRL 63

Query: 673 ASLIVFALLGIPLAITYSV-------PFSVTADLTADAGGGQGLAIGVLNLAIVVPQM-- 521
              ++  ++G  LAI  +V       P +  A +    G G G A+ ++  A +  Q   
Sbjct: 64  PRTLLCIMIGAILAICGAVMQGLFRNPLADPAIIGVTGGAGLGAALAIIVFAPIATQFPT 123

Query: 520 VISLGAGPWDALFGGGNIPAFALASIFALGAGVIAT 413
           +++LGA P  A  GG      +   ++ LG G   T
Sbjct: 124 ILNLGAIPLFAFIGG----VISTFFVYRLGTGTNGT 155



>gb:AE016946_364019 Bacteroides thetaiotaomicron VPI-5482, section
           21 of 21 of the complete genome.>gb:AE015928_990507
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 415

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 8/96 (8%)
 Frame = -1

Query: 796 AVSHFMVLM---CMAGTTVISYVSLNESSQ--GVQHVI---GASESTKVASLIVFALLGI 641
           AVS+F  LM   C+ G  ++  +      Q  GV  ++    A   +K  SLI F  +G 
Sbjct: 267 AVSYFWGLMTAGCLVGMILLKLIDSKRLLQVSGVLTIVLLLAALFGSKDVSLIAFPAIGF 326

Query: 640 PLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIV 533
            +++ YS+ FS+  +    A    G   G+L  AIV
Sbjct: 327 SISMMYSIVFSLALN---SASQHHGSFAGILCSAIV 359



>gb:AE015938_319971 Clostridium tetani E88, section 3 of 10 of the
           complete genome.>gb:AE015927_962760 Clostridium tetani
           E88, complete genome.
          Length = 584

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 27/97 (27%), Positives = 43/97 (44%)
 Frame = -1

Query: 520 VISLGAGPWDALFGGGNIPAFALASIFALGAGVIATLKLPTLSRNAFRSTGLHF**PMNQ 341
           VI +GAG      G G   A A A     GA VI   K+P +  N  RS G +     N 
Sbjct: 147 VIVVGAG------GAGMSAAVAAAE---KGAKVIVLEKMPMIGGNTIRSGGAY-----NA 192

Query: 340 ESLQSIMVRALPQSIHFFFSQFWQGNDVRGVEYIITL 230
             ++    + +  SI   ++Q ++G D +G   ++ +
Sbjct: 193 VDVERQKAQGIEDSIDKHYTQTYEGGDKKGESKLVKI 229



>gb:AE012358_281698 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 266 of 460 of the complete
           genome.>gb:AE008922_914980 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 492

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = -1

Query: 649 LGIPLAITYSVPFSVTADLTADAGGGQGLAIGVLNLAIVVPQMVISLGAG-PWDALFGGG 473
           +G   A   S+P+++ +D    A    G+ +G+ N  IV+PQ+V +   G       GG 
Sbjct: 406 VGFAWASILSLPYALLSDSVPAAK--MGVYMGIFNFFIVIPQLVAASALGFVLRVWLGGQ 463

Query: 472 NIPAFALASIFALGAGV 422
            I A A+  +  + AGV
Sbjct: 464 PIYALAIGGLSLIVAGV 480



>gb:PDA582082_157499 Photobacterium damselae subsp. piscicida hutZ
           gene, hutX gene, hutW gene, tonB gene, exbB gene, exbD
           gene, hutB gene, hutC gene and hutD gene.
          Length = 345

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 32/156 (20%), Positives = 66/156 (42%), Gaps = 19/156 (12%)
 Frame = -1

Query: 823 QMIGARLVWAVSHFMVLMCMAGTTVISYVSLNES----------SQGVQHVIGASESTKV 674
           Q +  R ++ +   ++L+ +  + VI  +S++ S          ++   H+       ++
Sbjct: 4   QRLSIRSLYPIGFGLLLLAIVSSIVIGPMSISYSDSIKALLPWHTELPNHISLVINQIRL 63

Query: 673 ASLIVFALLGIPLAITYSV-------PFSVTADLTADAGGGQGLAIGVLNLAIVVPQM-- 521
              ++  ++G  LAI  +V       P +  A +    G G G A+ ++  A +  Q   
Sbjct: 64  PRTLLCIMIGAILAICGAVMQGLFRNPLADPAIIGVTGGAGLGAALAIIVFAPIAAQFPT 123

Query: 520 VISLGAGPWDALFGGGNIPAFALASIFALGAGVIAT 413
           +++LGA P  A  GG      +   ++ LG G   T
Sbjct: 124 ILNLGAIPLFAFIGG----VISTFFVYRLGTGTNGT 155



>pir|T14004|T14004 trfA protein - slime mold (Dictyostelium
           discoideum)>gb:AB009080_1193152 Dictyostelium discoideum
           gene for TRFA, complete cds.
          Length = 1390

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 23/99 (23%), Positives = 45/99 (45%)
 Frame = +2

Query: 542 EVENSYGQTLSTASISSQICRNGERDTVSDSKGNAEKSKNNQRGNFS*FTRPNNMLNSL* 721
           ++ NS+    S +   + +  N     ++++  N   + NN   N +     NN  N+  
Sbjct: 638 DMHNSHHSQYSNSMSMNNMNNNNNNMNMNNNMNNNMNNMNNNNNNMNSMNNMNNNNNN-- 695

Query: 722 RFIKRNIANNSSPCHAHKHHKMAHSPNQSSTNHLAQRIN 838
             I  N++NN++  + H +H+M    NQ + N+    IN
Sbjct: 696 --INNNMSNNNN--NNHNNHQM----NQYNNNNNNSNIN 726



>pir|T35091|T35091 hypothetical protein SC4G6.31c - Streptomyces
           coelicolor>gb:SCO939111_175737 Streptomyces coelicolor
           A3(2) complete genome; segment 8/29.
          Length = 403

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 29/100 (29%), Positives = 42/100 (42%)
 Frame = +3

Query: 405 SLSVAMTPAPSANIEARANAGMFPPPNKASHGPAPSEITICGTTMARLRTPMAKPCPPPA 584
           +LS A  PA +      A AG    P        P++       +A LR P A P P PA
Sbjct: 210 ALSAAQRPAETPEHPTTAAAG----PTGTEERVPPAKGVPTPKDLAALRAPGAHPAPQPA 265

Query: 585 SAVKSAVTEKGTL*VIARGMPRRAKTINEATLVDSLAPIT 704
           +A     ++KG        + R A   +EA  + +LA +T
Sbjct: 266 NATLRWSSDKG-------WVDRPAAEPSEAATLPTLAQLT 298



>sp|P75465|Y223_MYCPN Hypothetical protein MG223 homolog
           (F10_orf419).>pir|S73846|S73846 MG223 homolog F10_orf419
           - Mycoplasma pneumoniae (strain ATCC
           29342)>gb:AE000051_19418 Mycoplasma pneumoniae M129
           section 29 of 63 of the complete
           genome.>gb:U00089_1101356 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 419

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 22/70 (31%), Positives = 32/70 (45%)
 Frame = +2

Query: 614 RDTVSDSKGNAEKSKNNQRGNFS*FTRPNNMLNSL*RFIKRNIANNSSPCHAHKHHKMAH 793
           RD  +D      K   + R N   +T  N+++  L  F+KRNI         H H  +AH
Sbjct: 137 RDLTTDKISKNFKYNCSYRANVIYYTTKNSLVKELKPFLKRNIIVKIDKIVTH-HMVLAH 195

Query: 794 SPNQSSTNHL 823
           S  Q + N+L
Sbjct: 196 SIKQINKNNL 205



>sp|P16385|THTR_SACER Putative thiosulfate sulfurtransferase (EC
           2.8.1.1) (Rhodanese-like protein).>gb:SERCYSA_182164
           S.erythraea rhodanese-like protein (cysA) gene, complete
           cds.
          Length = 281

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +2

Query: 458 KRGYVPSAK*GVPWTRTK*DNHLWYNDGEVENSYGQT-LSTASISSQICRNGERDT 622
           + G++PSA   VPW++   ++  + +D E++  YG+  L T   +   CR GER +
Sbjct: 186 RAGHIPSAI-NVPWSKAANEDGTFKSDEELKQVYGEAGLDTDKDTIAYCRIGERSS 240



>sp|Q00959|NME1_RAT Glutamate [NMDA] receptor subunit epsilon 1
            precursor (N-methyl D- aspartate receptor subtype 2A)
            (NR2A) (NMDAR2A).>pir|A43274|A43274 N-methyl D-aspartate
            receptor - rat>gb:A75680_1450629 Sequence 1 from Patent
            WO9323536.>gb:RATNMDA2A_2133148 Rattus norvegicus NMDA
            receptor subtype 2A mRNA, complete cds.
          Length = 1464

 Score = 32.7 bits (73), Expect = 8.8
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = +3

Query: 90   YRHSVGRPKSLPFYNRSSISTNGSH-TKNCKEHLANILSLHVFHYMNCNVIIYSTPRTSF 266
            Y+HS+        Y RSS+ +  S+ +++ + H    +S HV  Y      +YSTPR   
Sbjct: 1387 YKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHSDVYISEHVMPYAANKNTMYSTPRVLN 1446

Query: 267  PCQN 278
             C N
Sbjct: 1447 SCSN 1450


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 909,138,888
Number of Sequences: 1806583
Number of extensions: 20536901
Number of successful extensions: 67883
Number of sequences better than 10.0: 152
Number of HSP's better than 10.0 without gapping: 61419
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67065
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 56114489496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)