BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2430
         (659 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF227623_1778861 Euphorbia esula unknown mRNA.                      77   3e-13   
pir|T00983|T00983 cytochrome b6-f complex chain petM precursor [...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
gb:ATH5671_1552898 Arabidopsis thaliana mRNA for cytochrome b6f ...    75   8e-13   
gb:AC099043_1737028 Oryza sativa chromosome 3 BAC OSJNBa0079B15 ...    62   1e-08   


>gb:AF227623_1778861 Euphorbia esula unknown mRNA.
          Length = 128

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 42/105 (40%), Positives = 58/105 (55%)
 Frame = +2

Query: 176 SQKRATKVNYISGLNSFGGLKAHNHVSTLGLPVCTDHSFAKIVSSLRDPSXXXXXXXXXX 355
           SQK+ +K+ YI GLNS+GGLKAHN V++LG+PV T+  FA ++SSL+  S          
Sbjct: 25  SQKKESKIVYIRGLNSYGGLKAHNTVASLGMPVSTEQGFANVISSLKTSS---SNGKGKS 81

Query: 356 XXALSSTCNAVAEIFKIXXXXXXXXXXXXXXXXXXXRLEATVEEA 490
             AL S C+ + EI +I                   R+EA VEE+
Sbjct: 82  GGALGSKCSKIGEIVQIAATLNGLTLLGVAVGFVLLRIEAFVEES 126



>pir|T00983|T00983 cytochrome b6-f complex chain petM precursor
           [similarity] - Arabidopsis thaliana>gb:AC002505_1530759
           Arabidopsis thaliana chromosome 2 clone T9J22 map B68,
           complete sequence.>gb:AY060541_1564850 Arabidopsis
           thaliana At2g26500/T9J22.17 mRNA, complete
           cds.>gb:AY088737_1573751 Arabidopsis thaliana clone 9368
           mRNA, complete sequence.>gb:AF375459_1792964 Arabidopsis
           thaliana At2g26500 mRNA, complete cds.
          Length = 125

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 45/106 (42%), Positives = 59/106 (55%), Gaps = 1/106 (0%)
 Frame = +2

Query: 179 QKRATKVNYISGLNSFGGLKAHNH-VSTLGLPVCTDHSFAKIVSSLRDPSXXXXXXXXXX 355
           +K   KV+YI+GLNS+GGLKA N+ V ++G P+CT+  FA +V SL+             
Sbjct: 26  KKSEMKVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKG--------RRGN 77

Query: 356 XXALSSTCNAVAEIFKIXXXXXXXXXXXXXXXXXXXRLEATVEEAE 493
             ALS+TCNAV EIFKI                   R+E +VEEAE
Sbjct: 78  GGALSTTCNAVGEIFKIAAIMNALTLVGVAVGFVLLRIETSVEEAE 123



>gb:ATH5671_1552898 Arabidopsis thaliana mRNA for cytochrome b6f
           complex subunit.
          Length = 96

 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 44/101 (43%), Positives = 57/101 (56%), Gaps = 1/101 (0%)
 Frame = +2

Query: 194 KVNYISGLNSFGGLKAHNH-VSTLGLPVCTDHSFAKIVSSLRDPSXXXXXXXXXXXXALS 370
           KV+YI+GLNS+GGLKA N+ V ++G P+CT+  FA +V SL+               ALS
Sbjct: 2   KVSYITGLNSYGGLKAQNNKVVSMGSPLCTEQCFANVVMSLKG--------RRGNGGALS 53

Query: 371 STCNAVAEIFKIXXXXXXXXXXXXXXXXXXXRLEATVEEAE 493
           +TCNAV EIFKI                   R+E +VEEAE
Sbjct: 54  TTCNAVGEIFKIAAIMNALTLVGVAVGFVLLRIETSVEEAE 94



>gb:AC099043_1737028 Oryza sativa chromosome 3 BAC OSJNBa0079B15
           genomic sequence, complete sequence.
          Length = 118

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 35/107 (32%), Positives = 52/107 (48%)
 Frame = +2

Query: 173 PSQKRATKVNYISGLNSFGGLKAHNHVSTLGLPVCTDHSFAKIVSSLRDPSXXXXXXXXX 352
           P+ ++ + V Y+ G+N++ GLKA N V+ LG+    D+SFAK+V+ L             
Sbjct: 18  PAARKRSGVTYVEGMNAYSGLKALNKVTLLGVRKTADYSFAKVVAKL------SPAGGKS 71

Query: 353 XXXALSSTCNAVAEIFKIXXXXXXXXXXXXXXXXXXXRLEATVEEAE 493
              A  + CNA  EIF+I                   R+EA VEE+E
Sbjct: 72  RGGAFGAQCNAAGEIFRIAVIMNGLVLVGVAVGFVLLRVEAAVEESE 118


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 593,407,010
Number of Sequences: 1806583
Number of extensions: 10589591
Number of successful extensions: 22530
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 22012
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22519
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 36147673485
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)