BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2413
         (1008 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB026639_1517078 Arabidopsis thaliana genomic DNA, chromosome...   100   6e-20   
gb:AP005008_1847210 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
pir|AG2234|AG2234 hypothetical protein alr3430 [imported] - Nost...    47   6e-04   Nostoc sp. PCC 7120
gb:BA000012_668370 Mesorhizobium loti MAFF303099 DNA, complete g...    44   0.004   
gb:AP008231_579973 Synechococcus elongatus PCC 6301 DNA, complet...    42   0.019   
gb:AF295376_2485596 Danio rerio interferon-inducible double stra...    41   0.043   
pir|S76071|S76071 hypothetical protein - Synechocystis sp. (stra...    40   0.073   Synechocystis sp. PCC 6803
gb:BA000040_734078 Bradyrhizobium japonicum USDA 110 DNA, comple...    39   0.16    
gb:AY458650_620271 Uncultured bacterium 583 clone EBAC750-10A10 ...    39   0.21    
gb:CR522870_101386 Desulfotalea psychrophila LSv54 chromosome.         39   0.21    
pir|A46372|A46372 immunophilin FKBP52 - human>gb:BC001786_196785...    39   0.21    Homo sapiens [man]
sp|Q02790|FKB4_HUMAN|FKB4_HUMAN FK506-binding protein 4 (EC 5.2.1.8) (Pepti...    39   0.21    Homo sapiens [man]
gb:AE013598_298336 Xanthomonas oryzae pv. oryzae KACC10331, comp...    38   0.36    
gb:AY458642_619689 Uncultured bacterium 560 clone EBAC750-16D01 ...    37   0.47    
gb:AY458642_619688 Uncultured bacterium 560 clone EBAC750-16D01 ...    37   0.47    
gb:AF377339_505686 Myxococcus xanthus UDP-GlcNAc 1-carboxyvinyl ...    37   0.47    
gb:AE017246_415267 Treponema denticola ATCC 35405, section 1 of ...    37   0.47    
gb:BC046709_2549698 Xenopus laevis stress-induced-phosphoprotein...    37   0.62    
gb:AF506290_2498574 Xenopus laevis stress-induced phosphoprotein...    37   0.62    
gb:AE016818_1747925 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.62    
pir|A42386|A42386 hsp 90-binding protein p59 - rabbit>gb:RABP59H...    37   0.62    Oryctolagus cuniculus [domestic rabbit]
sp|P27124|FKB4_RABIT|FKB4_RABIT FK506-binding protein 4 (EC 5.2.1.8) (Pepti...    37   0.62    Oryctolagus cuniculus [domestic rabbit]
gb:AY458650_620275 Uncultured bacterium 583 clone EBAC750-10A10 ...    37   0.81    
gb:AE010982_268141 Methanosarcina acetivorans str. C2A, section ...    37   0.81    
gb:PHY17720_1700253 Petunia hybrida mRNA for SPY protein.              36   1.1     
gb:LES312093_1684569 Lycopersicon esculentum spy gene (SPINDLY-r...    36   1.1     
pir|T02204|T02204 virus replication inhibitor IVR homolog - comm...    36   1.1     Nicotiana tabacum [American tobacco]
gb:BA000040_735378 Bradyrhizobium japonicum USDA 110 DNA, comple...    36   1.4     
gb:AY458650_620274 Uncultured bacterium 583 clone EBAC750-10A10 ...    36   1.4     
gb:AY057934_587376 Xanthomonas campestris pv. campestris GTP-bin...    36   1.4     
gb:AE012552_283453 Xanthomonas campestris pv. campestris str. AT...    36   1.4     
pir|AH2256|AH2256 hypothetical protein alr3607 [imported] - Nost...    36   1.4     Nostoc sp. PCC 7120
gb:AY449459_1327305 Oikopleura dioica clone BACOIKO003 5xk14, co...    35   1.8     
gb:BA000045_743919 Gloeobacter violaceus PCC 7421 DNA, complete ...    35   1.8     
gb:SME591792_186875 Sinorhizobium meliloti 1021 complete chromos...    35   1.8     
pir|F83807|F83807 hypothetical protein BH1262 [imported] - Bacil...    35   1.8     Bacillus halodurans
pir|B69189|B69189 conserved hypothetical protein MTH67 / MTH82 -...    35   1.8     Methanothermobacter thermautotrophicus str. Delta H
pir|C75341|C75341 tetratricopeptide repeat family protein - Dein...    35   1.8     Deinococcus radiodurans
gb:FRU301646_2572118 Takifugu rubripes CRFR gene for corticotrop...    35   2.4     
gb:BC064232_2553785 Xenopus tropicalis hypothetical protein MGC7...    35   2.4     
gb:AY458650_620272 Uncultured bacterium 583 clone EBAC750-10A10 ...    35   2.4     
gb:AE017180_399844 Geobacter sulfurreducens PCA, complete genome.      35   2.4     
gb:AE010832_266962 Methanosarcina acetivorans str. C2A, section ...    35   2.4     
gb:OKE277157_2576738 Oncorhynchus keta mRNA for corticotropin-re...    35   3.1     
gb:CCA576244_2568327 Cyprinus carpio partial mRNA for putative c...    35   3.1     
gb:AF229359_2481185 Ameiurus nebulosus corticotropin releasing f...    35   3.1     
gb:AB188110_2467189 Rana catesbeiana CRFR-1 mRNA for cortcotropi...    35   3.1     
gb:BT019510_2151394 Synthetic construct Homo sapiens corticotrop...    35   3.1     
gb:MMTRANSP2_2117797 Mus musculus partial mRNA for immunophilin ...    35   3.1     
gb:BC003447_2089219 Mus musculus FK506 binding protein 4, mRNA (...    35   3.1     
gb:AY323828_2083490 Mus musculus cytoplasmic CAR retention prote...    35   3.1     
gb:AY034599_2074222 Mesocricetus auratus type-1 corticotropin-re...    35   3.1     
gb:AF531427_2067632 Rattus norvegicus FK506 binding protein 4 mR...    35   3.1     
gb:AF416616_2065340 Mesocricetus auratus corticotropin releasing...    35   3.1     
gb:AB028861_2044520 Mus musculus mRNA for mDj11, complete cds.         35   3.1     
gb:BC033772_1981046 Homo sapiens DnaJ (Hsp40) homolog, subfamily...    35   3.1     
gb:BC003601_1968914 Homo sapiens DnaJ (Hsp40) homolog, subfamily...    35   3.1     
gb:AY457172_1951281 Homo sapiens corticotropin releasing hormone...    35   3.1     
gb:AF180301_1888394 Homo sapiens corticotropin-releasing factor ...    35   3.1     
gb:AB078141_1871585 Macaca mulatta CRF1 mRNA for corticotropin r...    35   3.1     
gb:AX646515_1471883 Sequence 707 from Patent EP1270724.>gb:AB065...    35   3.1     
gb:TBE422241_1445972 Tupaia belangeri mRNA for corticotropin rel...    35   3.1     
gb:AB055434_1408696 Bos taurus CRFR mRNA for corticotropin-relea...    35   3.1     
gb:CR859815_1183917 Pongo pygmaeus mRNA; cDNA DKFZp469O1034 (fro...    35   3.1     
gb:AK076032_1171182 Mus musculus 10 days embryo whole body cDNA,...    35   3.1     
gb:AK011875_1156638 Mus musculus 10 days embryo whole body cDNA,...    35   3.1     
gb:AK011384_1156369 Mus musculus 10 days embryo whole body cDNA,...    35   3.1     
gb:BA000040_735302 Bradyrhizobium japonicum USDA 110 DNA, comple...    35   3.1     
gb:BA000012_669070 Mesorhizobium loti MAFF303099 DNA, complete g...    35   3.1     
pir|I38879|I38879 corticotropin releasing hormone receptor varia...    35   3.1     Homo sapiens [man]
pir|S14529|S14529 transition protein 2 - mouse>gb:MMTRANS2_21177...    35   3.1     Mus musculus [mouse]
pir|JN0873|JN0873 immunophilin p59 - mouse>gb:AK083912_1174108 M...    35   3.1     Mus musculus [mouse]
pir|S14538|S14538 transition protein - mouse                           35   3.1     Mus musculus [mouse]
sp|Q58350|Y940_METJA|Y940_METJA Hypothetical protein MJ0940.>pir|D64417|D64...    35   3.1     Methanocaldococcus jannaschii
sp|P30416|FKB4_MOUSE|FKB4_MOUSE FK506-binding protein 4 (EC 5.2.1.8) (Pepti...    35   3.1     Mus musculus [mouse]
sp|Q9QYI3|DJC7_MOUSE|DJC7_MOUSE DnaJ homolog subfamily C member 7 (Tetratri...    35   3.1     Mus musculus [mouse]
sp|Q99615|DJC7_HUMAN|DJC7_HUMAN DnaJ homolog subfamily C member 7 (Tetratri...    35   3.1     Homo sapiens [man]
sp|O42602|CRF1_XENLA|CRF1_XENLA Corticotropin releasing factor receptor 1 p...    35   3.1     Xenopus laevis [clawed frog]
sp|O62772|CRF1_SHEEP|CRF1_SHEEP Corticotropin releasing factor receptor 1 p...    35   3.1     Ovis aries [domestic sheep]
sp|P35353|CRF1_RAT|CRF1_RAT Corticotropin releasing factor receptor 1 pre...    35   3.1     Rattus norvegicus [brown rat]
sp|P35347|CRF1_MOUSE|CRF1_MOUSE Corticotropin releasing factor receptor 1 p...    35   3.1     Mus musculus [mouse]
sp|P34998|CRF1_HUMAN|CRF1_HUMAN Corticotropin releasing factor receptor 1 p...    35   3.1     Homo sapiens [man]
sp|Q90812|CRF1_CHICK|CRF1_CHICK Corticotropin releasing factor receptor 1 p...    35   3.1     Gallus gallus [bantam]
gb:BC075517_2558618 Xenopus tropicalis DnaJ (Hsp40) homolog, sub...    34   4.0     
gb:AY820281_2546481 Epinephelus coioides corticotropin-releasing...    34   4.0     
gb:AF387671_2064654 Mesocricetus auratus corticotropin releasing...    34   4.0     
gb:AF369652_1899297 Homo sapiens corticotropin releasing hormone...    34   4.0     
gb:AP004837_1845751 Oryza sativa (japonica cultivar-group) genom...    34   4.0     
gb:AE014297_1140568 Drosophila melanogaster chromosome 3R, compl...    34   4.0     
gb:AE013599_1132246 Drosophila melanogaster chromosome 2R, compl...    34   4.0     
gb:AE013599_1132245 Drosophila melanogaster chromosome 2R, compl...    34   4.0     
gb:BX957221_844126 Methanococcus maripaludis S2 complete genome;...    34   4.0     
gb:BX321860_773626 Nitrosomonas europaea ATCC 19718, complete ge...    34   4.0     
gb:AY458642_619701 Uncultured bacterium 560 clone EBAC750-16D01 ...    34   4.0     
pir|B69196|B69196 conserved hypothetical protein MTH72 - Methano...    34   4.0     Methanothermobacter thermautotrophicus str. Delta H
pir|H96950|H96950 TPR-repeat-containing protein [imported] - Clo...    34   4.0     Clostridium acetobutylicum
gb:AF229361_2481187 Ameiurus nebulosus corticotropin releasing f...    34   5.2     
gb:AF387672_2064655 Mesocricetus auratus corticotropin releasing...    34   5.2     
gb:AF369656_2064294 Mus musculus corticotropin releasing hormone...    34   5.2     
gb:AB178470_2049693 Rattus norvegicus CCRP mRNA for cytoplasmic ...    34   5.2     
gb:AY052144_1290738 Drosophila melanogaster SD10334 full length ...    34   5.2     
gb:AE014297_1138414 Drosophila melanogaster chromosome 3R, compl...    34   5.2     
gb:AE017180_400893 Geobacter sulfurreducens PCA, complete genome.      34   5.2     
gb:AE012091_279272 Xanthomonas axonopodis pv. citri str. 306, se...    34   5.2     
gb:CR628336_112666 Legionella pneumophila str. Paris complete ge...    34   5.2     
gb:BC046313_2099160 Mus musculus sperm associated antigen 1, mRN...    33   6.8     
gb:AE016959_1022949 Oryza sativa (japonica cultivar-group) chrom...    33   6.8     
gb:AY458642_619690 Uncultured bacterium 560 clone EBAC750-16D01 ...    33   6.8     
gb:AE017354_460831 Legionella pneumophila subsp. pneumophila str...    33   6.8     
gb:CR628337_115609 Legionella pneumophila str. Lens complete gen...    33   6.8     
gb:CR626857_110059 Rice Cluster I (RC-I), uncultured archeon clo...    33   6.8     
pir|JC7111|JC7111 tetratricopeptide repeat-containing protein - ...    33   6.8     Mus musculus [mouse]
gb:AY394434_2531659 Sphoeroides annulatus Hsp40-like protein gen...    33   8.9     
gb:BC042199_2098600 Mus musculus synovial apoptosis inhibitor 1,...    33   8.9     
gb:AK122558_2069223 Mus musculus mRNA for mKIAA1810 protein.           33   8.9     
gb:AX876569_1476592 Sequence 11474 from Patent EP1074617.>gb:AK0...    33   8.9     
gb:CQ815190_1453516 Sequence 1 from Patent EP1422238.>gb:AX13400...    33   8.9     
gb:LMU73845_1388908 Leishmania major protein antigen LmSTI1 mRNA...    33   8.9     
gb:AK004688_1152511 Mus musculus adult male lung cDNA, RIKEN ful...    33   8.9     
gb:BX572097_798207 Prochlorococcus marinus MIT9313 complete geno...    33   8.9     
gb:AE017235_413099 Mycobacterium avium subsp. paratuberculosis s...    33   8.9     
gb:AE012933_287271 Chlorobium tepidum TLS section 154 of 194 of ...    33   8.9     


>gb:AB026639_1517078 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21L13.>gb:BT005632_1638572 Arabidopsis
           thaliana clone U51296 unknown protein (At5g65520) mRNA,
           complete cds.>gb:AK119033_1816978 Arabidopsis thaliana
           At5g65520 mRNA for unknown protein, complete cds, clone:
           RAFL21-35-P11.
          Length = 206

 Score =  100 bits (248), Expect = 6e-20
 Identities = 65/200 (32%), Positives = 105/200 (52%), Gaps = 2/200 (1%)
 Frame = +2

Query: 92  TDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVLGAQRLAQARTAK 271
           T+ ++Q  ++++++  +  +  + Q   +K + + +A T+Q +R  +  ++ LA+ART  
Sbjct: 4   TETIIQGAILVLTLVMFWAIKYLSQRGLTKFRTKHRA-TLQTQRQLIQASRLLARARTTP 62

Query: 272 DLSSSMRMTLXXXXXXXXXXXIGIXXXXXXXXXXXXXXXEVQGFKTSALDAMNVXXXXXX 451
             S S   +L           I I               ++ G  TSAL + ++      
Sbjct: 63  KKSQSQ--SLAKTALTEADNVIAISPDDAAGHIVRALALDLLGHHTSALKSFDMALTYPR 120

Query: 452 XXXXXXXERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKG--DNVKGLCLLGECYE 625
                  ERA+AL KRAE+KLAV++  +IDSAVEDL E+VRL    D  +   LLGECYE
Sbjct: 121 LKSLSVGERADALVKRAEMKLAVNRRRRIDSAVEDLEEAVRLAAGTDTARLFRLLGECYE 180

Query: 626 KKELSEEARKSYEDALKIQP 685
            K L E+A+ ++ +ALK QP
Sbjct: 181 FKGLKEKAQWAFNEALKAQP 200



>gb:AP005008_1847210 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0544H11.
          Length = 242

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 64/218 (29%), Positives = 105/218 (48%), Gaps = 8/218 (3%)
 Frame = +2

Query: 89  WTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQART-----IQARRHFVLGAQRLA 253
           W + ++  +L +++    + +H++P+    +L+    A +      Q+RRHF  GAQ LA
Sbjct: 12  WPEAIVLCLLFILAAAMLVALHSLPRRAAHRLRRASSAGSSSAAAAQSRRHFAQGAQLLA 71

Query: 254 QARTAKDLSSSMRM-TLXXXXXXXXXXXIGIXXXXXXXXXXXXXXXEVQGFKTSALDAMN 430
           +AR A    +      L           I +               ++QG +  AL A++
Sbjct: 72  RARAAAAGGTKKPPGPLARAALAEADRAIALDPRDAAPLILKALALDLQGHRLPALRALD 131

Query: 431 VXXXXXXXXXXXXXERAEALHKRAELKLAVSKGEQ--IDSAVEDLIESVRLKGDNVKGLC 604
                         ER +AL KRAE+ LA+ +  +  +D A +DL E+VRL   N +   
Sbjct: 132 AALAPPLARSLEPRERGDALAKRAEIALALHRRHRRRLDQAADDLAEAVRLSPQNARAHA 191

Query: 605 LLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR 718
           LLGECYE+K ++ EA  +++ A  I P  +AA+DAL R
Sbjct: 192 LLGECYERKGMAAEALDAFKTAASIDPSLAAARDALRR 229



>pir|AG2234|AG2234 hypothetical protein alr3430 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684419 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 174

 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 3/69 (4%)
 Frame = +2

Query: 530 EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ-- 703
           EQ D A+    E+++ K D V  L  LG  YE+K+L+ +A + YE+ALK  P+ + A+  
Sbjct: 105 EQYDLAIRQYKEALKFKPDYVVALNNLGHAYERKKLTAQALQMYEEALKFAPNNATAKRR 164

Query: 704 -DALARLTS 727
            ++L RL +
Sbjct: 165 AESLRRLVT 173



>gb:BA000012_668370 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 280

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 20/62 (32%), Positives = 37/62 (59%)
 Frame = +2

Query: 539 DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR 718
           D+A  D   +++L G N +        YE++    +A KSY++A+++ P+Y  A+D LAR
Sbjct: 219 DNAFSDFNMAIKLDGQNAEAWANQALIYERRGDKAKAAKSYKEAVRLNPNYQPAKDGLAR 278

Query: 719 LT 724
           ++
Sbjct: 279 VS 280



>gb:AP008231_579973 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 175

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 24/66 (36%), Positives = 35/66 (53%)
 Frame = +2

Query: 506 LKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQP 685
           L  A +  EQ D A+    E++  + D V  L  LG  YEKK+L  +A  +YE  L ++P
Sbjct: 96  LGYAYAAQEQFDLAIRQYKEALEQQPDYVTALNNLGFAYEKKQLLSQAIATYESVLALEP 155

Query: 686 DYSAAQ 703
           +   AQ
Sbjct: 156 NNRTAQ 161



>gb:AF295376_2485596 Danio rerio interferon-inducible double
           stranded RNA dependent protein-kinase inhibitor (prkri)
           mRNA, complete cds.
          Length = 502

 Score = 40.8 bits (94), Expect = 0.043
 Identities = 24/76 (31%), Positives = 42/76 (55%)
 Frame = +2

Query: 491 HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA 670
           +KRA + LA+ K +   SA+ DL ++++LK D +      G    K+  ++EAR+ ++  
Sbjct: 80  YKRATVFLAMGKSK---SALPDLTQAIQLKPDFLAARLQRGNILLKQGSTQEAREDFQAV 136

Query: 671 LKIQPDYSAAQDALAR 718
           L   PD+  A D L +
Sbjct: 137 LNHSPDHKEAHDQLLK 152



>pir|S76071|S76071 hypothetical protein - Synechocystis sp. (strain
           PCC 6803)>gb:BA000022_689438 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 175

 Score = 40.0 bits (92), Expect = 0.073
 Identities = 20/58 (34%), Positives = 34/58 (58%)
 Frame = +2

Query: 530 EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQ 703
           EQ D A+    ++++L  D V  L  L   YEKK++  +A ++Y++ L I+P+   AQ
Sbjct: 105 EQFDLAIRHYKDALKLYPDYVIALNNLANVYEKKQMVNKALETYQETLAIEPNNKVAQ 162



>gb:BA000040_734078 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 307

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           +KG+  D A+ D  +S+ LK    K     G  Y +K   E A ++++DA+K+ PDY AA
Sbjct: 104 AKGDY-DKAIRDFDQSIALKPTYAKAFNNRGVAYLRKGEYELAIEAFDDAIKLDPDYVAA 162



>gb:AY458650_620271 Uncultured bacterium 583 clone EBAC750-10A10
           genomic sequence.
          Length = 1120

 Score = 38.5 bits (88), Expect = 0.21
 Identities = 19/63 (30%), Positives = 38/63 (60%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D +++ L +++ +K D  +    LG  ++++   + A K YE A+ I+PDY++A   L
Sbjct: 160 QVDRSIKSLNKALAIKPDYAQARNNLGVSFQERGQIDGAVKQYEQAVAIKPDYASAHHNL 219

Query: 713 ARL 721
           + L
Sbjct: 220 SVL 222



 Score = 36.6 bits (83), Expect = 0.81
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = +2

Query: 506 LKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQP 685
           L +A+    Q D+AV+   +++ +K D  +    LG   ++    + A KSYE A+ I+P
Sbjct: 652 LGIALKDLGQRDTAVKSFEQALAIKPDYAEAHNNLGVTLQELGQHDTAVKSYEQAIAIKP 711

Query: 686 DYSAAQDAL 712
           DY+ A + L
Sbjct: 712 DYAEAHNNL 720



 Score = 35.4 bits (80), Expect = 1.8
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D +V     ++ +K D V+    LG   ++    + A KS+E AL I+PDY+ A + L
Sbjct: 58  QLDESVTRYERAIAIKPDYVEAHNNLGNVLKELGQRDTAVKSFEQALAIKPDYAEAHNNL 117



 Score = 35.0 bits (79), Expect = 2.4
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q D+AV+   +++ +K D  +    LG    + +  + A KSYE A+ I P+Y+ A
Sbjct: 695 QHDTAVKSYEQAIAIKPDYAEAHNNLGNALRELDQLDAALKSYEQAIVINPEYAVA 750



 Score = 34.3 bits (77), Expect = 4.0
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q D+AV+   +++ +K D  +    LG   ++    + A K YE AL I+PDY+ A + L
Sbjct: 92  QRDTAVKSFEQALAIKPDYAEAHNNLGVTLQELGQLDAAVKCYEQALAIKPDYAEAHNNL 151



>gb:CR522870_101386 Desulfotalea psychrophila LSv54 chromosome.
          Length = 406

 Score = 38.5 bits (88), Expect = 0.21
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = +2

Query: 506 LKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQP 685
           L L   K  +I+ A +  +E+++ +GD++  L  L  CY + E  E A+  YE  L    
Sbjct: 85  LGLCQKKSGEIEEAKKSFLEALQCEGDDIDCLYNLAGCYRETEELEHAKLCYEAVLSRDK 144

Query: 686 DYSAAQDALA 715
           +Y  A   LA
Sbjct: 145 NYLPALSNLA 154



>pir|A46372|A46372 immunophilin FKBP52 - human>gb:BC001786_1967856
           Homo sapiens FK506 binding protein 4, 59kDa, mRNA (cDNA
           clone MGC:2294 IMAGE:3542330), complete
           cds.>gb:BC007924_1971097 Homo sapiens FK506 binding
           protein 4, 59kDa, mRNA (cDNA clone MGC:14457
           IMAGE:4304462), complete cds.>gb:HUMIMMPHLN_2033747
           Human immunophilin (FKBP52) mRNA, complete cds.
          Length = 459

 Score = 38.5 bits (88), Expect = 0.21
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++A+AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      E 
Sbjct: 312 QKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFEL 371

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P+  AA+  LA
Sbjct: 372 ARADFQKVLQLYPNNKAAKTQLA 394



>sp|Q02790|FKB4_HUMAN FK506-binding protein 4 (EC 5.2.1.8)
           (Peptidyl-prolyl cis-trans isomerase) (PPIase)
           (Rotamase) (p59 protein) (HSP binding immunophilin)
           (HBI) (FKBP52 protein) (52 kDa FK506 binding protein)
           (FKBP59).
          Length = 458

 Score = 38.5 bits (88), Expect = 0.21
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++A+AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      E 
Sbjct: 311 QKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFEL 370

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P+  AA+  LA
Sbjct: 371 ARADFQKVLQLYPNNKAAKTQLA 393



>gb:AE013598_298336 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 900

 Score = 37.7 bits (86), Expect = 0.36
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 8/91 (8%)
 Frame = +2

Query: 479  AEALHKRAELKLAVS--------KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKE 634
            AEAL  RA+  LA +        +G   +SA   L  ++++          LG+ Y +  
Sbjct: 810  AEALKLRADFALAANNLGFVYFRQGRSAESA-RRLETTLKIDPSRAVAYLNLGDAYAEGG 868

Query: 635  LSEEARKSYEDALKIQPDYSAAQDALARLTS 727
              E+ARK+Y   L++QP  S A  A A+L S
Sbjct: 869  DREKARKAYSTYLELQPQVSGAAQARAQLQS 899



>gb:AY458642_619689 Uncultured bacterium 560 clone EBAC750-16D01
           genomic sequence.
          Length = 732

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 24/80 (30%), Positives = 44/80 (55%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           E AEA +    L + + + EQ+D+AV+   +++ +K D  +    LG   ++    + A 
Sbjct: 107 EHAEAHNN---LGVTLKELEQLDAAVKSYEKAIAIKPDYAEAHNNLGNALKELGQLDVAV 163

Query: 653 KSYEDALKIQPDYSAAQDAL 712
           KSYE A+ I+PD++   + L
Sbjct: 164 KSYEKAIAIKPDFAETHNNL 183



 Score = 35.4 bits (80), Expect = 1.8
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D AV+   +++ +K D  +    LG   +     +EA K YE A+ I+PDY+ A + L
Sbjct: 158 QLDVAVKSYEKAIAIKPDFAETHNNLGNALQGLGQLDEAVKCYEQAIAIKPDYAEAHNNL 217



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D+AV+   + + +  ++ +    LG   ++ E  + A KSYE A+ I+PDY+ A + L
Sbjct: 90  QLDAAVKCYEDVLAVNPEHAEAHNNLGVTLKELEQLDAAVKSYEKAIAIKPDYAEAHNNL 149



>gb:AY458642_619688 Uncultured bacterium 560 clone EBAC750-16D01
           genomic sequence.
          Length = 723

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 24/80 (30%), Positives = 44/80 (55%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           E AEA +    L + + + EQ+D+AV+   +++ +K D  +    LG   ++    + A 
Sbjct: 111 EHAEAHNN---LGVTLKELEQLDAAVKSYEKAIAIKPDYAEAHNNLGNALKELGQLDVAV 167

Query: 653 KSYEDALKIQPDYSAAQDAL 712
           KSYE A+ I+PD++   + L
Sbjct: 168 KSYEKAIAIKPDFAETHNNL 187



 Score = 36.6 bits (83), Expect = 0.81
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D AV+   +++ ++ D       LG    +    ++A KSYE A+ I+PDY  A + L
Sbjct: 196 QLDEAVKSYEQAIAIQSDFSNAYYNLGNVLRELGQLDDAVKSYEKAIAIKPDYDEAHNNL 255



 Score = 34.7 bits (78), Expect = 3.1
 Identities = 22/72 (30%), Positives = 39/72 (54%)
 Frame = +2

Query: 506 LKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQP 685
           L +A+    Q+D+AV++L +++ +  D  +    LG   +     + A K YE A+ I+P
Sbjct: 323 LGIALQDLGQMDTAVKNLEKAIAITPDFAEAHHNLGIALQDLGQIDAAVKGYEKAIAIKP 382

Query: 686 DYSAAQDALARL 721
           DY+ A   L+ L
Sbjct: 383 DYAEAYHNLSYL 394



 Score = 34.7 bits (78), Expect = 3.1
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D AV+   +++ +K D  +    LG   +     +EA KSYE A+ IQ D+S A
Sbjct: 230 QLDDAVKSYEKAIAIKPDYDEAHNNLGNALQGLGQLDEAVKSYEQAIAIQSDFSNA 285



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D AV+   +++ +K D  +    LG   +     +EA KSYE A+ IQ D+S A
Sbjct: 162 QLDVAVKSYEKAIAIKPDFAETHNNLGNALQGLGQLDEAVKSYEQAIAIQSDFSNA 217



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 19/60 (31%), Positives = 35/60 (58%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D+AV+   + + +  ++ +    LG   ++ E  + A KSYE A+ I+PDY+ A + L
Sbjct: 94  QLDAAVKCYEDVLAVNPEHAEAHNNLGVTLKELEQLDAAVKSYEKAIAIKPDYAEAHNNL 153



>gb:AF377339_505686 Myxococcus xanthus UDP-GlcNAc 1-carboxyvinyl
           transferase MurA (murA), protoporphyrinogen oxidase HemK
           (hemK), peptide chain release factor RF-1 (prfA),
           polyglutamate synthase CapA (capA), serine/threonine
           kinase associate protein KapB (kapB), and hemolysin TlyC
           (tlyC) genes, complete cds; and unknown genes.
          Length = 271

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 22/64 (34%), Positives = 32/64 (50%)
 Frame = +2

Query: 497 RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK 676
           R EL   +       SA+  L E VRL+ DN +    LG C+ +K    EA ++YE A  
Sbjct: 149 RHELAALMMDEGDYRSAITQLKEVVRLEPDNFEAQLDLGICFAQKGFYAEAERAYERARA 208

Query: 677 IQPD 688
           + P+
Sbjct: 209 LNPE 212



>gb:AE017246_415267 Treponema denticola ATCC 35405, section 1 of 10
           of the complete genome.>gb:AE017226_1068863 Treponema
           denticola ATCC 35405, complete genome.
          Length = 380

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 22/72 (30%), Positives = 36/72 (50%)
 Frame = +2

Query: 503 ELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQ 682
           EL + + + E  D A + LI ++ L  +N+K +  LG    K+   EEA   +   L+I 
Sbjct: 306 ELAICLMELELFDEAEKHLINALSLDSENIKIISNLGTLALKQGKQEEAEAFFRTVLEIN 365

Query: 683 PDYSAAQDALAR 718
           PD   A + L +
Sbjct: 366 PDDKIALNVLGK 377



>gb:BC046709_2549698 Xenopus laevis stress-induced-phosphoprotein 1
           (Hsp70/Hsp90-organizing protein), mRNA (cDNA clone
           MGC:53256 IMAGE:5543683), complete cds.
          Length = 543

 Score = 37.0 bits (84), Expect = 0.62
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +2

Query: 515 AVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYS 694
           A +K ++   A+ED  ++V LK D  KG        E     EEA+K+YE+ L+ +P  +
Sbjct: 47  AYAKKKEFTKALEDGSKTVELKADWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPTNA 106

Query: 695 AAQDALARL 721
             ++ L  +
Sbjct: 107 QLKEGLQNM 115



>gb:AF506290_2498574 Xenopus laevis stress-induced phosphoprotein
           STI1 mRNA, complete cds.
          Length = 543

 Score = 37.0 bits (84), Expect = 0.62
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +2

Query: 515 AVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYS 694
           A +K ++   A+ED  ++V LK D  KG        E     EEA+K+YE+ L+ +P  +
Sbjct: 47  AYAKKKEFTKALEDGSKTVELKADWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPTNA 106

Query: 695 AAQDALARL 721
             ++ L  +
Sbjct: 107 QLKEGLQNM 115



>gb:AE016818_1747925 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 580

 Score = 37.0 bits (84), Expect = 0.62
 Identities = 23/59 (38%), Positives = 33/59 (55%)
 Frame = +2

Query: 545 AVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALARL 721
           A+ D  E VR+K D  KG   LG  +      +EA +SY+ AL++     AAQD LA++
Sbjct: 58  ALADAQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQV 116



>pir|A42386|A42386 hsp 90-binding protein p59 -
           rabbit>gb:RABP59HSP_1444049 Oryctolagus cuniculus p59
           protein mRNA, complete cds.>gb:RABP59X_1444050 Rabbit
           hsp90 binding protein (p59) mRNA, complete cds.
          Length = 458

 Score = 37.0 bits (84), Expect = 0.62
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++A+AL   + L LA+   K +   +AVE   +++ L  +N KGL   GE +      + 
Sbjct: 312 QKAQALRLASHLNLAMCHLKLQAFSAAVESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 371

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 372 ARADFQKVLQLYPSNKAAKAQLA 394



>sp|P27124|FKB4_RABIT FK506-binding protein 4 (EC 5.2.1.8)
           (Peptidyl-prolyl cis-trans isomerase) (PPIase)
           (Rotamase) (p59 protein) (HSP binding immunophilin)
           (HBI) (FKBP52 protein) (52 kDa FK506 binding protein)
           (FKBP59).
          Length = 457

 Score = 37.0 bits (84), Expect = 0.62
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++A+AL   + L LA+   K +   +AVE   +++ L  +N KGL   GE +      + 
Sbjct: 311 QKAQALRLASHLNLAMCHLKLQAFSAAVESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 370

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 371 ARADFQKVLQLYPSNKAAKAQLA 393



>gb:AY458650_620275 Uncultured bacterium 583 clone EBAC750-10A10
           genomic sequence.
          Length = 733

 Score = 36.6 bits (83), Expect = 0.81
 Identities = 21/60 (35%), Positives = 34/60 (56%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           ++D AV+   +++ +K D  +    LG   ++    + A KSYE AL IQPDY+ A + L
Sbjct: 58  ELDEAVKSFEKALAIKPDYTEVNYNLGLTLQELGRLDAAVKSYEQALDIQPDYAEAHNNL 117



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 19/63 (30%), Positives = 32/63 (50%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D+AV+   +++ +  D  +    LG   +     + A KSYE  L I PDY+ A + L
Sbjct: 126 QLDAAVQCYEKALAINPDYAEAHNNLGNALKDLNQLDAAVKSYEKTLAINPDYAEAHNNL 185

Query: 713 ARL 721
             +
Sbjct: 186 GNV 188



>gb:AE010982_268141 Methanosarcina acetivorans str. C2A, section 327
           of 534 of the complete genome.>gb:AE010299_908700
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 1121

 Score = 36.6 bits (83), Expect = 0.81
 Identities = 24/72 (33%), Positives = 37/72 (51%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           E  EAL  RA   LA+++ E+ + A+ED    ++L   N K L      +E+    EEA 
Sbjct: 776 ENIEALDGRA---LALARSERREEALEDYNRILQLDPSNTKALAEKASLFEELGRYEEAA 832

Query: 653 KSYEDALKIQPD 688
            +Y + L I P+
Sbjct: 833 STYGEILLITPE 844



>gb:PHY17720_1700253 Petunia hybrida mRNA for SPY protein.
          Length = 932

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 20/57 (35%), Positives = 28/57 (49%)
 Frame = +2

Query: 545 AVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALA 715
           A E   E+++L   N   L   G  Y+ +    EA +SY+ ALK  P Y  A + LA
Sbjct: 101 AFESFAEAIKLDPQNACALTHCGILYKDEGRLVEAAESYQKALKADPSYKPAAECLA 157



>gb:LES312093_1684569 Lycopersicon esculentum spy gene
           (SPINDLY-related gene), exons 1-18.>gb:LES312094_1684570
           Lycopersicon esculentum mRNA for SPY protein
           (SPINDLY-related protein).
          Length = 931

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +2

Query: 545 AVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALA 715
           A E   E++++   N   L   G  Y+ +    EA +SYE ALK  P Y+ A + LA
Sbjct: 101 AFESFSEAIKVDPQNACALTHCGILYKDEGRLVEAAESYEKALKADPSYTPAAECLA 157



>pir|T02204|T02204 virus replication inhibitor IVR homolog - common
           tobacco>gb:NTA9684_1691439 Nicotiana tabacum mRNA for
           inhibitor of virus replication (IVR)-like protein.
          Length = 199

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 512 LAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELS-EEARKSYEDALKIQPD 688
           LA+SK   I  A+    E+++    + K L L+G+ +       E+A+K YE +L+++P 
Sbjct: 32  LAISK---IKEALHAAREAMKAMPQSAKALKLVGDVHASNTSGREKAKKFYESSLRLEPG 88

Query: 689 YSAAQDALARL 721
           Y  A  ALA L
Sbjct: 89  YLGAALALAEL 99



>gb:BA000040_735378 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 216

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 27/83 (32%), Positives = 40/83 (48%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           ++AE L  RA   LA+ K   I  A  DL E+      N +     G+ YE+     +A 
Sbjct: 135 QKAEPLLGRAISHLALGK---IKEATADLDEASEADPHNAQVWTARGQAYERLGDKAKAA 191

Query: 653 KSYEDALKIQPDYSAAQDALARL 721
            SY  A+ ++P   AA+  LAR+
Sbjct: 192 ASYTKAVALRPRDDAARSGLARV 214



>gb:AY458650_620274 Uncultured bacterium 583 clone EBAC750-10A10
           genomic sequence.
          Length = 733

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 20/60 (33%), Positives = 33/60 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D+AV+   +++ +K D       LG   +     + A KSYE A+ I+PD+S A + L
Sbjct: 90  QLDAAVKSYEKAIAIKPDYANACNNLGVTLQDLGQLDAAVKSYEKAIAIKPDFSDANNNL 149



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D+AVE   +++ +K D       LG   +     + A K YE A+ I+PDY+ A
Sbjct: 192 QLDAAVECYKKALAIKPDYADACNNLGNALKNLGQLDAAVKCYEKAVAIKPDYAEA 247



>gb:AY057934_587376 Xanthomonas campestris pv. campestris GTP-binding
            protein (thdF) gene, partial cds; NodB-like protein, 60Kd
            inner-membrane protein (yidC), ribonuclease P (rnpA),
            ribosomal protein L34 (rpmH), chromosomal replication
            initiator protein DnaA (dnaA), DNA polymerase III beta
            chain (dnaN), and RecF protein (recF) genes, complete
            cds; and DNA gyrase subunit B (gyrB) gene, partial cds.
          Length = 900

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 7/88 (7%)
 Frame = +2

Query: 479  AEALHKRAELKLAVS-------KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKEL 637
            AEAL  R +  LA +       + E+   A   L  ++++          LG+ Y K   
Sbjct: 810  AEALKLRPDFALAANNLGFVYYRQERYAEAARWLENTLKIDPSRAVAYLNLGDAYAKAGD 869

Query: 638  SEEARKSYEDALKIQPDYSAAQDALARL 721
             E+ARK+Y   L +QP  + A+ A A+L
Sbjct: 870  REKARKAYTTYLALQPQGAGAEQARAQL 897



>gb:AE012552_283453 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 460 of 460 of the complete
            genome.>gb:AE008922_916735 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 952

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 7/88 (7%)
 Frame = +2

Query: 479  AEALHKRAELKLAVS-------KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKEL 637
            AEAL  R +  LA +       + E+   A   L  ++++          LG+ Y K   
Sbjct: 862  AEALKLRPDFALAANNLGFVYYRQERYAEAARWLENTLKIDPSRAVAYLNLGDAYAKAGD 921

Query: 638  SEEARKSYEDALKIQPDYSAAQDALARL 721
             E+ARK+Y   L +QP  + A+ A A+L
Sbjct: 922  REKARKAYTTYLALQPQGAGAEQARAQL 949



>pir|AH2256|AH2256 hypothetical protein alr3607 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684596 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 232

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +2

Query: 524 KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           +G+++++A+    E++RL+         LG  Y  +    EA   Y+ AL+I PDY  A
Sbjct: 119 RGKKVEAAISAYQEAIRLRSRYAVAYNALGIVYASQSRWSEAIVQYQKALEINPDYGDA 177



>gb:AY449459_1327305 Oikopleura dioica clone BACOIKO003 5xk14,
           complete sequence.
          Length = 1070

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           ++D A+E    ++RL+ +     C L    + + L  EA   YE ALK+ P+++ + + L
Sbjct: 288 RLDLAIETYRIAIRLQPNFPDAYCNLANALKDRLLVSEAESCYEQALKLHPEHADSLNNL 347

Query: 713 ARL 721
           A +
Sbjct: 348 ANI 350



>gb:BA000045_743919 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 213

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           + AEA   RA+++   S+      A+ED    VRL+  +      LG  + +    +EA 
Sbjct: 89  DSAEAHFNRADMR---SRMGSTSGALEDYAWVVRLRPSDACARGKLGNAFYRLGQHQEAL 145

Query: 653 KSYEDALKIQPDYS 694
           +SY++AL++ P Y+
Sbjct: 146 ESYDEALRLDPAYA 159



>gb:SME591792_186875 Sinorhizobium meliloti 1021 complete
           chromosome; segment 11/12.
          Length = 295

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +2

Query: 518 VSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSA 697
           V++G+  D+A  D   ++ L G   +        YE++    +A KSY  AL + P Y  
Sbjct: 225 VAQGDD-DNAFSDFNTAINLNGKLAESWANQALIYERRGDKAKAAKSYSHALSLDPKYEP 283

Query: 698 AQDALAR 718
           A+  LAR
Sbjct: 284 ARAGLAR 290



>pir|F83807|F83807 hypothetical protein BH1262 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_655208 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 214

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 22/70 (31%), Positives = 37/70 (52%)
 Frame = +2

Query: 497 RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK 676
           R +L L +++ EQ+D A++ L   V    ++      LG  Y  K+  EEA   +E A+ 
Sbjct: 129 RFQLGLCLAQLEQVDEAIKHLQLVVEHVPNHADAHFNLGVAYAYKDRLEEALAHFERAIH 188

Query: 677 IQPDYSAAQD 706
           IQP++  A +
Sbjct: 189 IQPEHILAHN 198



>pir|B69189|B69189 conserved hypothetical protein MTH67 / MTH82 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000798_27770 Methanobacterium
           thermoautotrophicum from bases 36267 to 48321 (section 4
           of 148) of the complete genome.>gb:AE000799_27784
           Methanobacterium thermoautotrophicum from bases 48264 to
           58328 (section 5 of 148) of the complete
           genome.>gb:AE000666_924852 Methanobacterium
           thermoautotrophicum str. Delta H complete
           genome.>gb:AE000666_924866 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 60

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 18/38 (47%), Positives = 23/38 (60%)
 Frame = +2

Query: 611 GECYEKKELSEEARKSYEDALKIQPDYSAAQDALARLT 724
           G+  +K    +EA K YE ALKI P+Y  A+ AL  LT
Sbjct: 3   GKTLQKLGKHKEALKCYEKALKIDPEYKKAKKALKELT 40



>pir|C75341|C75341 tetratricopeptide repeat family protein -
           Deinococcus radiodurans (strain R1)>gb:AE002028_42143
           Deinococcus radiodurans R1 section 165 of 229 of the
           complete chromosome 1.>gb:AE000513_883038 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 500

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 5/70 (7%)
 Frame = +2

Query: 527 GEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEK-----KELSEEARKSYEDALKIQPDY 691
           G  + SA ++L  +V L   + +    LG  YE+        +  AR++Y+ ALK+ P Y
Sbjct: 424 GSDLKSARDNLTRAVALNSTSAEYAYYLGLAYERGVPGVAADNVRARENYDKALKLAPGY 483

Query: 692 SAAQDALARL 721
             AQ+   RL
Sbjct: 484 KQAQEGADRL 493



>gb:FRU301646_2572118 Takifugu rubripes CRFR gene for corticotrophin
           releasing factor receptor, exons 1-14.
          Length = 434

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 285 VYTDYIYQGPMILVLVINFIFLFNIVRILMTKLRASTTSETIQYRK 330



>gb:BC064232_2553785 Xenopus tropicalis hypothetical protein
           MGC76181, mRNA (cDNA clone MGC:76181 IMAGE:5335741),
           complete cds.
          Length = 543

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 21/69 (30%), Positives = 36/69 (52%)
 Frame = +2

Query: 515 AVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYS 694
           A +K ++   A+ED  ++V LK D  KG        E     EEA+K+YE+ L+ +P  +
Sbjct: 47  AFAKKKEFTKALEDGGKTVELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEPANA 106

Query: 695 AAQDALARL 721
             ++ L  +
Sbjct: 107 QLKEGLQNM 115



>gb:AY458650_620272 Uncultured bacterium 583 clone EBAC750-10A10
           genomic sequence.
          Length = 697

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D+AVE   +++ +K D  +    LG   +     + A KSYE AL I+P+Y+ A
Sbjct: 158 QLDAAVECYKKALAIKPDYAEAHYNLGNALKDLGQLDAAVKSYEQALAIKPEYANA 213



 Score = 34.3 bits (77), Expect = 4.0
 Identities = 18/56 (32%), Positives = 33/56 (58%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D+AV+   +++ +K D V+    LG   ++    + A + Y+ AL I+PDY+ A
Sbjct: 124 QLDTAVKSYEQAIAIKPDFVEAYYNLGVTLQELGQLDAAVECYKKALAIKPDYAEA 179



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAA 700
           Q+D+AV+   +++ +K D       LG   ++    + A KSYE A+ I+PD+  A
Sbjct: 90  QLDAAVKSYEKAIAIKPDYANACNNLGVTLQELGQLDTAVKSYEQAIAIKPDFVEA 145



>gb:AE017180_399844 Geobacter sulfurreducens PCA, complete genome.
          Length = 473

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 19/77 (24%), Positives = 37/77 (48%)
 Frame = +2

Query: 491 HKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDA 670
           H  + L + ++  ++ + A    + ++ L+ D+      LG     ++   EA +SY  A
Sbjct: 79  HTHSNLGVLLANQKRFEEAESAYLSAIELEPDSPAAWSNLGVLQACRKQEREAEESYRTA 138

Query: 671 LKIQPDYSAAQDALARL 721
           L++ PDY  A   L+ L
Sbjct: 139 LRLDPDYHRASFNLSYL 155



>gb:AE010832_266962 Methanosarcina acetivorans str. C2A, section 177
           of 534 of the complete genome.>gb:AE010299_907521
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 1885

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           +  EAL  R    LA+ + E+   A++   ++++L+  N   L   G C+      EEA 
Sbjct: 37  DHKEALFHRG---LALLETEKTQEALDSFNDALQLEPGNSDALYRKGTCFAALGRFEEAL 93

Query: 653 KSYEDALKIQPD 688
           ++YE AL+  PD
Sbjct: 94  EAYESALESSPD 105



>gb:OKE277157_2576738 Oncorhynchus keta mRNA for
           corticotropin-releasing factor receptor type 1 (crfr1
           gene).
          Length = 430

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 280 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 325



>gb:CCA576244_2568327 Cyprinus carpio partial mRNA for putative
           corticotropin releasing hormone-receptor1 (crh-r1 gene).
          Length = 329

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 211 IYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 256



>gb:AF229359_2481185 Ameiurus nebulosus corticotropin releasing
           factor receptor 1 mRNA, complete cds.
          Length = 445

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 296 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 341



>gb:AB188110_2467189 Rana catesbeiana CRFR-1 mRNA for cortcotropin
           releasing factor receptor type 1, complete cds.
          Length = 416

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 267 VYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 312



>gb:BT019510_2151394 Synthetic construct Homo sapiens corticotropin
           releasing hormone receptor 1 mRNA, partial cds.
          Length = 416

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:MMTRANSP2_2117797 Mus musculus partial mRNA for immunophilin
           FKBP-52.
          Length = 453

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 307 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 366

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 367 ARADFQKVLQLYPSNKAAKTQLA 389



>gb:BC003447_2089219 Mus musculus FK506 binding protein 4, mRNA
           (cDNA clone MGC:6528 IMAGE:2651490), complete cds.
          Length = 458

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 312 QKVRALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 371

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 372 ARADFQKVLQLYPSNKAAKTQLA 394



>gb:AY323828_2083490 Mus musculus cytoplasmic CAR retention protein
           mRNA, complete cds.
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AY034599_2074222 Mesocricetus auratus type-1
           corticotropin-releasing hormone receptor alpha isoform
           (CRH-R1) mRNA, complete cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:AF531427_2067632 Rattus norvegicus FK506 binding protein 4 mRNA,
           partial cds.
          Length = 402

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 256 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 315

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 316 ARADFQKVLQLYPSNKAAKTQLA 338



>gb:AF416616_2065340 Mesocricetus auratus corticotropin releasing
           hormone variant 1d mRNA, partial cds; alternatively
           spliced.
          Length = 106

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 10  VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 55



>gb:AB028861_2044520 Mus musculus mRNA for mDj11, complete cds.
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:BC033772_1981046 Homo sapiens DnaJ (Hsp40) homolog, subfamily C,
           member 7, mRNA (cDNA clone MGC:45296 IMAGE:3924081),
           complete cds.>gb:HSU46571_2024453 Human
           tetratricopeptide repeat protein (tpr2) mRNA, complete
           cds.
          Length = 484

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  ++D A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 295 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 342



>gb:BC003601_1968914 Homo sapiens DnaJ (Hsp40) homolog, subfamily C,
           member 7, mRNA (cDNA clone MGC:911 IMAGE:3543074),
           complete cds.
          Length = 438

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  ++D A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 249 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 296



>gb:AY457172_1951281 Homo sapiens corticotropin releasing hormone
           receptor 1 (CRHR1) mRNA, complete cds.>gb:HSCRFA_2011659
           H.sapiens mRNA for corticotrophin releasing factor
           receptor.>gb:HUMCRFRA_2030303 Human corticotropin
           releasing factor receptor mRNA, complete cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:AF180301_1888394 Homo sapiens corticotropin-releasing factor
           receptor variant 1d (CRHR1) mRNA, alternative splice
           product, complete cds.
          Length = 401

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:AB078141_1871585 Macaca mulatta CRF1 mRNA for corticotropin
           releasing factor receptor type 1, complete cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:AX646515_1471883 Sequence 707 from Patent
           EP1270724.>gb:AB065967_1870151 Homo sapiens gene for
           seven transmembrane helix receptor, complete cds,
           isolate:CBRC7TM_530.
          Length = 447

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 298 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 343



>gb:TBE422241_1445972 Tupaia belangeri mRNA for corticotropin
           releasing factor type 1 receptor (crf1 gene).
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:AB055434_1408696 Bos taurus CRFR mRNA for
           corticotropin-releasing hormone receptor, complete cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>gb:CR859815_1183917 Pongo pygmaeus mRNA; cDNA DKFZp469O1034 (from
           clone DKFZp469O1034).
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  ++D A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 352



>gb:AK076032_1171182 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610300C22
           product:DnaJ (Hsp40) homolog, subfamily C, member 7,
           full insert sequence.
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AK011875_1156638 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610204E12
           product:DnaJ (Hsp40) homolog, subfamily C, member 7,
           full insert sequence.
          Length = 484

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 295 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 342



>gb:AK011384_1156369 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610011N24
           product:DnaJ (Hsp40) homolog, subfamily C, member 7,
           full insert sequence.
          Length = 301

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 112 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 159



>gb:BA000040_735302 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 561

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 24/89 (26%), Positives = 48/89 (53%), Gaps = 9/89 (10%)
 Frame = +2

Query: 485 ALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           A++ RA++ +   KG+ +D+A++D   ++++  +NV+     G+ YE+++   +AR  Y 
Sbjct: 233 AINNRADVSMM--KGD-LDAALKDYNSAIQINPNNVRAHSGRGQIYERRKDLAQARADYR 289

Query: 665 ---------DALKIQPDYSAAQDALARLT 724
                    D L +    + AQ+ LA LT
Sbjct: 290 AAAYSLTKFDELDVARARAVAQERLAALT 318



>gb:BA000012_669070 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 558

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 18/52 (34%), Positives = 29/52 (55%)
 Frame = +2

Query: 524 KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKI 679
           K  +   A+  + +++ LK D V+ LC LG+ Y + +  E A   +E ALKI
Sbjct: 122 KVSEFTPAIRHIQQALDLKPDLVEALCALGDAYNEFDKGELALPLFEKALKI 173



>pir|I38879|I38879 corticotropin releasing hormone receptor variant
           - human>gb:HSU16273_2022473 Human corticotropin
           releasing hormone receptor variant mRNA, complete cds.
          Length = 375

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 226 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 271



>pir|S14529|S14529 transition protein 2 - mouse>gb:MMTRANS2_2117795
           Mouse mRNA for protein with homology to transition
           protein 2 (TP2).
          Length = 519

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 265 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 324

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 325 ARADFQKVLQLYPSNKAAKTQLA 347



>pir|JN0873|JN0873 immunophilin p59 - mouse>gb:AK083912_1174108 Mus
           musculus 12 days embryo spinal ganglion cDNA, RIKEN
           full-length enriched library, clone:D130059C21
           product:FK506 binding protein 4 (59 kDa), full insert
           sequence.>gb:MMP59_2116865 M.musculus mRNA for p59
           immunophilin.>gb:BC086118_2564705 Xenopus laevis
           hypothetical LOC495625, mRNA (cDNA clone MGC:98518
           IMAGE:7198848), complete cds.
          Length = 458

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 312 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 371

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 372 ARADFQKVLQLYPSNKAAKTQLA 394



>pir|S14538|S14538 transition protein - mouse
          Length = 411

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 265 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 324

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 325 ARADFQKVLQLYPSNKAAKTQLA 347



>sp|Q58350|Y940_METJA Hypothetical protein MJ0940.>pir|D64417|D64417
           transformation sensitive protein homolog - Methanococcus
           jannaschii>gb:U67537_207049 Methanocaldococcus
           jannaschii DSM 2661 section 79 of 150 of the complete
           genome.>gb:L77117_1099807 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 318

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 19/63 (30%), Positives = 35/63 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           ++D A + +   ++L+ D+       G+ YEK+   EEA K Y  A+++ P ++ A  A 
Sbjct: 236 KLDKAEKYIEMGLKLRPDDASLWYFKGKLYEKQNKFEEALKYYNKAIQLMPHHTKALLAK 295

Query: 713 ARL 721
           AR+
Sbjct: 296 ARV 298



>sp|P30416|FKB4_MOUSE FK506-binding protein 4 (EC 5.2.1.8)
           (Peptidyl-prolyl cis-trans isomerase) (PPIase)
           (Rotamase) (p59 protein) (HSP binding immunophilin)
           (HBI) (FKBP52 protein) (52 kDa FK506 binding protein)
           (FKBP59).
          Length = 457

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVS--KGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEE 646
           ++  AL   + L LA+   K +   +A+E   +++ L  +N KGL   GE +      + 
Sbjct: 311 QKVHALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFDL 370

Query: 647 ARKSYEDALKIQPDYSAAQDALA 715
           AR  ++  L++ P   AA+  LA
Sbjct: 371 ARADFQKVLQLYPSNKAAKTQLA 393



>sp|Q9QYI3|DJC7_MOUSE DnaJ homolog subfamily C member 7
           (Tetratricopeptide repeat protein 2) (TPR repeat protein
           2) (MDj11).>gb:BC023681_2094207 Mus musculus DnaJ
           (Hsp40) homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:35912 IMAGE:5343384), complete
           cds.>gb:BC055729_2102122 Mus musculus DnaJ (Hsp40)
           homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:66940 IMAGE:6414499), complete cds.
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  Q++ A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>sp|Q99615|DJC7_HUMAN DnaJ homolog subfamily C member 7
           (Tetratricopeptide repeat protein 2) (TPR repeat protein
           2).>gb:BC011837_1973248 Homo sapiens DnaJ (Hsp40)
           homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:20075 IMAGE:3945721), complete cds.
          Length = 494

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK  ++D A+ED   +V+L    +K      +CY   E  EEA + YE
Sbjct: 305 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 352



>sp|O42602|CRF1_XENLA Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>gb:XLY14036_2583667
           Xenopus laevis mRNA for corticotropin releasing factor
           receptor, type 1.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>sp|O62772|CRF1_SHEEP Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>gb:AF054582_1412940 Ovis
           aries corticotropin releasing factor receptor type 1
           mRNA, complete cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>sp|P35353|CRF1_RAT Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>pir|I58144|I58144
           corticotropin-releasing factor receptor -
           rat>gb:AH006791S1_2068227 Rattus norvegicus
           corticotropin releasing factor receptor gene, exon 13
           and complete cds.>gb:RATCRFR_2131890 Rat
           corticotropin-releasing factor receptor mRNA, complete
           cds.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>sp|P35347|CRF1_MOUSE Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>pir|S39535|S39535
           corticotropin-releasing hormone receptor -
           mouse>gb:AF483484_2066861 Mus musculus strain ILS
           corticotrophin releasing factor receptor mRNA, complete
           cds.>gb:AF483485_2066862 Mus musculus strain ISS
           corticotrophin releasing factor receptor mRNA, complete
           cds.>gb:MMCRFA_2114619 M.musculus mRNA for
           corticotrophin releasing factor receptor.
          Length = 415

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 266 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 311



>sp|P34998|CRF1_HUMAN Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>pir|I60975|A48260
           corticoliberin receptor, long splice form -
           human>gb:HSCRFR14_2011661 Homo sapiens
           corticotropin-releasing factor type 1 receptor gene,
           exon 14 and complete cds.>gb:HUMCRFRB_2030304 Human
           corticotropin releasing factor receptor mRNA, complete
           cds.
          Length = 444

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 295 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 340



>sp|Q90812|CRF1_CHICK Corticotropin releasing factor receptor 1
           precursor (CRF-R) (CRF1) (Corticotropin-releasing
           hormone receptor 1) (CRH-R 1).>gb:CHKCRFR_2568959 Gallus
           gallus corticotropin-releasing factor receptor mRNA,
           complete cds.
          Length = 420

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 271 VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRK 316



>gb:BC075517_2558618 Xenopus tropicalis DnaJ (Hsp40) homolog,
           subfamily C, member 7, mRNA (cDNA clone MGC:89403
           IMAGE:6989707), complete cds.
          Length = 493

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 15/48 (31%), Positives = 27/48 (56%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           +K ++++ A+ED   +++L    +K      +CY   EL EEA + YE
Sbjct: 304 AKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYE 351



>gb:AY820281_2546481 Epinephelus coioides corticotropin-releasing
           hormone receptor mRNA, partial cds.
          Length = 186

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 118 VYTDYIYQGPMILVLLINFVFLFNIVRILMTKLRASTTSETIQYRK 163



>gb:AF387671_2064654 Mesocricetus auratus corticotropin releasing
           hormone receptor variant 1f (CRH-R1) mRNA, partial cds.,
           alternatively spliced.
          Length = 64

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVL 235
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R    L
Sbjct: 10  VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRTSLCL 59



>gb:AF369652_1899297 Homo sapiens corticotropin releasing hormone
           receptor variant 1f (CRHR1) mRNA, partial cds,
           alternatively spliced.
          Length = 66

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARRHFVL 235
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R    L
Sbjct: 1   VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRASLCL 50



>gb:AP004837_1845751 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0483C08.>gb:AP004864_1846189 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0048K16.
          Length = 953

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +2

Query: 536 IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALA 715
           +D A+    E+V+LK          G  Y+   +S+EA  SY+ A++ +PDY+ A   LA
Sbjct: 264 LDKALLYYKEAVKLKPSFADAYLNQGNVYKTMGMSQEAIISYQRAVQARPDYAMAYGNLA 323

Query: 716 RL 721
            +
Sbjct: 324 TI 325



>gb:AE014297_1140568 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003733_1222561 Drosophila melanogaster
            chromosome 3R, section 71 of 118 of the complete
            sequence.
          Length = 4496

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 29/86 (33%), Positives = 46/86 (53%), Gaps = 8/86 (9%)
 Frame = +2

Query: 503  ELKLAVSKGE--QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKK------ELSEEARKS 658
            ++KLAV + E  + + A + LIE V ++ + V+    + +  E K      E+S++ R  
Sbjct: 3096 KVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDC 3155

Query: 659  YEDALKIQPDYSAAQDALARLTS*SL 736
             ED LK +P   AAQDAL  L   +L
Sbjct: 3156 EEDLLKAEPALMAAQDALNTLNKANL 3181



>gb:AE013599_1132246 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132247 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003806_1225443
           Drosophila melanogaster chromosome 2R, section 44 of 74
           of the complete sequence.>gb:AE003806_1225444 Drosophila
           melanogaster chromosome 2R, section 44 of 74 of the
           complete sequence.
          Length = 577

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 23/63 (36%), Positives = 26/63 (41%)
 Frame = -2

Query: 695 RSSLAGF*ERLRKTFGPPRSALSFHSTLLTDKAP*HYRPSTAPTRSDPQRPSQFARPYSP 516
           R  L G    LRK   P  SA   +ST L D    H+ P T   +  P    Q A  YS 
Sbjct: 380 REPLPGHISSLRKPTSPAESAKEINST-LKDATQKHFDPRTGALQQGPSEMGQVAMAYSK 438

Query: 515 RAS 507
            AS
Sbjct: 439 SAS 441



>gb:AE013599_1132245 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003806_1225442 Drosophila melanogaster
           chromosome 2R, section 44 of 74 of the complete
           sequence.>gb:AY070513_1294658 Drosophila melanogaster
           GH19382 full length cDNA.
          Length = 551

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 23/63 (36%), Positives = 26/63 (41%)
 Frame = -2

Query: 695 RSSLAGF*ERLRKTFGPPRSALSFHSTLLTDKAP*HYRPSTAPTRSDPQRPSQFARPYSP 516
           R  L G    LRK   P  SA   +ST L D    H+ P T   +  P    Q A  YS 
Sbjct: 380 REPLPGHISSLRKPTSPAESAKEINST-LKDATQKHFDPRTGALQQGPSEMGQVAMAYSK 438

Query: 515 RAS 507
            AS
Sbjct: 439 SAS 441



>gb:BX957221_844126 Methanococcus maripaludis S2 complete genome;
           segment 3/5.
          Length = 567

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 22/64 (34%), Positives = 32/64 (50%)
 Frame = +2

Query: 530 EQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDA 709
           E+   A  +  ++V L G N K    L     K E  +EA + Y+ A++I PDY AA   
Sbjct: 456 EKYGEAEIEFKKAVALDGSNSKAYNNLATFLAKSEKYDEAEEHYKKAIEIAPDYWAAIYN 515

Query: 710 LARL 721
           LA +
Sbjct: 516 LAAM 519



>gb:BX321860_773626 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 5/10.
          Length = 1165

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
 Frame = +2

Query: 509 KLAVSKGEQ----IDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK 676
           KLA+S  +Q    I++A+    E+VRL   N      L E       S+ A +S E A+ 
Sbjct: 351 KLALSYAQQANFQIETALASAEEAVRLDSQNALAWARLAELQMSAGKSDHALQSAERAVS 410

Query: 677 IQPDYSAAQDAL 712
           + PD S  Q  L
Sbjct: 411 LDPDLSRTQTVL 422



>gb:AY458642_619701 Uncultured bacterium 560 clone EBAC750-16D01
           genomic sequence.
          Length = 764

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+D+AV+   +++ +K +  +    LG  ++     + A KSYE AL I+PDY+   + L
Sbjct: 190 QLDTAVKSYEKALAIKPNFAEAHNNLGNVFKDLGQLDTAVKSYEKALAIRPDYAEVHNNL 249



 Score = 34.3 bits (77), Expect = 4.0
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q+++AV+   E++ ++ D  +     G   ++    E A K YE+AL I+PDY+ A + L
Sbjct: 88  QLEAAVKHYEEALAIRPDYAEAHNNFGVTLQELGQLEAAVKHYEEALAIRPDYAEAHNNL 147



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQD 706
           Q D+AV+    ++ +K D       LG   ++    E A K YE+AL I+PDY+ A +
Sbjct: 54  QRDAAVKSFENALAIKQDFADAHNNLGVTLQELGQLEAAVKHYEEALAIRPDYAEAHN 111



>pir|B69196|B69196 conserved hypothetical protein MTH72 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000798_27774 Methanobacterium
           thermoautotrophicum from bases 36267 to 48321 (section 4
           of 148) of the complete genome.>gb:AE000666_924856
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 403

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = +2

Query: 611 GECYEKKELSEEARKSYEDALKIQPDYSAAQDALARL 721
           G+  +K    ++A+KSY+ ALKI P+Y  A+ AL  L
Sbjct: 363 GKTLQKLGKHQKAKKSYKKALKIDPEYKKAKKALKEL 399



>pir|H96950|H96950 TPR-repeat-containing protein [imported] -
           Clostridium acetobutylicum>gb:AE007556_227756
           Clostridium acetobutylicum ATCC 824 section 44 of 356 of
           the complete genome.>gb:AE001437_1090711 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 436

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +2

Query: 539 DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPD 688
           D AVE   +++ + GDN +    LG+  +K    EEA + Y  A+++QP+
Sbjct: 26  DEAVEYYRKALEVDGDNFEAYANLGDLLDKTNKWEEACEVYGKAIELQPE 75



>gb:AF229361_2481187 Ameiurus nebulosus corticotropin releasing
           factor receptor 3 mRNA, complete cds.
          Length = 428

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 15/46 (32%), Positives = 29/46 (63%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQARR 223
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R+
Sbjct: 279 IYTDYIYQGPMILVLMINFVFLFNIVRILMTKLRASTTSETIQYRK 324



>gb:AF387672_2064655 Mesocricetus auratus corticotropin releasing
           hormone receptor variant 1m (CRH-R1) mRNA, partial cds,
           alternatively spliced.
          Length = 60

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQAR 220
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R
Sbjct: 10  VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYR 54



>gb:AF369656_2064294 Mus musculus corticotropin releasing hormone
           receptor variant 1f (Crhr1) mRNA, partial cds,
           alternatively spliced.
          Length = 64

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = +2

Query: 86  MWTDLLLQAVLILISIFTYLFMHNIPQNLYSKLQMRRQARTIQAR 220
           ++TD + Q  +IL+ +  ++F+ NI + L +KL+    + TIQ R
Sbjct: 10  VYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYR 54



>gb:AB178470_2049693 Rattus norvegicus CCRP mRNA for cytoplasmic CAR
           retention protein, complete cds.
          Length = 494

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 17/48 (35%), Positives = 26/48 (54%)
 Frame = +2

Query: 521 SKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYE 664
           SK ++++ A+ED   +V+L    VK      +CY   E  EEA + YE
Sbjct: 305 SKLKKLEDAIEDCTNAVKLDDTYVKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AY052144_1290738 Drosophila melanogaster SD10334 full length
           cDNA.
          Length = 947

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 28/83 (33%), Positives = 34/83 (40%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           E A     RA   L + K E   +AVED  ES++    + K L    + YE  E  EEA 
Sbjct: 48  ELAVFYKNRAAAYLKLGKYE---NAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAY 104

Query: 653 KSYEDALKIQPDYSAAQDALARL 721
           K      K  P     Q  L RL
Sbjct: 105 KDATALFKADPGNKTVQPMLQRL 127



>gb:AE014297_1138414 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003677_1220407 Drosophila melanogaster
           chromosome 3R, section 15 of 118 of the complete
           sequence.
          Length = 947

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 28/83 (33%), Positives = 34/83 (40%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           E A     RA   L + K E   +AVED  ES++    + K L    + YE  E  EEA 
Sbjct: 48  ELAVFYKNRAAAYLKLGKYE---NAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAY 104

Query: 653 KSYEDALKIQPDYSAAQDALARL 721
           K      K  P     Q  L RL
Sbjct: 105 KDATALFKADPGNKTVQPMLQRL 127



>gb:AE017180_400893 Geobacter sulfurreducens PCA, complete genome.
          Length = 585

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 24/78 (30%), Positives = 38/78 (48%)
 Frame = +2

Query: 479 AEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKS 658
           AE L +     LA   G  +D A+    E+VRL+    +    LG  +++K L +EA  S
Sbjct: 35  AEMLWRAGNAHLA---GGALDMALSCYREAVRLRPGFAQAHYNLGVVFQQKGLLDEAAAS 91

Query: 659 YEDALKIQPDYSAAQDAL 712
           +  A+    DY+ A + L
Sbjct: 92  FRSAISFNRDYAKAYNNL 109



>gb:AE012091_279272 Xanthomonas axonopodis pv. citri str. 306, section
            469 of 469 of the complete genome.>gb:AE008923_921047
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 911

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 29/90 (32%), Positives = 42/90 (46%), Gaps = 7/90 (7%)
 Frame = +2

Query: 479  AEALHKRAELKLAVSKGEQIDSAVEDLIESVR-----LKGDNVKGLCLL--GECYEKKEL 637
            AEAL  R +  LA +    +        ES R     LK D  + +  L  G+ Y K   
Sbjct: 821  AEALKLRPDFALAANNLGFVYYRQGRFAESARWLENTLKIDPSRAVAYLNLGDAYAKAGD 880

Query: 638  SEEARKSYEDALKIQPDYSAAQDALARLTS 727
             ++ARK+Y   L++QP  S A+ A  +L S
Sbjct: 881  RDKARKAYSTYLELQPQGSGAEQARTQLQS 910



>gb:CR628336_112666 Legionella pneumophila str. Paris complete
           genome.
          Length = 577

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 22/81 (27%), Positives = 44/81 (54%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           +  E LH    L L  ++   +++A+   +++ ++  ++V  L  L   Y+K    +EA 
Sbjct: 37  KHTETLHF---LGLTYAQLGDMENAILYFLQAKKINPNDVGILNNLANAYKKAGQLDEAI 93

Query: 653 KSYEDALKIQPDYSAAQDALA 715
           K Y+ A++I+P+Y  A + LA
Sbjct: 94  KYYQQAIEIKPEYVQAHNNLA 114



>gb:BC046313_2099160 Mus musculus sperm associated antigen 1, mRNA
           (cDNA clone MGC:54631 IMAGE:6310604), complete cds.
          Length = 901

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = +2

Query: 497 RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK 676
           +AE+KL     ++  SA+ED  +++ L   NVK L      Y+ +   +EA       L+
Sbjct: 254 QAEIKL-----QRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQ 308

Query: 677 IQPDYSAAQDALARL 721
           ++PD   A+  L+ +
Sbjct: 309 VEPDNDLAKKTLSEV 323



>gb:AE016959_1022949 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068951_1540580
           Oryza sativa chromosome 10 BAC OSJNBa0042E19 genomic
           sequence, complete sequence.>gb:AE017102_1752768 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           56 of 77 of the complete sequence.
          Length = 380

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/66 (24%), Positives = 37/66 (56%)
 Frame = +2

Query: 506 LKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQP 685
           L ++  +  ++D +++   ++V L+   V     LG+ YE+K+  + A K++E+ L   P
Sbjct: 292 LGVSYKRDNKLDKSIQQFEKAVELQPGYVTAWNNLGDAYEQKKDLKSALKAFEEVLLFDP 351

Query: 686 DYSAAQ 703
           + + A+
Sbjct: 352 NNTVAR 357



>gb:AY458642_619690 Uncultured bacterium 560 clone EBAC750-16D01
           genomic sequence.
          Length = 604

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 20/63 (31%), Positives = 35/63 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           Q D A++   +S+ +K D       LG  ++K    + A +SY+ A+ I+PDY+ AQ  L
Sbjct: 209 QDDVAIKSYEKSIAIKPDYPLPHNNLGIAFQKLGQMDAAVESYKKAVAIKPDYATAQFNL 268

Query: 713 ARL 721
           + +
Sbjct: 269 SAM 271



>gb:AE017354_460831 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 571

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 22/81 (27%), Positives = 44/81 (54%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           +  E LH    L L  ++   +++A+   +++ ++  ++V  L  L   Y+K    +EA 
Sbjct: 37  KHTETLHF---LGLTYAQLGDMENAILYFLQARKINPNDVGILNNLANAYKKAGQLDEAI 93

Query: 653 KSYEDALKIQPDYSAAQDALA 715
           K Y+ A++I+P+Y  A + LA
Sbjct: 94  KYYQQAIEIKPEYVQAHNNLA 114



>gb:CR628337_115609 Legionella pneumophila str. Lens complete
           genome.
          Length = 577

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 22/81 (27%), Positives = 44/81 (54%)
 Frame = +2

Query: 473 ERAEALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEAR 652
           +  E LH    L L  ++   +++A+   +++ ++  ++V  L  L   Y+K    +EA 
Sbjct: 37  KHTETLHF---LGLTYAQLGDMENAILYFLQARKINPNDVGILNNLANAYKKAGQLDEAI 93

Query: 653 KSYEDALKIQPDYSAAQDALA 715
           K Y+ A++I+P+Y  A + LA
Sbjct: 94  KYYQQAIEIKPEYVQAHNNLA 114



>gb:CR626857_110059 Rice Cluster I (RC-I), uncultured archeon clone
           3D10 complete sequence.
          Length = 423

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 6/75 (8%)
 Frame = +2

Query: 512 LAVSKGEQIDS--AVEDLI----ESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDAL 673
           L++    ++D   A+ D+I    E+VRL  D  +  CLLG        S +A ++ E A+
Sbjct: 31  LSIMNSARLDDLPALYDVISLCREAVRLNPDYAEAYCLLGAALAGMGQSGDAIQALEKAI 90

Query: 674 KIQPDYSAAQDALAR 718
            +QP Y+ A   L +
Sbjct: 91  TLQPGYAEAHYYLGK 105



>pir|JC7111|JC7111 tetratricopeptide repeat-containing protein -
           mouse>gb:AF181252_2058056 Mus musculus testis
           TPR-containing protein involved in spermatogenesis TPIS
           (Tpis) mRNA, complete cds.
          Length = 901

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 21/75 (28%), Positives = 38/75 (50%)
 Frame = +2

Query: 497 RAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALK 676
           +AE+KL     ++  SA+ED  +++ L   NVK L      Y+ +   +EA       L+
Sbjct: 254 QAEIKL-----QRWSSALEDCEKALELDPGNVKALLRRATTYKHQNKLQEAVDDLRKVLQ 308

Query: 677 IQPDYSAAQDALARL 721
           ++PD   A+  L+ +
Sbjct: 309 VEPDNDLAKKTLSEV 323



>gb:AY394434_2531659 Sphoeroides annulatus Hsp40-like protein gene,
           partial cds.
          Length = 124

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 18/61 (29%), Positives = 28/61 (45%)
 Frame = +2

Query: 515 AVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYS 694
           A +K  +++  +ED   ++RL    VK      +CY   E  EEA + YE   +   D  
Sbjct: 11  AGAKLNKLNQTIEDCTSAIRLDDSYVKAYLRRAQCYMDTEQYEEAVRDYEKVYQTGKDVR 70

Query: 695 A 697
           A
Sbjct: 71  A 71



>gb:BC042199_2098600 Mus musculus synovial apoptosis inhibitor 1,
           synoviolin, mRNA (cDNA clone MGC:49100 IMAGE:4953165),
           complete cds.>gb:BC057917_2102950 Mus musculus synovial
           apoptosis inhibitor 1, synoviolin, mRNA (cDNA clone
           MGC:67727 IMAGE:5136398), complete
           cds.>gb:BC080722_2107803 Mus musculus synovial apoptosis
           inhibitor 1, synoviolin, mRNA (cDNA clone MGC:90943
           IMAGE:5323695), complete cds.
          Length = 612

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 20/53 (37%), Positives = 24/53 (45%)
 Frame = -2

Query: 656 TFGPPRSALSFHSTLLTDKAP*HYRPSTAPTRSDPQRPSQFARPYSPRASIPP 498
           + GPPR A S + T  T        PST+   S+   PS  A P  P A  PP
Sbjct: 524 SLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPSPGASPPIPEAEKPP 576



>gb:AK122558_2069223 Mus musculus mRNA for mKIAA1810 protein.
          Length = 568

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 20/53 (37%), Positives = 24/53 (45%)
 Frame = -2

Query: 656 TFGPPRSALSFHSTLLTDKAP*HYRPSTAPTRSDPQRPSQFARPYSPRASIPP 498
           + GPPR A S + T  T        PST+   S+   PS  A P  P A  PP
Sbjct: 516 SLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPSPGASPPIPEAEKPP 568



>gb:AX876569_1476592 Sequence 11474 from Patent
           EP1074617.>gb:AK027530_1911040 Homo sapiens cDNA
           FLJ14624 fis, clone NT2RP2000248, weakly similar to
           UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
           N-ACETYLGLUCOSAMINYLTRANSFERASE 110 KD SUBUNIT (EC
           2.4.1.-).
          Length = 479

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 21/64 (32%), Positives = 35/64 (54%)
 Frame = +2

Query: 509 KLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPD 688
           K    KG Q  +A+ +  E+VRL    V  +  LG   +++   +EA +    A++IQPD
Sbjct: 228 KNLADKGNQT-AAIRNYREAVRLNPKYVHAMNNLGNILKERNELQEAEELLSLAVQIQPD 286

Query: 689 YSAA 700
           ++AA
Sbjct: 287 FAAA 290



>gb:CQ815190_1453516 Sequence 1 from Patent
           EP1422238.>gb:AX134002_1461803 Sequence 1 from Patent
           EP1113073.
          Length = 546

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 539 DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR 718
           + A++D  + + LK D VKG    G  Y   +    A ++Y++ LK+ P  +  +D   R
Sbjct: 409 NDALKDAEKCIELKPDFVKGYARKGHAYFWTKQYNRALQAYDEGLKVDPSNADCKDGRYR 468



>gb:LMU73845_1388908 Leishmania major protein antigen LmSTI1 mRNA,
           partial cds.
          Length = 545

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 17/60 (28%), Positives = 30/60 (50%)
 Frame = +2

Query: 539 DSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDALAR 718
           + A++D  + + LK D VKG    G  Y   +    A ++Y++ LK+ P  +  +D   R
Sbjct: 408 NDALKDAEKCIELKPDFVKGYARKGHAYFWTKQYNRALQAYDEGLKVDPSNADCKDGRYR 467



>gb:AK004688_1152511 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200010C09
           product:HRD1 homolog [Homo sapiens], full insert
           sequence.>gb:BC046829_2099403 Mus musculus synovial
           apoptosis inhibitor 1, synoviolin, mRNA (cDNA clone
           MGC:61286 IMAGE:6811574), complete cds.
          Length = 612

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 20/53 (37%), Positives = 24/53 (45%)
 Frame = -2

Query: 656 TFGPPRSALSFHSTLLTDKAP*HYRPSTAPTRSDPQRPSQFARPYSPRASIPP 498
           + GPPR A S + T  T        PST+   S+   PS  A P  P A  PP
Sbjct: 524 SLGPPRPATSVNPTEETASTVVSAAPSTSAPSSEAPTPSPGASPPIPEAEKPP 576



>gb:BX572097_798207 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 918

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 18/61 (29%), Positives = 36/61 (59%)
 Frame = +2

Query: 482 EALHKRAELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSY 661
           + L +RAE+ L  S  +++ + +E L+E+       V+   LL +C +++E +E+A K+ 
Sbjct: 168 QQLEQRAEVSLQSSLDQKVSTELEALVEAT-FTSRGVRRNSLLWQCQQQRERAEDALKTA 226

Query: 662 E 664
           E
Sbjct: 227 E 227



>gb:AE017235_413099 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 9 of 16 of the complete
           genome.>gb:AE016958_1056503 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 268

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 18/62 (29%), Positives = 33/62 (53%)
 Frame = +2

Query: 503 ELKLAVSKGEQIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQ 682
           E++ AV+   Q   + ED  ++      +V+G  +L   YEK + S+   ++ EDA+ I 
Sbjct: 137 EMEKAVANLVQAGLSPEDAFDTYSAISVHVRGSVVLQRLYEKNQSSDVGPRAIEDAVAID 196

Query: 683 PD 688
           P+
Sbjct: 197 PE 198



>gb:AE012933_287271 Chlorobium tepidum TLS section 154 of 194 of the
           complete genome.>gb:AE006470_934439 Chlorobium tepidum
           TLS complete genome.
          Length = 465

 Score = 33.1 bits (74), Expect = 8.9
 Identities = 17/61 (27%), Positives = 34/61 (55%)
 Frame = +2

Query: 533 QIDSAVEDLIESVRLKGDNVKGLCLLGECYEKKELSEEARKSYEDALKIQPDYSAAQDAL 712
           +I+ A E   +++ ++ D++  L  LG   E+ E   EA   Y+  +++ P+++ A  AL
Sbjct: 253 RIEDAAESYTKTLEIEPDDINALYNLGIAREELEQYSEAIACYKRCIELNPEFADAWFAL 312

Query: 713 A 715
           A
Sbjct: 313 A 313


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 808,504,524
Number of Sequences: 1806583
Number of extensions: 13808640
Number of successful extensions: 45777
Number of sequences better than 10.0: 122
Number of HSP's better than 10.0 without gapping: 43538
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45723
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 74779971000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)