BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2407
         (633 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY429440_1605843 Gossypium barbadense fiber protein Fb19 mRNA...   228   8e-59   
pir|F84918|F84918 hypothetical protein At2g47710 [imported] - Ar...   222   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AY086842_1571884 Arabidopsis thaliana clone 2847 mRNA, comple...   219   2e-56   
gb:AY589695_1616575 Mirabilis jalapa clone FS-25 putative univer...   193   2e-48   
gb:AP004300_1839813 Oryza sativa (japonica cultivar-group) genom...   182   5e-45   
gb:AF491815_1804877 Oryza sativa (indica cultivar-group) putativ...   181   1e-44   
gb:ATAC016795_1543606 Arabidopsis thaliana chromosome III BAC F2...   128   9e-29   
gb:AY088520_1573539 Arabidopsis thaliana clone 7474 mRNA, comple...   124   2e-27   
gb:AC092556_1735468 Oryza sativa chromosome 3 BAC OSJNBa0047E24 ...   112   7e-24   
gb:BT005843_1638765 Arabidopsis thaliana At1g09740 gene, complet...   111   9e-24   
pir|C86231|C86231 hypothetical protein [imported] - Arabidopsis ...   111   1e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP002871_1823510 Oryza sativa (japonica cultivar-group) genom...   108   7e-23   
gb:AB017061_1513325 Arabidopsis thaliana genomic DNA, chromosome...   107   1e-22   
gb:AE016959_1022756 Oryza sativa (japonica cultivar-group) chrom...   105   6e-22   
gb:BT004026_1637140 Arabidopsis thaliana clone RAFL15-12-A17 (R2...   102   5e-21   
gb:AF139378_1771410 Lupinus luteus LlDD2A18 mRNA, complete cds.        99   8e-20   
gb:AF096262_1767812 Lycopersicon esculentum ER6 protein mRNA, pa...    98   1e-19   
gb:AP003077_1824681 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AP004159_1838384 Oryza sativa (japonica cultivar-group) genom...    89   8e-17   
gb:AY035146_1559914 Arabidopsis thaliana unknown protein (At3g62...    89   8e-17   
gb:AY224503_1590705 Oryza sativa (japonica cultivar-group) isola...    63   9e-16   
pir|F96706|F96706 unknown protein, 44604-45347 [imported] - Arab...    82   7e-15   Arabidopsis thaliana [mouse-ear cress]
gb:BA000045_742764 Gloeobacter violaceus PCC 7421 DNA, complete ...    78   1e-13   
pir|F86247|F86247 protein T23J18.3 [imported] - Arabidopsis thal...    74   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP004068_1837199 Oryza sativa (japonica cultivar-group) genom...    70   3e-11   
gb:AP005126_1848240 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AP005126_1848239 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:AC087425_1734059 Oryza sativa (japonica cultivar-group) chrom...    70   4e-11   
gb:AK175268_1817256 Arabidopsis thaliana mRNA, complete cds, clo...    69   5e-11   
gb:AK176860_1818848 Arabidopsis thaliana mRNA, complete cds, clo...    69   9e-11   
gb:AK176819_1818807 Arabidopsis thaliana mRNA, complete cds, clo...    69   9e-11   
gb:AK176355_1818343 Arabidopsis thaliana mRNA, complete cds, clo...    69   9e-11   
gb:AK175883_1817871 Arabidopsis thaliana mRNA, complete cds, clo...    69   9e-11   
gb:AY084304_1569396 Arabidopsis thaliana clone 10313 mRNA, compl...    69   9e-11   
pir|T05756|T05756 hypothetical protein M4I22.130 - Arabidopsis t...    69   9e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T45665|T45665 hypothetical protein F14P22.40 - Arabidopsis t...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AY070394_1566793 Arabidopsis thaliana unknown protein (At5g54...    65   9e-10   
gb:AB026634_1517037 Arabidopsis thaliana genomic DNA, chromosome...    65   9e-10   
gb:AP003368_1828577 Oryza sativa (japonica cultivar-group) genom...    61   1e-08   
pir|T36954|T36954 hypothetical protein SCJ1.21 - Streptomyces co...    60   2e-08   Streptomyces coelicolor
gb:ATAC009325_1542883 Arabidopsis thaliana chromosome III BAC F4...    60   3e-08   
gb:AF480496_1803736 Oryza sativa clone BAC 49D11, complete seque...    60   4e-08   
gb:AC007119_1535260 Arabidopsis thaliana chromosome 2 clone F2G1...    59   5e-08   
gb:AY084275_1569367 Arabidopsis thaliana clone 102038 mRNA, comp...    59   7e-08   
gb:AY052696_1562856 Arabidopsis thaliana AT3g01520/F4P13_7 mRNA,...    59   7e-08   
gb:AC130597_1740691 Oryza sativa (japonica cultivar-group) chrom...    57   2e-07   
gb:AB039925_1519379 Arabidopsis thaliana mRNA for RD2 protein, c...    57   2e-07   
gb:AB026636_1517055 Arabidopsis thaliana genomic DNA, chromosome...    57   2e-07   
gb:AY223460_1176918 Schistosoma japonicum clone ZZZ49 mRNA seque...    57   3e-07   
sp|Q57951|Y531_METJA|Y531_METJA Hypothetical protein MJ0531.>pir|C64366|C64...    56   4e-07   Methanocaldococcus jannaschii
gb:VFA271816_1727095 Vicia faba mRNA for early nodulin ENOD18 (e...    56   6e-07   
gb:VFA271815_1727094 Vicia faba mRNA for early nodulin ENOD18 (e...    56   6e-07   
gb:AB110169_1526882 Oryza sativa (japonica cultivar-group) mRNA ...    56   6e-07   
pir|T48641|T48641 hypothetical protein T15N1.170 - Arabidopsis t...    56   6e-07   Arabidopsis thaliana [mouse-ear cress]
gb:VFA277286_1727096 Vicia faba partial enod18 gene, exons 1-4.        55   8e-07   
pir|E90349|E90349 conserved hypothetical protein [imported] - Su...    55   8e-07   Saccharolobus solfataricus
gb:AP005323_1850631 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AE017180_400629 Geobacter sulfurreducens PCA, complete genome.      55   1e-06   
gb:BX294153_771173 Pirellula sp. strain 1 complete genome; segme...    54   3e-06   
pir|B86857|B86857 conserved hypothetical protein ytcD [imported]...    54   3e-06   Lactococcus lactis subsp. lactis
gb:AY220736_1590528 Hordeum vulgare pathogen induced protein 2-4...    53   4e-06   
gb:BA000023_692178 Sulfolobus tokodaii str. 7 DNA, complete genome.    53   4e-06   
gb:AY050416_1562193 Arabidopsis thaliana At1g11360/T23J18_35 mRN...    53   5e-06   
gb:AE017180_398567 Geobacter sulfurreducens PCA, complete genome.      52   8e-06   
pir|C86634|C86634 conserved hypothetical protein yahB [imported]...    52   8e-06   Lactococcus lactis subsp. lactis
gb:AC084817_1733843 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
gb:BA000035_717572 Corynebacterium efficiens YS-314 DNA, complet...    52   1e-05   
gb:AP003242_1826082 Oryza sativa (japonica cultivar-group) genom...    51   1e-05   
gb:ATAC012328_1543412 Arabidopsis thaliana chromosome III BAC T1...    51   2e-05   
gb:AE011302_271449 Leptospira interrogans serovar lai str. 56601...    51   2e-05   
gb:BA000043_739332 Geobacillus kaustophilus HTA426 DNA, complete...    50   2e-05   
pir|AG1946|AG1946 hypothetical protein all1122 [imported] - Nost...    50   2e-05   Nostoc sp. PCC 7120
sp|P72745|YB01_SYNY3|YB01_SYNY3 Hypothetical protein slr1101.>pir|S74608|S7...    50   2e-05   Synechocystis sp.
pir|A70942|A70942 hypothetical protein Rv2026c - Mycobacterium t...    50   3e-05   Mycobacterium tuberculosis
gb:AJ630657_1812770 Cicer arietinum mRNA for putative universal ...    50   4e-05   
gb:AY297449_1596430 Solanum tuberosum anti-bacterial protein (ap...    49   5e-05   
gb:AL935259_552253 Lactobacillus plantarum strain WCFS1 complete...    49   5e-05   
gb:AE017202_404157 Lactobacillus johnsonii NCC 533, section 3 of...    49   5e-05   
pir|F95336|F95336 hypothetical protein SMa1100 [imported] - Sino...    49   5e-05   Sinorhizobium meliloti
gb:AC116986_1207547 Dictyostelium discoideum chromosome 2 map 22...    49   7e-05   
gb:BX248360_763527 Corynebacterium diphtheriae gravis NCTC13129,...    49   7e-05   
gb:BA000039_728156 Thermosynechococcus elongatus BP-1 DNA, compl...    49   9e-05   
gb:AE016950_365146 Enterococcus faecalis V583, section 4 of 11 o...    49   9e-05   
sp|P42297|YXIE_BACSU|YXIE_BACSU Hypothetical protein yxiE precursor.>pir|A7...    48   1e-04   Bacillus subtilis
gb:AP006618_559393 Nocardia farcinica IFM 10152 DNA, complete ge...    48   2e-04   
pir|G86734|G86734 conserved hypothetical protein yjaB [imported]...    48   2e-04   Lactococcus lactis subsp. lactis
pir|A69233|A69233 conserved hypothetical protein MTH993 - Methan...    48   2e-04   Methanothermobacter thermautotrophicus str. Delta H
gb:AY050353_1562132 Arabidopsis thaliana At2g21620/F2G1.11 mRNA,...    47   2e-04   
gb:BX294152_771171 Pirellula sp. strain 1 complete genome; segme...    47   2e-04   
gb:AE017180_399417 Geobacter sulfurreducens PCA, complete genome.      47   2e-04   
pir|T36949|T36949 conserved hypothetical protein SCJ1.16c - Stre...    47   2e-04   Streptomyces coelicolor
pir|T45939|T45939 hypothetical protein F5K20.290 - Arabidopsis t...    47   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AE017355_463502 Bacillus thuringiensis serovar konkukian str....    47   3e-04   
pir|H84635|H84635 probable protein kinase [imported] - Arabidops...    47   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY223450_1176909 Schistosoma japonicum clone ZZZ463 mRNA sequ...    47   3e-04   
gb:BA000036_720670 Corynebacterium glutamicum ATCC 13032 DNA, co...    47   3e-04   
gb:AE017233_412446 Mycobacterium avium subsp. paratuberculosis s...    47   3e-04   
gb:CP000033_88465 Lactobacillus acidophilus NCFM, complete genome.     47   3e-04   
pir|AI1885|AI1885 hypothetical protein all0634 [imported] - Nost...    47   3e-04   Nostoc sp. PCC 7120
gb:BA000045_743625 Gloeobacter violaceus PCC 7421 DNA, complete ...    46   5e-04   
gb:AP006618_559436 Nocardia farcinica IFM 10152 DNA, complete ge...    46   5e-04   
gb:AE013140_289508 Thermoanaerobacter tengcongensis MB4, section...    46   5e-04   
gb:CR628336_111112 Legionella pneumophila str. Paris complete ge...    46   5e-04   
gb:CR628337_115513 Legionella pneumophila str. Lens complete gen...    46   6e-04   
pir|A69220|A69220 conserved hypothetical protein MTH898 - Methan...    46   6e-04   Methanothermobacter thermautotrophicus str. Delta H
gb:BA000045_744289 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   8e-04   
gb:BA000028_696577 Oceanobacillus iheyensis HTE831 DNA, complete...    45   8e-04   
gb:AE017333_446916 Bacillus licheniformis DSM 13, complete genom...    45   8e-04   
gb:AE016822_341146 Leifsonia xyli subsp. xyli str. CTCB07, compl...    45   8e-04   
gb:AE014295_312320 Bifidobacterium longum NCC2705, complete genome.    45   8e-04   
gb:AY596298_634841 Haloarcula marismortui ATCC 43049 chromosome ...    45   0.001   
gb:AE017354_459308 Legionella pneumophila subsp. pneumophila str...    45   0.001   
gb:AE010314_261774 Methanopyrus kandleri AV19 section 13 of 157 ...    45   0.001   
gb:CR628337_114164 Legionella pneumophila str. Lens complete gen...    45   0.001   
gb:AE017306_437326 Thermus thermophilus HB27 section 6 of 7 of t...    45   0.001   
gb:AE013564_293407 Methanosarcina mazei strain Goe1, section 346...    45   0.001   
gb:NSP561198_156233 Actinomadura sp. ATCC 39727 gene cluster for...    45   0.001   
pir|AD1900|AD1900 hypothetical protein alr0750 [imported] - Nost...    45   0.001   Nostoc sp. PCC 7120
pir|H84047|H84047 hypothetical protein BH3184 [imported] - Bacil...    45   0.001   Bacillus halodurans
pir|A90454|A90454 conserved hypothetical protein [imported] - Su...    45   0.001   Saccharolobus solfataricus
gb:BA000045_742059 Gloeobacter violaceus PCC 7421 DNA, complete ...    44   0.002   
gb:AP006627_565518 Bacillus clausii KSM-K16 DNA, complete genome.      44   0.002   
gb:AE017200_403499 Lactobacillus johnsonii NCC 533, section 1 of...    44   0.002   
gb:AE011122_269378 Methanosarcina acetivorans str. C2A, section ...    44   0.002   
gb:CP000033_89064 Lactobacillus acidophilus NCFM, complete genome.     44   0.002   
pir|B81866|B81866 conserved hypothetical protein NMA1703 [import...    44   0.002   Neisseria meningitidis serogroup A
pir|H81076|H81076 conserved hypothetical protein NMB1500 [import...    44   0.002   Neisseria meningitidis serogroup B
gb:AP008231_579946 Synechococcus elongatus PCC 6301 DNA, complet...    44   0.002   
gb:AE017000_375626 Bacillus cereus ATCC 14579 section 3 of 18 of...    44   0.002   
gb:AE016956_366979 Enterococcus faecalis V583, section 10 of 11 ...    44   0.002   
gb:SAG766852_171249 Streptococcus agalactiae NEM316 complete gen...    44   0.002   
pir|AH2004|AH2004 hypothetical protein all1590 [imported] - Nost...    44   0.002   Nostoc sp. PCC 7120
gb:BX571966_793263 Burkholderia pseudomallei strain K96243, chro...    44   0.003   
gb:AE017355_461888 Bacillus thuringiensis serovar konkukian str....    44   0.003   
gb:AE017266_421954 Bacillus cereus ATCC 10987, section 3 of 18 o...    44   0.003   
gb:AE017026_380912 Bacillus anthracis str. Ames section 3 of 18 ...    44   0.003   
gb:BX571966_794088 Burkholderia pseudomallei strain K96243, chro...    43   0.004   
gb:AP008226_577752 Thermus thermophilus HB8 genomic DNA, complet...    43   0.004   
gb:AE017282_428495 Methylococcus capsulatus str. Bath, complete ...    43   0.004   
gb:AE017180_398819 Geobacter sulfurreducens PCA, complete genome.      43   0.004   
gb:AE013379_291784 Methanosarcina mazei strain Goe1, section 161...    43   0.004   
gb:AE011032_268590 Methanosarcina acetivorans str. C2A, section ...    43   0.004   
gb:CR543861_103924 Acinetobacter sp. ADP1 complete genome.             43   0.004   
gb:AE004969_60677 Neisseria gonorrhoeae FA 1090, complete genome.      43   0.004   
pir|B89955|B89955 conserved hypothetical protein SA1532 [importe...    43   0.004   Staphylococcus aureus subsp. aureus N315
gb:BT006183_1639075 Arabidopsis thaliana clone RAFL15-32-F07 (R5...    43   0.005   
gb:AB023045_1515511 Arabidopsis thaliana genomic DNA, chromosome...    43   0.005   
gb:BX957220_843838 Methanococcus maripaludis S2 complete genome;...    43   0.005   
gb:BA000045_740765 Gloeobacter violaceus PCC 7421 DNA, complete ...    43   0.005   
gb:AE017316_440345 Desulfovibrio vulgaris subsp. vulgaris str. H...    43   0.005   
gb:AE013379_291786 Methanosarcina mazei strain Goe1, section 161...    43   0.005   
gb:SCO939130_180913 Streptomyces coelicolor A3(2) complete genom...    43   0.005   
pir|C69829|C69829 conserved hypothetical protein yheK - Bacillus...    43   0.005   Bacillus subtilis
sp|O07552|NHAX_BACSU|NHAX_BACSU Stress response protein nhaX.>gb:BSUB0006_7...    43   0.005   Bacillus subtilis
gb:AY774040_2148753 Synthetic construct Francisella tularensis c...    42   0.007   
gb:AL935260_552326 Lactobacillus plantarum strain WCFS1 complete...    42   0.007   
gb:AJ749949_530702 Francisella tularensis subsp. tularensis comp...    42   0.007   
gb:AE017312_439146 Desulfovibrio vulgaris subsp. vulgaris str. H...    42   0.007   
gb:AE009873_256778 Pyrobaculum aerophilum strain IM2 section 128...    42   0.007   
gb:CP000031_85193 Silicibacter pomeroyi DSS-3, complete genome.        42   0.007   
gb:AY596297_634540 Haloarcula marismortui ATCC 43049 chromosome ...    42   0.009   
gb:AE016863_351556 Pseudomonas syringae pv. tomato str. DC3000 s...    42   0.009   
pir|D84603|D84603 hypothetical protein At2g21620 [imported] - Ar...    42   0.009   Arabidopsis thaliana [mouse-ear cress]
gb:BA000039_725939 Thermosynechococcus elongatus BP-1 DNA, compl...    42   0.011   
gb:AY596297_634681 Haloarcula marismortui ATCC 43049 chromosome ...    42   0.011   
gb:AE012789_285596 Chlorobium tepidum TLS section 10 of 194 of t...    42   0.011   
pir|AI2537|AI2537 hypothetical protein all7588 [imported] - Nost...    42   0.011   Nostoc sp. PCC 7120
pir|H98097|H98097 conserved hypothetical protein spr1810 [import...    42   0.011   Streptococcus pneumoniae R6
gb:BX248357_762434 Corynebacterium diphtheriae gravis NCTC13129,...    41   0.015   
gb:AP006618_559293 Nocardia farcinica IFM 10152 DNA, complete ge...    41   0.015   
gb:AE013233_290453 Methanosarcina mazei strain Goe1, section 15 ...    41   0.015   
pir|D86904|D86904 conserved hypothetical protein yxbE [imported]...    41   0.015   Lactococcus lactis subsp. lactis
gb:AC121363_1740150 Oryza sativa (japonica cultivar-group) chrom...    41   0.019   
gb:BX321856_772419 Nitrosomonas europaea ATCC 19718, complete ge...    41   0.019   
gb:BA000011_665087 Thermoplasma volcanium GSS1 DNA, complete gen...    41   0.019   
gb:CR382130_1663384 Yarrowia lipolytica chromosome D of strain C...    40   0.025   
gb:CR382130_1662945 Yarrowia lipolytica chromosome D of strain C...    40   0.025   
gb:BX294153_771175 Pirellula sp. strain 1 complete genome; segme...    40   0.025   
gb:AE013379_291782 Methanosarcina mazei strain Goe1, section 161...    40   0.025   
gb:AF206717_2141944 Shuttle vector pI3 hypothetical proteins, Ht...    40   0.033   
gb:BX640450_817185 Bordetella bronchiseptica strain RB50, comple...    40   0.033   
gb:BA000045_741907 Gloeobacter violaceus PCC 7421 DNA, complete ...    40   0.033   
gb:AF377337_505671 Myxococcus xanthus serine/threonine kinase Pk...    40   0.033   
gb:AE017333_450128 Bacillus licheniformis DSM 13, complete genom...    40   0.033   
gb:AE017327_444028 Listeria monocytogenes str. 4b F2365, section...    40   0.033   
gb:AE017233_412447 Mycobacterium avium subsp. paratuberculosis s...    40   0.033   
gb:AE015010_314125 Streptococcus mutans UA159 section 158 of 185...    40   0.033   
pir|AF1634|AF1634 hypothetical protein homolog lin1615 [imported...    40   0.033   Listeria innocua
pir|AD1272|AD1272 hypothetical protein lmo1580 [imported] - List...    40   0.033   Listeria monocytogenes
pir|F95233|F95233 universal stress protein family [imported] - S...    40   0.033   Streptococcus pneumoniae
gb:BX294140_767628 Pirellula sp. strain 1 complete genome; segme...    40   0.043   
gb:CP000027_80273 Dehalococcoides ethenogenes 195, complete genome.    40   0.043   
pir|F70572|F70572 hypothetical protein Rv2623 - Mycobacterium tu...    40   0.043   Mycobacterium tuberculosis
pir|A75310|A75310 hypothetical protein - Deinococcus radiodurans...    40   0.043   Deinococcus radiodurans
sp|P74148|YD88_SYNY3|YD88_SYNY3 Hypothetical protein sll1388.>pir|S75674|S7...    40   0.043   Synechocystis sp.
gb:CR382137_1669910 Debaryomyces hansenii chromosome E of strain...    39   0.056   
gb:BX572604_803047 Rhodopseudomonas palustris CGA009 complete ge...    39   0.056   
gb:BX571966_795200 Burkholderia pseudomallei strain K96243, chro...    39   0.056   
gb:BA000030_699161 Streptomyces avermitilis MA-4680 genomic DNA,...    39   0.056   
gb:AL935255_551156 Lactobacillus plantarum strain WCFS1 complete...    39   0.056   
gb:AE017233_412459 Mycobacterium avium subsp. paratuberculosis s...    39   0.056   
gb:AE016925_359261 Chromobacterium violaceum ATCC 12472 section ...    39   0.056   
gb:CR522870_100185 Desulfotalea psychrophila LSv54 chromosome.         39   0.056   
gb:CR378680_98519 Photobacterium profundum SS9 chromosome 2; seg...    39   0.056   
pir|G70572|G70572 hypothetical protein Rv2624c - Mycobacterium t...    39   0.056   Mycobacterium tuberculosis
pir|A86854|A86854 conserved hypothetical protein ytaA [imported]...    39   0.056   Lactococcus lactis subsp. lactis
sp|Q10851|YK05_MYCTU|YK05_MYCTU Hypothetical protein Rv2005c/MT2061/Mb2028c...    39   0.056   Mycobacterium tuberculosis
gb:BA000036_719097 Corynebacterium glutamicum ATCC 13032 DNA, co...    39   0.073   
gb:AL935258_552008 Lactobacillus plantarum strain WCFS1 complete...    39   0.073   
pir|C90503|C90503 conserved hypothetical protein [imported] - Su...    39   0.073   Saccharolobus solfataricus
gb:AY588238_630448 Lactobacillus sakei universal stress protein ...    39   0.095   
gb:AE017331_445069 Listeria monocytogenes str. 4b F2365, section...    39   0.095   
gb:AE016966_369162 Coxiella burnetii strain RSA 493, section 7 o...    39   0.095   
gb:TACID2_196358 Thermoplasma acidophilum complete genome; segme...    39   0.095   
gb:CR522870_99227 Desulfotalea psychrophila LSv54 chromosome.          39   0.095   
gb:CP000029_81874 Staphylococcus epidermidis RP62A, complete gen...    39   0.095   
pir|AH1408|AH1408 conserved hypothetical protein lmo2673 [import...    39   0.095   Listeria monocytogenes
pir|AF1784|AF1784 conserved hypothetical protein lin2820 [import...    39   0.095   Listeria innocua
sp|O27222|YB54_METTH|YB54_METTH Hypothetical protein MTH1154.>pir|G69020|G6...    39   0.095   Methanothermobacter thermautotrophicus
gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome...    38   0.12    
gb:BA000035_716283 Corynebacterium efficiens YS-314 DNA, complet...    38   0.12    
gb:AY596297_634391 Haloarcula marismortui ATCC 43049 chromosome ...    38   0.12    
gb:AE017302_436179 Thermus thermophilus HB27 section 2 of 7 of t...    38   0.12    
pir|AD2010|AD2010 hypothetical protein alr1634 [imported] - Nost...    38   0.12    Nostoc sp. PCC 7120
pir|D69008|D69008 conserved hypothetical protein MTH1065 - Metha...    38   0.12    Methanothermobacter thermautotrophicus str. Delta H
gb:CP000001_854968 Bacillus cereus ZK, complete genome.                38   0.16    
gb:BX321859_773356 Nitrosomonas europaea ATCC 19718, complete ge...    38   0.16    
gb:BA000040_733942 Bradyrhizobium japonicum USDA 110 DNA, comple...    38   0.16    
gb:BA000031_705779 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    38   0.16    
gb:BA000023_693055 Sulfolobus tokodaii str. 7 DNA, complete genome.    38   0.16    
gb:AE017013_379488 Bacillus cereus ATCC 14579 section 16 of 18 o...    38   0.16    
gb:CP000027_79677 Dehalococcoides ethenogenes 195, complete genome.    38   0.16    
gb:CP000027_79643 Dehalococcoides ethenogenes 195, complete genome.    38   0.16    
sp|P45680|YJ16_COXBU|YJ16_COXBU Hypothetical protein CBU1916.>pir|I40650|I4...    38   0.16    Coxiella burnetii
gb:CP000003_861432 Streptococcus pyogenes MGAS10394, complete ge...    37   0.21    
gb:BX569694_776881 Synechococcus sp. WH8102 complete genome; seg...    37   0.21    
gb:BA000045_744243 Gloeobacter violaceus PCC 7421 DNA, complete ...    37   0.21    
gb:BA000039_728053 Thermosynechococcus elongatus BP-1 DNA, compl...    37   0.21    
gb:AE016953_365989 Enterococcus faecalis V583, section 7 of 11 o...    37   0.21    
gb:AE016784_332070 Pseudomonas putida KT2440 section 11 of 21 of...    37   0.21    
gb:AE014165_305023 Streptococcus pyogenes MGAS315, section 30 of...    37   0.21    
gb:AE013379_291783 Methanosarcina mazei strain Goe1, section 161...    37   0.21    
gb:AE010090_259249 Streptococcus pyogenes strain MGAS8232, secti...    37   0.21    
gb:AE006605_220640 Streptococcus pyogenes M1 GAS, section 134 of...    37   0.21    
gb:SPAC57A7_1718090 S.pombe chromosome I cosmid c57A7.                 37   0.28    
gb:BX640435_812299 Bordetella parapertussis strain 12822, comple...    37   0.28    
gb:AL935257_551513 Lactobacillus plantarum strain WCFS1 complete...    37   0.28    
gb:AE016799_335442 Vibrio vulnificus CMCP6 chromosome I section ...    37   0.28    
pir|T37029|T37029 hypothetical protein SCJ12.10c - Streptomyces ...    37   0.28    Streptomyces coelicolor
sp|P87132|YFK5_SCHPO|YFK5_SCHPO Hypothetical protein C167.05 in chromosome ...    37   0.28    Schizosaccharomyces pombe
sp|Q50777|YB54_METTM|YB54_METTM Hypothetical 16.1 kDa protein in MTR region...    37   0.28    Methanothermobacter thermautotrophicus
gb:BX571966_794396 Burkholderia pseudomallei strain K96243, chro...    37   0.36    
gb:BA000040_731679 Bradyrhizobium japonicum USDA 110 DNA, comple...    37   0.36    
gb:AY596297_632173 Haloarcula marismortui ATCC 43049 chromosome ...    37   0.36    
gb:AE013496_292852 Methanosarcina mazei strain Goe1, section 278...    37   0.36    
gb:AE013379_291785 Methanosarcina mazei strain Goe1, section 161...    37   0.36    
gb:AE011032_268592 Methanosarcina acetivorans str. C2A, section ...    37   0.36    
pir|T36962|T36962 hypothetical protein SCJ1.29c - Streptomyces c...    37   0.36    Streptomyces coelicolor
pir|T48559|T48559 probable receptor-like kinase - Arabidopsis th...    37   0.36    Arabidopsis thaliana [mouse-ear cress]
gb:AP003022_1824288 Oryza sativa (japonica cultivar-group) genom...    36   0.47    
gb:CP000023_875488 Streptococcus thermophilus LMG 18311, complet...    36   0.47    
gb:BX321861_773834 Nitrosomonas europaea ATCC 19718, complete ge...    36   0.47    
gb:AY596296_631313 Haloarcula marismortui ATCC 43049 plasmid pNG...    36   0.47    
gb:AP006840_568113 Symbiobacterium thermophilum DNA, complete ge...    36   0.47    
gb:AF496313_516193 Lactobacillus delbrueckii subsp. lactis rod-s...    36   0.47    
gb:AE013307_291154 Methanosarcina mazei strain Goe1, section 89 ...    36   0.47    
pir|G84340|G84340 hypothetical protein Vng1898c [imported] - Hal...    36   0.47    Halobacterium salinarum
gb:AE017356_1760365 Cryptococcus neoformans var. neoformans JEC2...    36   0.62    
gb:AE017356_1760364 Cryptococcus neoformans var. neoformans JEC2...    36   0.62    
gb:BA000030_698800 Streptomyces avermitilis MA-4680 genomic DNA,...    36   0.62    
gb:AP008231_580525 Synechococcus elongatus PCC 6301 DNA, complet...    36   0.62    
gb:AP008226_578352 Thermus thermophilus HB8 genomic DNA, complet...    36   0.62    
gb:CP000031_84655 Silicibacter pomeroyi DSS-3, complete genome.        36   0.62    
sp|Q57997|Y577_METJA|Y577_METJA Protein MJ0577.>pir|A64372|A64372 hypotheti...    36   0.62    Methanocaldococcus jannaschii
gb:AB023041_1515447 Arabidopsis thaliana genomic DNA, chromosome...    35   0.80    
gb:BA000039_725943 Thermosynechococcus elongatus BP-1 DNA, compl...    35   0.80    
gb:AE016868_352907 Pseudomonas syringae pv. tomato str. DC3000 s...    35   0.80    
gb:AE013233_290455 Methanosarcina mazei strain Goe1, section 15 ...    35   0.80    
gb:AE010815_266812 Methanosarcina acetivorans str. C2A, section ...    35   0.80    
gb:AB110611_13523 Pseudomonas sp. MT-1 nar gene cluster (orf1, o...    35   0.80    
gb:T1N24_1723646 Arabidopsis thaliana BAC T1N24.                       35   1.1     
gb:AP006618_559966 Nocardia farcinica IFM 10152 DNA, complete ge...    35   1.1     
gb:AL646064_546432 Ralstonia solanacearum GMI1000 chromosome, co...    35   1.1     
gb:AL646057_545112 Ralstonia solanacearum GMI1000 chromosome, co...    35   1.1     
gb:AE012848_286276 Chlorobium tepidum TLS section 69 of 194 of t...    35   1.1     
gb:CR543861_104687 Acinetobacter sp. ADP1 complete genome.             35   1.1     
gb:AE000516_22101 Mycobacterium tuberculosis CDC1551, complete g...    35   1.1     
pir|AG1916|AG1916 hypothetical protein alr0882 [imported] - Nost...    35   1.1     
pir|H83231|H83231 conserved hypothetical protein PA3309 [importe...    35   1.1     
sp|P74897|YQA3_THEAQ|YQA3_THEAQ Hypothetical 14.6 kDa protein in QAH/OAS su...    35   1.1     
sp|Q10862|YJ96_MYCTU|YJ96_MYCTU Hypothetical protein Rv1996/MT2052/Mb2019.>...    35   1.1     
gb:AB012239_1511663 Arabidopsis thaliana genomic DNA, chromosome...    35   1.4     
gb:CP000020_870448 Vibrio fischeri ES114 chromosome I, complete ...    35   1.4     
gb:AY596297_634641 Haloarcula marismortui ATCC 43049 chromosome ...    35   1.4     
gb:AE017311_438797 Desulfovibrio vulgaris subsp. vulgaris str. H...    35   1.4     
pir|AD1139|AD1139 conserved hypothetical protein lmo0515 [import...    35   1.4     
pir|AC1497|AC1497 conserved hypothetical protein lin0515 [import...    35   1.4     
sp|Q898N5|HCP_CLOTE|HCP_CLOTE Hydroxylamine reductase (EC 1.7.-.-) (Hybrid...    35   1.4     
gb:AP005412_1851384 Oryza sativa (japonica cultivar-group) genom...    34   1.8     
gb:AY086786_1571829 Arabidopsis thaliana clone 2767 mRNA, comple...    34   1.8     
gb:AY596297_632195 Haloarcula marismortui ATCC 43049 chromosome ...    34   1.8     
gb:AE017180_399280 Geobacter sulfurreducens PCA, complete genome.      34   1.8     
gb:AE014295_310748 Bifidobacterium longum NCC2705, complete genome.    34   1.8     
gb:AE012065_279055 Xanthomonas axonopodis pv. citri str. 306, se...    34   1.8     
gb:SAG766853_171306 Streptococcus agalactiae NEM316 complete gen...    34   1.8     
gb:CR543861_104689 Acinetobacter sp. ADP1 complete genome.             34   1.8     
gb:AP003332_1828067 Oryza sativa (japonica cultivar-group) genom...    34   2.3     
gb:AY596297_633517 Haloarcula marismortui ATCC 43049 chromosome ...    34   2.3     
gb:AP006840_569583 Symbiobacterium thermophilum DNA, complete ge...    34   2.3     
gb:AE017340_457884 Idiomarina loihiensis L2TR, complete genome.        34   2.3     
gb:AE016918_357337 Chromobacterium violaceum ATCC 12472 section ...    34   2.3     
gb:AE016782_331559 Pseudomonas putida KT2440 section 9 of 21 of ...    34   2.3     
gb:AE012523_283243 Xanthomonas campestris pv. campestris str. AT...    34   2.3     
gb:AE005154_64028 Halobacterium sp. NRC-1 plasmid pNRC200 sectio...    34   2.3     
pir|D75282|D75282 conserved hypothetical protein - Deinococcus r...    34   2.3     
pir|S74555|S74555 hypothetical protein slr0244 - Synechocystis s...    34   2.3     
pir|E83426|E83426 conserved hypothetical protein PA1753 [importe...    34   2.3     
pir|A69071|A69071 conserved hypothetical protein MTH153 - Methan...    34   2.3     
gb:BX640412_804854 Bordetella pertussis strain Tohama I, complet...    33   3.1     
gb:AY596294_630936 Haloarcula marismortui ATCC 43049 plasmid pNG...    33   3.1     
gb:AP006878_577186 Thermococcus kodakaraensis strain KOD1 DNA, c...    33   3.1     
gb:AE013225_290384 Methanosarcina mazei strain Goe1, section 7 o...    33   3.1     
gb:AE010988_268181 Methanosarcina acetivorans str. C2A, section ...    33   3.1     
gb:AE010945_267833 Methanosarcina acetivorans str. C2A, section ...    33   3.1     
gb:AE010673_265551 Methanosarcina acetivorans str. C2A, section ...    33   3.1     
pir|H83101|H83101 conserved hypothetical protein PA4352 [importe...    33   3.1     
gb:AP003297_1827574 Oryza sativa (japonica cultivar-group) genom...    33   4.0     
gb:CR382131_1664385 Yarrowia lipolytica chromosome E of strain C...    33   4.0     
pir|T04490|T04490 hypothetical protein F8F16.50 - Arabidopsis th...    33   4.0     
pir|E84481|E84481 probable protein kinase [imported] - Arabidops...    33   4.0     
gb:AJ629845_2068485 Rattus norvegicus mRNA for SCO-spondin.            33   5.2     
gb:AY086194_1571249 Arabidopsis thaliana clone 22327 mRNA, compl...    33   5.2     
gb:AE016959_1023834 Oryza sativa (japonica cultivar-group) chrom...    33   5.2     
gb:AE005173_894520 Arabidopsis thaliana chromosome 1, bottom arm...    33   5.2     
gb:BX321860_773529 Nitrosomonas europaea ATCC 19718, complete ge...    33   5.2     
gb:BA000039_728257 Thermosynechococcus elongatus BP-1 DNA, compl...    33   5.2     
gb:BA000036_719134 Corynebacterium glutamicum ATCC 13032 DNA, co...    33   5.2     
gb:AP004237_555357 Proteus vulgaris plasmid Rts1 DNA, complete g...    33   5.2     
pir|G83701|G83701 hypothetical protein BH0415 [imported] - Bacil...    33   5.2     
gb:XELXDEL_2582280 Xenopus laevis X-Delta-1 gene, complete cds.        32   6.8     
gb:BC075742_2558706 Danio rerio cDNA clone MGC:86576 IMAGE:69027...    32   6.8     
gb:AF030031_2469416 Danio rerio DeltaA (deltaA) mRNA, complete cds.    32   6.8     
gb:AB095017_2464626 Cynops pyrrhogaster Delta-1 mRNA for ligand ...    32   6.8     
gb:MMU491857_2121694 Mus musculus mRNA for SCO-spondin (sco-spon...    32   6.8     
gb:AY358892_1947771 Homo sapiens clone DNA35916 DLL1 (UNQ146) mR...    32   6.8     
gb:AF196571_1889651 Homo sapiens Delta-like-1 protein (DLL1) mRN...    32   6.8     
gb:AY084798_1569882 Arabidopsis thaliana clone 118261 mRNA, comp...    32   6.8     
gb:AY084186_1296842 Drosophila melanogaster RE69157 full insert ...    32   6.8     
gb:AY497019_1188304 Mus musculus strain C57BL/6J chromosome 17 c...    32   6.8     
gb:AE014134_1128808 Drosophila melanogaster chromosome 2L, compl...    32   6.8     
gb:BX572598_801284 Rhodopseudomonas palustris CGA009 complete ge...    32   6.8     
gb:BA000040_730544 Bradyrhizobium japonicum USDA 110 DNA, comple...    32   6.8     
gb:AP008226_579406 Thermus thermophilus HB8 genomic DNA, complet...    32   6.8     
gb:AL646085_549931 Ralstonia solanacearum GMI1000 megaplasmid, c...    32   6.8     
gb:AF332574_502011 Desulfovibrio gigas putative lytic transglyco...    32   6.8     
gb:AE015489_314830 Shewanella oneidensis MR-1 section 38 of 457 ...    32   6.8     
gb:AE010346_262153 Methanopyrus kandleri AV19 section 45 of 157 ...    32   6.8     
gb:CR555306_105528 Azoarcus sp. EbN1 complete genome.                  32   6.8     
pir|AC2417|AC2417 hypothetical protein alr4891 [imported] - Nost...    32   6.8     
pir|AI3264|AI3264 universal stress protein family [imported] - B...    32   6.8     
pir|F83267|F83267 conserved hypothetical protein PA3017 [importe...    32   6.8     
pir|F84279|F84279 amino acid transporter [imported] - Halobacter...    32   6.8     
pir|I50719|I50719 C-Delta-1 - chicken>gb:GGU26590_2573563 Gallus...    32   6.8     
sp|P97677|DLL1_RAT|DLL1_RAT Delta-like protein 1 precursor (Drosophila De...    32   6.8     
sp|Q61483|DLL1_MOUSE|DLL1_MOUSE Delta-like protein 1 precursor (Drosophila ...    32   6.8     
sp|O00548|DLL1_HUMAN|DLL1_HUMAN Delta-like protein 1 precursor (Drosophila ...    32   6.8     
gb:AE014296_1137272 Drosophila melanogaster chromosome 3L, compl...    32   8.9     
gb:AE017261_419838 Picrophilus torridus DSM 9790, complete genome.     32   8.9     
gb:AE016785_332578 Pseudomonas putida KT2440 section 12 of 21 of...    32   8.9     
gb:AE015933_319242 Staphylococcus epidermidis ATCC 12228 plasmid...    32   8.9     
gb:CR543861_103209 Acinetobacter sp. ADP1 complete genome.             32   8.9     
gb:CP000031_84524 Silicibacter pomeroyi DSS-3, complete genome.        32   8.9     
pir|C70374|C70374 conserved hypothetical protein aq_855 - Aquife...    32   8.9     
pir|C82324|C82324 conserved hypothetical protein VC0428 [importe...    32   8.9     
pir|T01061|T01061 hypothetical protein YUP8H12R.45 - Arabidopsis...    32   8.9     
pir|B84307|B84307 hypothetical protein Vng1536c [imported] - Hal...    32   8.9     


>gb:AY429440_1605843 Gossypium barbadense fiber protein Fb19 mRNA,
           partial cds.
          Length = 151

 Score =  228 bits (580), Expect = 8e-59
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVST--FRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           V +DDSEHS YAL W LDHFF    S   F+LV+VHAKPS ++AV LAGPGAAD+LP+VD
Sbjct: 1   VGIDDSEHSTYALQWILDHFFAPFASNPPFKLVIVHAKPSASSAVGLAGPGAADVLPYVD 60

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           +DL+KIAARV+E+AKE+C SKSV D + E+ EGDA NVLC+ VEKHHASIL VGSHGYGA
Sbjct: 61  ADLRKIAARVVEKAKELCLSKSVHDAVVEVGEGDASNVLCDAVEKHHASILAVGSHGYGA 120

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           IKRAVLGSVSDYC+HHAHC+VMIVK+PK K
Sbjct: 121 IKRAVLGSVSDYCSHHAHCSVMIVKRPKIK 150



>pir|F84918|F84918 hypothetical protein At2g47710 [imported] -
           Arabidopsis thaliana>gb:AC005309_1532448 Arabidopsis
           thaliana chromosome 2 clone F17A22 map CIC06C03,
           complete sequence.>gb:AY054620_1563274 Arabidopsis
           thaliana Unknown protein (At2g47710; F17A22.10) mRNA,
           complete cds.>gb:AY081535_1568795 Arabidopsis thaliana
           unknown protein (At2g47710) mRNA, complete cds.
          Length = 162

 Score =  222 bits (566), Expect = 4e-57
 Identities = 109/161 (67%), Positives = 127/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFT--GPVSTFRLVLVHAKPSPANAVSLAG 204
           MA    K VMVV VDDSE S YAL WTLD FF    P   F+L +VHAKP+  +AV LAG
Sbjct: 1   MATGDGKSVMVVGVDDSEQSTYALEWTLDRFFAPYAPNYPFKLFIVHAKPNAVSAVGLAG 60

Query: 205 PGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS 384
           PG A+++P+VD+DLK  AA+V+E+AK IC S+SV   + E+ EGDARN+LCE V+KHHAS
Sbjct: 61  PGTAEVVPYVDADLKHTAAKVVEKAKAICQSRSVHGAVIEVFEGDARNILCEVVDKHHAS 120

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           ILVVGSHGYGAIKRAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct: 121 ILVVGSHGYGAIKRAVLGSTSDYCAHHAHCSVMIVKKPKIK 161



>gb:AY086842_1571884 Arabidopsis thaliana clone 2847 mRNA, complete
           sequence.
          Length = 162

 Score =  219 bits (559), Expect = 2e-56
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFT--GPVSTFRLVLVHAKPSPANAVSLAG 204
           MA    K VMVV VDDSE S YAL WTLD FF    P   F+L +VHAKP+  +AV LAG
Sbjct: 1   MATGDGKSVMVVGVDDSEQSTYALEWTLDRFFAPYAPNYPFKLFIVHAKPNAVSAVGLAG 60

Query: 205 PGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS 384
           PG A+++P+VD+DLK  AA+V+E+AK IC S+SV   + E+ EGDARN+LCE V+KHHAS
Sbjct: 61  PGTAEVVPYVDADLKHTAAKVVEKAKAICQSRSVHRAVIEVFEGDARNILCEVVDKHHAS 120

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           ILVVGSHGYGAI RAVLGS SDYCAHHAHC+VMIVKKPK K
Sbjct: 121 ILVVGSHGYGAIXRAVLGSTSDYCAHHAHCSVMIVKKPKIK 161



>gb:AY589695_1616575 Mirabilis jalapa clone FS-25 putative universal
           stress protein mRNA, partial cds.
          Length = 170

 Score =  193 bits (491), Expect = 2e-48
 Identities = 97/155 (62%), Positives = 120/155 (77%), Gaps = 2/155 (1%)
 Frame = +1

Query: 49  KPVMVVAVDDSEHSFYALGWTLDHFFTG--PVSTFRLVLVHAKPSPANAVSLAGPGAADI 222
           K VM+V +D+SE   YAL W L+H F    P   F  VLVHA P+ ++A+ LAGP AA+I
Sbjct: 15  KGVMIVGIDESEECMYALEWALNHLFLPYVPNHPFDFVLVHALPTASHAIGLAGPVAAEI 74

Query: 223 LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS 402
            P+VDSDLK IA RV E+A E+C SKS++D   E ++GDAR VLC+ VEK++AS+LVVGS
Sbjct: 75  SPYVDSDLKNIATRVKEKALELCRSKSLNDVTVETVDGDARKVLCDAVEKYNASMLVVGS 134

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
            G+GAIKRAVLGSVSDYCAHHAHC+V+IVKKPK K
Sbjct: 135 RGHGAIKRAVLGSVSDYCAHHAHCSVIIVKKPKTK 169



>gb:AP004300_1839813 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0470D12.
          Length = 171

 Score =  182 bits (461), Expect = 5e-45
 Identities = 93/164 (56%), Positives = 122/164 (74%), Gaps = 7/164 (4%)
 Frame = +1

Query: 37  AAAE----KPVMVVAVDDSEHSFYALGWTLDHFFTGPVST--FRLVLVHAKPSPANAVSL 198
           AAAE    K V+VV VDDSEHS YAL WT+ H  +G   +    LV+VHAKPSP++ V  
Sbjct: 2   AAAEGEQGKTVVVVGVDDSEHSNYALEWTMQHLASGMAGSGGAELVIVHAKPSPSSVVGF 61

Query: 199 -AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH 375
            AGPG+ +++ +V++DL+K A  V+E+A+ +C + ++   + E++EG+ R VLC  VEKH
Sbjct: 62  GAGPGSGEVVRYVEADLRKTAEDVVEKARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKH 120

Query: 376 HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
            A +LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct: 121 SAGLLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK 164



>gb:AF491815_1804877 Oryza sativa (indica cultivar-group) putative
           universal stress protein USP1 (Usp1) mRNA, complete cds.
          Length = 171

 Score =  181 bits (458), Expect = 1e-44
 Identities = 93/164 (56%), Positives = 121/164 (73%), Gaps = 7/164 (4%)
 Frame = +1

Query: 37  AAAE----KPVMVVAVDDSEHSFYALGWTLDHFFTGPVST--FRLVLVHAKPSPANAVSL 198
           AAAE    K V+VV VDDSEHS YAL WT+ H  +G        LV+VHAKPSP++ V  
Sbjct: 2   AAAEGEQRKTVVVVGVDDSEHSNYALEWTMQHLASGMAGGGGAELVIVHAKPSPSSVVGF 61

Query: 199 -AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH 375
            AGPG+ +++ +V++DL+K A  V+E+A+ +C + ++   + E++EG+ R VLC  VEKH
Sbjct: 62  GAGPGSGEVVRYVEADLRKTAEDVVEKARRLCIANAMH-ALIEVIEGEPRYVLCNAVEKH 120

Query: 376 HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
            A +LVVGSHGYGAIKRA LGSVSDYCAHHAHC+VMIVK+PK K
Sbjct: 121 SAGLLVVGSHGYGAIKRAFLGSVSDYCAHHAHCSVMIVKQPKAK 164



>gb:ATAC016795_1543606 Arabidopsis thaliana chromosome III BAC
           F26K24 genomic sequence, complete
           sequence.>gb:AY050359_1562138 Arabidopsis thaliana
           MEC18.3/MEC18.3 mRNA, complete cds.>gb:AY057721_1564133
           Arabidopsis thaliana AT3g11930/MEC18.3 mRNA, complete
           cds.>gb:AF372882_1792597 Arabidopsis thaliana
           MEC18.3/MEC18.3 mRNA, complete cds.>gb:AF428448_1799378
           Arabidopsis thaliana At3g11930/MEC18.3 mRNA, complete
           cds.>gb:AP002040_1821574 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MEC18.
          Length = 200

 Score =  128 bits (321), Expect = 9e-29
 Identities = 72/167 (43%), Positives = 102/167 (61%), Gaps = 16/167 (9%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFR-------LVLVHAKPSPAN--AVSLAGPG 210
           MVVA+D+S+ SFYAL W +DHF    ++T         L ++H + SP N  A   AGPG
Sbjct: 35  MVVAIDESDSSFYALQWVIDHFSNLLLTTAAAEAESGMLTVIHVQ-SPFNHFAAFPAGPG 93

Query: 211 AA-------DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE 369
            A        ++  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VE
Sbjct: 94  GATAVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVE 152

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
           K H  +LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct: 153 KMHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT 199



>gb:AY088520_1573539 Arabidopsis thaliana clone 7474 mRNA, complete
           sequence.
          Length = 199

 Score =  124 bits (310), Expect = 2e-27
 Identities = 71/166 (42%), Positives = 101/166 (60%), Gaps = 15/166 (9%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFR-------LVLVHAKPSPAN--AVSLAGPG 210
           MVVA+D+S+ SFYAL   +DHF    ++T         L ++H + SP N  A   AGPG
Sbjct: 35  MVVAIDESDSSFYALQLVIDHFSNLLLTTAAAEAESGMLTVIHVQ-SPFNHFAAFPAGPG 93

Query: 211 AADI------LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK 372
            A +      +  V    ++ +A ++ RA ++C +K +      ++EG+A+ ++CE VEK
Sbjct: 94  GATVYASSSMIESVKKAQQETSAALLSRALQMCRAKQIRTETL-VLEGEAKEMICEAVEK 152

Query: 373 HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
            H  +LVVGS G G IKRA LGSVSDYCAHHA+C ++IVK PK  T
Sbjct: 153 MHVDLLVVGSRGLGKIKRAFLGSVSDYCAHHANCPILIVKPPKEMT 198



>gb:AC092556_1735468 Oryza sativa chromosome 3 BAC OSJNBa0047E24
           genomic sequence, complete sequence.
          Length = 182

 Score =  112 bits (279), Expect = 7e-24
 Identities = 65/163 (39%), Positives = 92/163 (56%), Gaps = 8/163 (4%)
 Frame = +1

Query: 37  AAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSP--------ANAV 192
           AAA    +VVAVD SE S  AL W LD+          +V+VHA+  P        A+A+
Sbjct: 20  AAAGTMKVVVAVDASEESLNALSWALDNVIGRRAGAVSVVVVHAQHGPDHFVYPVAAHAI 79

Query: 193 SLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK 372
           + A   A + +     ++ +   +V+ RA ++C  + V      I+EGDA+  +C+ VE+
Sbjct: 80  AYAPASAIESMRKAQEEISR---KVVSRALDVCKQREVS-ATGAIVEGDAKEAICQAVEE 135

Query: 373 HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
            HA +LV+GS G G IKRA LGSVSDY  HHA C V++VK  K
Sbjct: 136 MHADMLVLGSRGLGKIKRAFLGSVSDYLVHHACCPVLVVKPTK 178



>gb:BT005843_1638765 Arabidopsis thaliana At1g09740 gene, complete
           cds.
          Length = 171

 Score =  111 bits (278), Expect = 9e-24
 Identities = 63/156 (40%), Positives = 92/156 (58%), Gaps = 11/156 (7%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHF-FTGPVSTFRLVLVHAKPSPANAVSLA-------GPGA 213
           +VVAVD SE S  AL W LD+   +   S    V++H +PSP+ A  ++       GP  
Sbjct: 10  VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG 69

Query: 214 ADI---LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS 384
            ++      ++   K+I   ++E A +ICA KSV+    +++ GD +  +CE VE  HA 
Sbjct: 70  LEVPAFTAAIEQHQKRITDTILEHASQICAEKSVNVKT-QVVIGDPKYKICEAVENLHAD 128

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +LV+GS  YG IKR  LGSVS+YC +HAHC V+I+K
Sbjct: 129 LLVMGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIK 164



>pir|C86231|C86231 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889978 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F21M12_1677851 Sequence of BAC F21M12 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 174

 Score =  111 bits (277), Expect = 1e-23
 Identities = 63/158 (39%), Positives = 92/158 (58%), Gaps = 13/158 (8%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHF-FTGPVSTFRLVLVHAKPSPANAVSLA-------GPGA 213
           +VVAVD SE S  AL W LD+   +   S    V++H +PSP+ A  ++       GP  
Sbjct: 10  VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG 69

Query: 214 ADI---LPHVDSDLKKIAARVIERAKEICASKSVD--DPMFEIMEGDARNVLCETVEKHH 378
            ++      ++   K+I   ++E A +ICA KSV   +   +++ GD +  +CE VE  H
Sbjct: 70  LEVPAFTAAIEQHQKRITDTILEHASQICAEKSVSRVNVKTQVVIGDPKYKICEAVENLH 129

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           A +LV+GS  YG IKR  LGSVS+YC +HAHC V+I+K
Sbjct: 130 ADLLVMGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIK 167



>gb:AP002871_1823510 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0475H04.>gb:AP003206_1825160 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1146F03.
          Length = 182

 Score =  108 bits (270), Expect = 7e-23
 Identities = 67/161 (41%), Positives = 96/161 (59%), Gaps = 5/161 (3%)
 Frame = +1

Query: 34  AAAAEKPV--MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAK-PSPANAV--SL 198
           AAAAE P   +VVAVD+SE S +AL W L +  +       LVL+HA+ P P  A   S 
Sbjct: 23  AAAAEAPGRRIVVAVDESEESTHALTWCLANVVSSSGGD-TLVLLHARRPRPVYAAMDSS 81

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
                +D++  +D     ++A  + +AK ICA+         +  GD R+V+C+  EK  
Sbjct: 82  GYMMTSDVMASMDKYAAAVSAAAVGKAKHICAAFPHVTVETMVESGDPRDVICDATEKMA 141

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           A +LV+G+HGYG I+RA LGSVS++CA +  C V+IVK+PK
Sbjct: 142 ADLLVMGTHGYGLIQRAFLGSVSNHCAQNCKCPVLIVKRPK 182



>gb:AB017061_1513325 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19E20.
          Length = 150

 Score =  107 bits (268), Expect = 1e-22
 Identities = 55/124 (44%), Positives = 85/124 (68%), Gaps = 2/124 (1%)
 Frame = +1

Query: 16  VKWLRMAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVST--FRLVLVHAKPSPANA 189
           +K ++MA+ +E+ V+VV VDDS HS++AL   LD FF    +   F+LV++HA+P+    
Sbjct: 28  LKKIKMASGSER-VVVVGVDDSAHSYHALETALDLFFIPFKANPRFKLVVLHARPTATFF 86

Query: 190 VSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE 369
           + +AGPG  DI+P V+ DL K A  V ++  E+C++KSV+    E++EGD RN++ E VE
Sbjct: 87  LGVAGPGTVDIIPMVEEDLNKTADLVKKKCAEVCSAKSVEISSLEVIEGDPRNIMLEAVE 146

Query: 370 KHHA 381
           +HHA
Sbjct: 147 RHHA 150



>gb:AE016959_1022756 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752575
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 181

 Score =  105 bits (262), Expect = 6e-22
 Identities = 69/165 (41%), Positives = 87/165 (52%), Gaps = 18/165 (10%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFF-----TG--------PVSTFRLVLVHAKPSPANAVSL 198
           ++VAVDDS  S  AL W LDH F     TG        P     LVLVHA     + +  
Sbjct: 3   VLVAVDDSRGSHRALSWVLDHLFFPAAATGDGGEEEQVPRPAPELVLVHAIEPLHHVMFP 62

Query: 199 AGPG-----AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
            GPG     AA ++  V +   + A  ++ RA+ IC  + V      + EG+ R  LC  
Sbjct: 63  VGPGSAVYGAASMMEAVRAAQAENARNLLVRARLICERRGVAAATVAV-EGEPREALCRA 121

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
            E   A +LVVGS G GA+KRA LGSVSDYCAH A C +M+VK P
Sbjct: 122 AEDAGAGLLVVGSRGLGALKRAFLGSVSDYCAHRASCPIMVVKPP 166



>gb:BT004026_1637140 Arabidopsis thaliana clone RAFL15-12-A17
           (R20781) unknown protein (At3g58450) mRNA, complete
           cds.>gb:BT005060_1638006 Arabidopsis thaliana clone
           U20781 unknown protein (At3g58450) mRNA, complete cds.
          Length = 204

 Score =  102 bits (254), Expect = 5e-21
 Identities = 63/166 (37%), Positives = 91/166 (54%), Gaps = 14/166 (8%)
 Frame = +1

Query: 46  EKPVMVVAVDDSEHSFYALGWTLDHFF--------TGPVSTFRLVLVHAKPSPANAVSLA 201
           +K  ++VA+D+S++SF AL W +DH          TG      L L+H  P+    +  +
Sbjct: 28  KKLKVMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEGGL-LTLLHVHPTYLQYIYPS 86

Query: 202 GPGAADILP--HVDSDLKKI----AARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
           G  A+ +     V   ++K        +  RA EIC  K V      I+EGD + ++C+ 
Sbjct: 87  GGTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETM-ILEGDPKEMICQA 145

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           VE+ H  +LVVGS G G IKRA LGSVSDYCA HA C ++IV+ P+
Sbjct: 146 VEQTHVDLLVVGSRGLGMIKRAFLGSVSDYCAQHAKCPILIVRPPR 191



>gb:AF139378_1771410 Lupinus luteus LlDD2A18 mRNA, complete cds.
          Length = 106

 Score = 98.6 bits (244), Expect = 8e-20
 Identities = 51/96 (53%), Positives = 71/96 (73%), Gaps = 4/96 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFT--GPVSTFRLVLVHAKPSPANAVSLAGPGA--ADIL 225
           MV+A+D+ EHS YALGWTLD FFT  G  + F+LVLV+AK SP  AVS+AGPGA   +  
Sbjct: 1   MVLAIDEHEHSSYALGWTLDRFFTPFGSDAPFKLVLVNAKSSPPVAVSMAGPGALGTEFF 60

Query: 226 PHVDSDLKKIAARVIERAKEICASKSVDDPMFEIME 333
           P V+  LK++A ++ E+A++ICASK V++   E++E
Sbjct: 61  PSVEVQLKQLADQITEKARQICASKLVNEVEVEVIE 96



>gb:AF096262_1767812 Lycopersicon esculentum ER6 protein mRNA,
           partial cds.
          Length = 168

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 56/161 (34%), Positives = 90/161 (55%), Gaps = 16/161 (9%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLD------HFFTGPVSTFRLVLVHAKPSPA-------NAVSL 198
           ++V+VD SE S  AL WTLD      H    P S   +V++H +  P+        A+  
Sbjct: 6   VIVSVDGSEESMNALNWTLDNIKLKPHDPDSPESQGFIVILHVQSPPSIAAGLNPGAIPF 65

Query: 199 AGPGAADI---LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE 369
            GP   ++      +++  K+I   +++ A  ICA K+ +    +++ GD +  +C+ VE
Sbjct: 66  GGPSDVEVPAFTAAIEAHQKRITQAILDHALGICAKKNANVKT-QVVIGDPKEKICDAVE 124

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           + +A +LV+GS  +G IKR  LGSVS+YC +HA C V+IVK
Sbjct: 125 EMNADLLVMGSRAFGPIKRMFLGSVSNYCTNHAQCPVIIVK 165



>gb:AP003077_1824681 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0520B06.>gb:AP003213_1825292 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0054L14.
          Length = 167

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 52/155 (33%), Positives = 89/155 (57%), Gaps = 10/155 (6%)
 Frame = +1

Query: 61  VVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS-PANAVSLAGPG--------A 213
           +VAVD+SE S +AL W L +    P     L+++  +P  P   VS A  G        A
Sbjct: 15  MVAVDESEFSHHALEWALRNL--APTIAPPLLVLTVQPLLPLGYVSAASFGSPLGTPVVA 72

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVD-DPMFEIMEGDARNVLCETVEKHHASIL 390
            +++  +    ++++  ++++AK+ICA   V  + M ++  GD + ++C+  E+    +L
Sbjct: 73  PELIKAMQEQQQQLSQALLDKAKQICAQHGVAVETMIKV--GDPKEMICQAAEESKVDLL 130

Query: 391 VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           +VGSH  G ++R  LGSVS+YC HH+ C V++VKK
Sbjct: 131 IVGSHSRGPVQRLFLGSVSNYCMHHSKCPVLVVKK 165



>gb:AP004159_1838384 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1175_B01.
          Length = 162

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 50/155 (32%), Positives = 85/155 (54%), Gaps = 10/155 (6%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSL-------AGPGAA 216
           +VVAVD SE S  AL W LD+    P     LV++H +P P+ A  L        GP   
Sbjct: 9   VVVAVDGSEESMNALRWALDNLRLRPDGA--LVVLHVQPPPSIAAGLNPGPIPFGGPSEV 66

Query: 217 DI---LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASI 387
           ++      +++  ++I   +++ A +IC+ K+V+    +++ GD +  +CE      A +
Sbjct: 67  EVPAFTQAIEAHQRRITQAILDHALKICSEKNVEVKT-DVVVGDPKEKICEVTANLKADL 125

Query: 388 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           LV+G   +G +KR  LGSVS+YC ++  C V+++K
Sbjct: 126 LVMGCRAFGPLKRMFLGSVSNYCINNVVCPVVVIK 160



>gb:AY035146_1559914 Arabidopsis thaliana unknown protein
           (At3g62550) mRNA, complete cds.>gb:AY059079_1564444
           Arabidopsis thaliana unknown protein (At3g62550) mRNA,
           complete cds.
          Length = 162

 Score = 88.6 bits (218), Expect = 8e-17
 Identities = 56/150 (37%), Positives = 82/150 (54%), Gaps = 4/150 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPG---AADILP 228
           +VVAVD+SE S  AL W+LD+ F    S   L+L++ KP      SL   G     D + 
Sbjct: 9   IVVAVDESEESMEALSWSLDNLFPYG-SNNTLILLYVKPPLPVYSSLDAAGFIVTGDPVA 67

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFE-IMEGDARNVLCETVEKHHASILVVGSH 405
            +     ++   V+ R++ +      D  +   +  GDA+ V+C  V+K    +LV+G+H
Sbjct: 68  ALKKYEYELVESVMARSRTVYQDYESDINIERRVGRGDAKEVICNAVQKLRVDMLVMGTH 127

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
            YG  KRA+LGSVS+YCA    C V+IVKK
Sbjct: 128 DYGFFKRALLGSVSEYCAKRVKCPVVIVKK 157



>gb:AY224503_1590705 Oryza sativa (japonica cultivar-group) isolate
           31158 unknown mRNA.
          Length = 174

 Score = 63.2 bits (152), Expect(2) = 9e-16
 Identities = 37/69 (53%), Positives = 44/69 (63%), Gaps = 7/69 (10%)
 Frame = +1

Query: 37  AAAE----KPVMVVAVDDSEHSFYALGWTLDHFFTGPVST--FRLVLVHAKPSPANAVSL 198
           AAAE    K V+VV VDDSEHS YAL WT+ H  +G   +    LV+VHAKPSP + V  
Sbjct: 2   AAAEGEQGKTVVVVGVDDSEHSNYALEWTMQHLASGMAGSGGAELVIVHAKPSPXSVVGF 61

Query: 199 -AGPGAADI 222
            AGPG  +I
Sbjct: 62  GAGPGGGEI 70



 Score = 42.4 bits (98), Expect(2) = 9e-16
 Identities = 28/68 (41%), Positives = 35/68 (51%)
 Frame = +3

Query: 321 RDHGRGCQECPLRNCGETPCLYLGCRQPWLWSYQEGCSGQCKRLLRSSCSLHCHDREEAK 500
           R   RG Q   ++  GE        RQPWL   QEG  G+ +RLLR   +L  HDR+  +
Sbjct: 98  RGDRRGAQVRAVQRGGEAQRGVARRRQPWLRRNQEGLPGERQRLLRPPRALLRHDRQATQ 157

Query: 501 AQNLISCR 524
            Q L SCR
Sbjct: 158 GQAL-SCR 164



>pir|F96706|F96706 unknown protein, 44604-45347 [imported] -
           Arabidopsis thaliana>gb:AE005173_894451 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016447_1538138 Arabidopsis thaliana
           chromosome 1 BAC T22E19 genomic sequence, complete
           sequence.>gb:AY086731_1571774 Arabidopsis thaliana clone
           27109 mRNA, complete sequence.>gb:BT005207_1638147
           Arabidopsis thaliana At1g68300 mRNA, complete cds.
          Length = 160

 Score = 82.0 bits (201), Expect = 7e-15
 Identities = 55/158 (34%), Positives = 86/158 (54%), Gaps = 6/158 (3%)
 Frame = +1

Query: 37  AAAEKPVM---VVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS-PANAVSLAG 204
           A  EK VM   +VA+D+SE S  AL WTL  +    ++   ++L  A+P    + V  + 
Sbjct: 2   AEEEKSVMKQVMVAIDESECSKRALQWTLV-YLKDSLADSDIILFTAQPHLDLSCVYASS 60

Query: 205 PGAA--DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
            GAA  +++  +    K      ++   +ICA   V  P   +  G+ +  +CE  EK  
Sbjct: 61  YGAAPIELINSLQESHKNAGLNRLDEGTKICAETGVT-PRKVLEFGNPKEAICEAAEKLG 119

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             +LVVGSHG GA++R  LGSVS+YC ++A C V++V+
Sbjct: 120 VDMLVVGSHGKGALQRTFLGSVSNYCVNNAKCPVLVVR 157



>gb:BA000045_742764 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 163

 Score = 77.8 bits (190), Expect = 1e-13
 Identities = 48/153 (31%), Positives = 76/153 (49%), Gaps = 9/153 (5%)
 Frame = +1

Query: 61  VVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------PANAVSLAGPGA 213
           +VA+D SE    AL   L+     P     L+L  A+ +         P       GP  
Sbjct: 18  LVAIDGSETGLSALAKALE--LAKPTGASLLLLTVAEQANATFWPGMLPTGEPLYQGPPL 75

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           A++    +   + +    +E+  ++C +  VD     +  G AR+ +CE  E+    ILV
Sbjct: 76  AEL----EQIARSVGEAALEKGAKLCEAAGVDYQT-RLEFGHARDTICEVAEQEKPDILV 130

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +GS G G+++R +LGSVSDY  HHAHC V++V+
Sbjct: 131 IGSRGLGSVQRLMLGSVSDYVIHHAHCPVLVVR 163



>pir|F86247|F86247 protein T23J18.3 [imported] - Arabidopsis
            thaliana>gb:AE005172_890144 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC011661_1537281 Genomic sequence for
            Arabidopsis thaliana BAC T23J18 from chromosome I,
            complete sequence.
          Length = 875

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 54/163 (33%), Positives = 86/163 (52%), Gaps = 15/163 (9%)
 Frame = +1

Query: 64   VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
            +AVD S+ S YA+ W + ++     S   +VL+H +P+  + +  A  GA D+ P  D +
Sbjct: 675  IAVDLSDESAYAVQWAVQNYLR---SGDAVVLLHVQPT--SVLYGADWGAMDLSPQWDPN 729

Query: 244  LKKIAARVIERAKEICASKSVDD---PMFE---------IMEGDARNVLCETVEKHHASI 387
             ++ + R +E   +I  +K   D   P+ E         + + D +  LC  VE+   S 
Sbjct: 730  NEE-SQRKLEDDFDIVTNKKASDVAQPLVEADIPFKIHIVKDHDMKERLCLEVERLGLST 788

Query: 388  LVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKPKHK 507
            L++GS G+GA KR+    LGSVSDY  HH  C V++V+ P  K
Sbjct: 789  LIMGSRGFGATKRSSKGRLGSVSDYSVHHCACPVVVVRFPDDK 831



>gb:AP004068_1837199 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1611_C08.
          Length = 165

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 52/163 (31%), Positives = 83/163 (50%), Gaps = 10/163 (6%)
 Frame = +1

Query: 40  AAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAV--SLAGPGA 213
           AAEK  + + +D S  S  A  W +D+      +  R++LVH  P  A+A    L     
Sbjct: 2   AAEKRTIGLGMDYSPSSKAAAKWAVDNLVK---AGDRIILVHVLPKGADASHKELWKSTG 58

Query: 214 ADILPHVDSDLKKIAAR--------VIERAKEICASKSVDDPMFEIMEGDARNVLCETVE 369
           + ++P ++     + AR        V+E  +    SK V+  + ++  GDAR  LCE V+
Sbjct: 59  SPLIPLLEFMEMNVQARYGINPDKEVLEILQAESKSKQVE-VLAKVYWGDAREKLCEAVD 117

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
               +  V+G  G G +KRA+LGSVS+Y  ++A C V +V+ P
Sbjct: 118 DLKVNTFVLGCRGLGPLKRALLGSVSNYVVNNATCPVTVVRAP 160



>gb:AP005126_1848240 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0041B22.
          Length = 268

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 55/185 (29%), Positives = 90/185 (48%), Gaps = 30/185 (16%)
 Frame = +1

Query: 34  AAAAEKPV------MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPA---- 183
           AAAA  PV      + +AVD S+ S YA+ W + ++     +   ++L+H +P+      
Sbjct: 44  AAAAAAPVGSSHRRIAIAVDLSDESAYAVRWAVANYLRPGDA---VILLHVRPTSVLYGA 100

Query: 184 --NAVSL----AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVD--DPMFE----- 324
              +V L    A P  +   P  + D +  A ++ +      ASK+ D   P+ +     
Sbjct: 101 DWGSVDLSLPAANPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPY 160

Query: 325 ----IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVM 483
               + + D +  LC  VE+   S +++GS G+GA +R     LGSVSDYC HH  C V+
Sbjct: 161 KIHIVKDHDMKERLCLEVERLGLSAVIMGSKGFGASRRTSKGRLGSVSDYCVHHCVCPVV 220

Query: 484 IVKKP 498
           +V+ P
Sbjct: 221 VVRFP 225



>gb:AP005126_1848239 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0041B22.
          Length = 268

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 55/185 (29%), Positives = 90/185 (48%), Gaps = 30/185 (16%)
 Frame = +1

Query: 34  AAAAEKPV------MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPA---- 183
           AAAA  PV      + +AVD S+ S YA+ W + ++     +   ++L+H +P+      
Sbjct: 44  AAAAAAPVGSSHRRIAIAVDLSDESAYAVRWAVANYLRPGDA---VILLHVRPTSVLYGA 100

Query: 184 --NAVSL----AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVD--DPMFE----- 324
              +V L    A P  +   P  + D +  A ++ +      ASK+ D   P+ +     
Sbjct: 101 DWGSVDLSLPAANPNPSGDPPSAEDDAEAAARKMEDDFDAFTASKADDLAKPLKDAGIPY 160

Query: 325 ----IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVM 483
               + + D +  LC  VE+   S +++GS G+GA +R     LGSVSDYC HH  C V+
Sbjct: 161 KIHIVKDHDMKERLCLEVERLGLSAVIMGSKGFGASRRTSKGRLGSVSDYCVHHCVCPVV 220

Query: 484 IVKKP 498
           +V+ P
Sbjct: 221 VVRFP 225



>gb:AC087425_1734059 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0676G05, complete sequence.
          Length = 167

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 55/164 (33%), Positives = 79/164 (48%), Gaps = 11/164 (6%)
 Frame = +1

Query: 34  AAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSP---ANAVSLAG 204
           AAAAE+ V   AVD SE S  AL W  D+      +   L+L+H    P        L  
Sbjct: 5   AAAAERWVGA-AVDFSEGSRAALRWAADNLLR---AGDHLILLHVLKDPDYEQGETLLWE 60

Query: 205 PGAADILPHVDSDLKKIA--------ARVIERAKEICASKSVDDPMFEIMEGDARNVLCE 360
              + ++P  D     IA        A  ++    +   K V   +F+++ GD R  LC+
Sbjct: 61  ATGSPLIPLSDFSEPTIAKKYGAKPDAETLDMLNTVARQKEVV-VVFKVLWGDPREKLCQ 119

Query: 361 TVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            + +   S LV+GS G G +KR +LGSVSDY  ++A C V +VK
Sbjct: 120 AINEIPMSCLVIGSRGLGKLKRVLLGSVSDYVVNNATCPVTVVK 163



>gb:AK175268_1817256 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-70-E12.
          Length = 260

 Score = 69.3 bits (168), Expect = 5e-11
 Identities = 52/165 (31%), Positives = 80/165 (48%), Gaps = 20/165 (12%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDP--MFEIMEGDARNVLCETVEK 372
             PGA       D D    +++V + AK +   K  + P  +  + + D R  LC   E+
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL---KEAEFPHKIHIVKDHDMRERLCLETER 161

Query: 373 HHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            + S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 162 LNLSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>gb:AK176860_1818848 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-41-I01.
          Length = 260

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>gb:AK176819_1818807 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-37-K15.
          Length = 260

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSGGKLGSVSDYCVHHCVCPVVVVRYP 206



>gb:AK176355_1818343 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL24-05-M15.
          Length = 260

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPFPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>gb:AK175883_1817871 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL22-52-C18.
          Length = 260

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPIQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>gb:AY084304_1569396 Arabidopsis thaliana clone 10313 mRNA, complete
           sequence.>gb:AY123998_1580076 Arabidopsis thaliana
           AT4g27320/M4I22_130 mRNA, complete
           cds.>gb:AY143840_1583297 Arabidopsis thaliana
           At4g27320/M4I22_130 mRNA, complete
           cds.>gb:AK175197_1817185 Arabidopsis thaliana mRNA,
           complete cds, clone: RAFL21-61-I12.>gb:AK175342_1817330
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL21-78-I12.>gb:AK175411_1817399 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL21-84-L23.>gb:AK175423_1817411 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL21-85-L11.>gb:AK176431_1818419 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL24-18-C17.>gb:AK176530_1818518 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL25-05-A12.>gb:AK176789_1818777 Arabidopsis thaliana
           mRNA, complete cds, clone:
           RAFL25-33-I15.>gb:AK176877_1818865 Arabidopsis thaliana
           mRNA, complete cds, clone: RAFL25-43-L24.
          Length = 260

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>pir|T05756|T05756 hypothetical protein M4I22.130 - Arabidopsis
           thaliana>gb:ATCHRIV66_1546613 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 66.>gb:ATM4I22_1553668
           Arabidopsis thaliana DNA chromosome 4, P1 clone M4I22
           (ESSA project).
          Length = 259

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 50/163 (30%), Positives = 77/163 (47%), Gaps = 18/163 (11%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS---------------PANAVSL 198
           VAVD SE S +A+ W +DH+     +   +V++H  P+               P    + 
Sbjct: 49  VAVDLSEESAFAVRWAVDHYIRPGDA---VVILHVSPTSVLFGADWGPLPLQTPPPPSAA 105

Query: 199 AGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHH 378
             PGA       D D    +++V + AK +         +  + + D R  LC   E+ +
Sbjct: 106 TDPGAQPKPSQEDFDAFT-SSKVADLAKPL-KEAGFPHKIHIVKDHDMRERLCLETERLN 163

Query: 379 ASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
            S +++GS G+GA KR     LGSVSDYC HH  C V++V+ P
Sbjct: 164 LSAVIMGSRGFGAEKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 206



>pir|T45665|T45665 hypothetical protein F14P22.40 - Arabidopsis
           thaliana>gb:ATF14P22_1548613 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14P22.
          Length = 174

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 47/141 (33%), Positives = 71/141 (50%), Gaps = 14/141 (9%)
 Frame = +1

Query: 46  EKPVMVVAVDDSEHSFYALGWTLDHFF--------TGPVSTFRLVLVHAKPSPANAVSLA 201
           +K  ++VA+D+S++SF AL W +DH          TG      L L+H  P+    +  +
Sbjct: 28  KKLKVMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEGGL-LTLLHVHPTYLQYIYPS 86

Query: 202 GPGAADILP--HVDSDLKKI----AARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
           G  A+ +     V   ++K        +  RA EIC  K V      I+EGD + ++C+ 
Sbjct: 87  GGTASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETM-ILEGDPKEMICQA 145

Query: 364 VEKHHASILVVGSHGYGAIKR 426
           VE+ H  +LVVGS G G IKR
Sbjct: 146 VEQTHVDLLVVGSRGLGMIKR 166



>gb:AY070394_1566793 Arabidopsis thaliana unknown protein
           (At5g54430) mRNA, complete cds.>gb:AY087680_1572708
           Arabidopsis thaliana clone 37617 mRNA, complete
           sequence.>gb:AY123025_1579903 Arabidopsis thaliana
           unknown protein (At5g54430) mRNA, complete
           cds.>gb:AK118526_1816498 Arabidopsis thaliana At5g54430
           mRNA for unknown protein, complete cds, clone:
           RAFL19-75-I17.
          Length = 242

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 50/160 (31%), Positives = 78/160 (48%), Gaps = 15/160 (9%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGP---------GAA 216
           VAVD SE S +A+ W +DH+     +   +VL+H  P+     +  GP           A
Sbjct: 52  VAVDLSEESSFAVRWAVDHYIRPGDA---VVLLHVSPTSVLFGADWGPLPLKTQIEDPNA 108

Query: 217 DILPHVDSDLKKIAARVIERAKEICASKSVDDP--MFEIMEGDARNVLCETVEKHHASIL 390
              P  +      + +V + AK +   K +  P  +  + + D R  LC  +E+   S +
Sbjct: 109 QPQPSQEDFDAFTSTKVADLAKPL---KELGFPYKIHIVKDHDMRERLCLEIERLGLSAV 165

Query: 391 VVGSHGYGAIKR----AVLGSVSDYCAHHAHCTVMIVKKP 498
           ++GS G+GA K+      LGSVSDYC HH  C V++V+ P
Sbjct: 166 IMGSRGFGAEKKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 205



>gb:AB026634_1517037 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F24B18.
          Length = 250

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 50/160 (31%), Positives = 78/160 (48%), Gaps = 15/160 (9%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGP---------GAA 216
           VAVD SE S +A+ W +DH+     +   +VL+H  P+     +  GP           A
Sbjct: 52  VAVDLSEESSFAVRWAVDHYIRPGDA---VVLLHVSPTSVLFGADWGPLPLKTQIEDPNA 108

Query: 217 DILPHVDSDLKKIAARVIERAKEICASKSVDDP--MFEIMEGDARNVLCETVEKHHASIL 390
              P  +      + +V + AK +   K +  P  +  + + D R  LC  +E+   S +
Sbjct: 109 QPQPSQEDFDAFTSTKVADLAKPL---KELGFPYKIHIVKDHDMRERLCLEIERLGLSAV 165

Query: 391 VVGSHGYGAIKR----AVLGSVSDYCAHHAHCTVMIVKKP 498
           ++GS G+GA K+      LGSVSDYC HH  C V++V+ P
Sbjct: 166 IMGSRGFGAEKKRGSDGKLGSVSDYCVHHCVCPVVVVRYP 205



>gb:AP003368_1828577 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1100D10.
          Length = 262

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 41/167 (24%), Positives = 76/167 (45%), Gaps = 20/167 (11%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSP--------ANAVSLAGPGA 213
           + +AVD S+ S YA+ W + ++     +   +VL+H +P+         +  VS++    
Sbjct: 62  IAIAVDLSDESAYAVRWAVQNYLRPGDA---VVLLHVRPTSVLYGADWGSIPVSVSDDAD 118

Query: 214 ADILPHV---------DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV 366
            ++ P           + D     +   E   +      +   +  + + D +  LC   
Sbjct: 119 GEVAPAASAEELQKKREEDFDAFTSTKAEDLAQPLVDAQIPFKIHVVKDHDMKERLCLEA 178

Query: 367 EKHHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKP 498
           E+   S +++GS G+GA ++     LGSVSDYC HH  C V++V+ P
Sbjct: 179 ERLGLSAMIMGSRGFGASRKGGKGRLGSVSDYCVHHCVCPVVVVRYP 225



>pir|T36954|T36954 hypothetical protein SCJ1.21 - Streptomyces
           coelicolor>gb:SCO939104_173848 Streptomyces coelicolor
           A3(2) complete genome; segment 1/29.
          Length = 152

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 49/146 (33%), Positives = 65/146 (44%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VV VD S  S+ AL W  D +          V V   PS   AV  AGP         D
Sbjct: 10  VVVGVDGSPSSYAALRWA-DRYARAVGGVVEAVHVWDTPS---AVGFAGPAIDP-----D 60

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
            DL++   R     +     +        ++EGD    L    +   A +LVVG  G GA
Sbjct: 61  FDLEQARERFAAELEATFPGERPPGLKEILVEGDPSETLIRASQG--AELLVVGRRGRGA 118

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKK 495
             RA+LGSVS  CA HA C V++V++
Sbjct: 119 FARAMLGSVSQRCAQHAACPVVVVRQ 144



>gb:ATAC009325_1542883 Arabidopsis thaliana chromosome III BAC F4P13
           genomic sequence, complete sequence.
          Length = 296

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 48/180 (26%), Positives = 80/180 (44%), Gaps = 17/180 (9%)
 Frame = +1

Query: 22  WLRMAAAAEKPVMVVAVDDSEHSFY---------ALGWTLDHFFTGPVSTFRLVLVHAKP 174
           W +M +   K  ++VAV+ S    Y         A  WTL+       S F+++L+H + 
Sbjct: 119 WRKMGSEPTK--VMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQ- 175

Query: 175 SPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFE--------IM 330
                V   G    D +     D + +  R   +AK +   +   +   E        I 
Sbjct: 176 ----VVDEDGFDDVDSIYASPEDFRDM--RQSNKAKGLHLLEFFVNKCHEIGVGCEAWIK 229

Query: 331 EGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
            GD ++V+C+ V++     LVVGS G G  ++  +G+VS +C  HA C VM +K+   +T
Sbjct: 230 TGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADET 289



>gb:AF480496_1803736 Oryza sativa clone BAC 49D11, complete
           sequence.>gb:AP005844_1858945 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0060O16.
          Length = 177

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 43/171 (25%), Positives = 76/171 (44%), Gaps = 16/171 (9%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFY---------ALGWTLDHFFTGPVSTFRLVLVHAKPSPA 183
           MA ++E   ++VAV++S    Y         A  W L        + F L+ +H +    
Sbjct: 1   MAGSSEPTRVMVAVNESSIKGYPHPSISCRAAFDWMLSKLVRSNAAGFHLLFLHVQVPDE 60

Query: 184 NAVSLAGPGAADILPHVDSDLKKIAAR-------VIERAKEICASKSVDDPMFEIMEGDA 342
           +     G    D +     D +++  R       ++E     C    +    + I +GD 
Sbjct: 61  D-----GFDDMDSIYASPPDFQRMKQRDKIRGLHLLEHFVNQCHQLEIKCEAW-IKQGDP 114

Query: 343 RNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           + V+C  V++    +LVVGS G G  +R  +G+VS++C  HA C V+ +K+
Sbjct: 115 KEVICSEVKRVQPDLLVVGSRGLGPFQRVFVGTVSEFCVKHADCPVITIKR 165



>gb:AC007119_1535260 Arabidopsis thaliana chromosome 2 clone F2G1
           map mi238, complete sequence.>gb:AY087097_1572133
           Arabidopsis thaliana clone 31655 mRNA, complete
           sequence.
          Length = 187

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 42/144 (29%), Positives = 67/144 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD   +S +A  W L HF         L LVHA  S  N V             V 
Sbjct: 42  VIVAVDHGPNSKHAFDWALVHFCR---LADTLHLVHAVSSVKNDV-------------VY 85

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
              + +  ++   A ++   KSV      ++EGDA  V+C+  EK   + ++VG+ G   
Sbjct: 86  ETSQALMEKLAVEAYQVAMVKSVA----RVVEGDAGKVICKEAEKVKPAAVIVGTRGRSL 141

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIV 489
           ++  + GSVS+YC H+     +I+
Sbjct: 142 VRSVLQGSVSEYCFHNCKSAPVII 165



>gb:AY084275_1569367 Arabidopsis thaliana clone 102038 mRNA,
           complete sequence.
          Length = 167

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 8/146 (5%)
 Frame = +1

Query: 97  ALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIER 276
           A  WTL+       S F+++L+H +      V   G    D +     D + +  R   +
Sbjct: 22  AFEWTLEKIVRSNTSDFKILLLHVQ-----VVDEDGFDDVDSIYASPEDFRDM--RQSNK 74

Query: 277 AKEICASKSVDDPMFE--------IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAV 432
           AK +   +   +   E        I  GD ++V+C+ V++     LVVGS G G  ++  
Sbjct: 75  AKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVF 134

Query: 433 LGSVSDYCAHHAHCTVMIVKKPKHKT 510
           +G+VS +C  HA C VM +K+   +T
Sbjct: 135 VGTVSAFCVKHAECPVMTIKRNADET 160



>gb:AY052696_1562856 Arabidopsis thaliana AT3g01520/F4P13_7 mRNA,
           complete cds.>gb:AF446878_1800519 Arabidopsis thaliana
           AT3g01520/F4P13_7 mRNA, complete cds.
          Length = 175

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 8/146 (5%)
 Frame = +1

Query: 97  ALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIER 276
           A  WTL+       S F+++L+H +      V   G    D +     D + +  R   +
Sbjct: 30  AFEWTLEKIVRSNTSDFKILLLHVQ-----VVDEDGFDDVDSIYASPEDFRDM--RQSNK 82

Query: 277 AKEICASKSVDDPMFE--------IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAV 432
           AK +   +   +   E        I  GD ++V+C+ V++     LVVGS G G  ++  
Sbjct: 83  AKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVF 142

Query: 433 LGSVSDYCAHHAHCTVMIVKKPKHKT 510
           +G+VS +C  HA C VM +K+   +T
Sbjct: 143 VGTVSAFCVKHAECPVMTIKRNADET 168



>gb:AC130597_1740691 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0017K09, complete sequence.
          Length = 268

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 44/186 (23%), Positives = 81/186 (43%), Gaps = 31/186 (16%)
 Frame = +1

Query: 34  AAAAEKPV--MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSP--------- 180
           +A+A  P   + +AVD S+ S +A+ W++ ++     +   +VL+H +P+          
Sbjct: 50  SASASSPHRRIAIAVDLSDESAFAVKWSVQNYLRPGDA---VVLLHVRPTSVLYGADWGS 106

Query: 181 -----------------ANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVD 309
                            ANA +       +     + D     +   +   +   +  + 
Sbjct: 107 IPVSVDDDDSAPDAAQHANAHAATRDEPEEAKKKREEDFDAFTSTKAQDLAQPLVAAQIP 166

Query: 310 DPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTV 480
             +  + + D +  LC   E+   S +++GS G+GA +RA    LGSVSDYC HH  C V
Sbjct: 167 FKIHIVKDHDMKERLCLEAERLGLSAMIMGSRGFGASRRAGKGRLGSVSDYCVHHCVCPV 226

Query: 481 MIVKKP 498
           ++V+ P
Sbjct: 227 VVVRYP 232



>gb:AB039925_1519379 Arabidopsis thaliana mRNA for RD2 protein,
           complete cds.
          Length = 193

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 41/144 (28%), Positives = 69/144 (47%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD   +S +A  W L HF         L LVHA  S  +   +      D++    
Sbjct: 42  VIVAVDHGPNSKHAFDWALVHFCR---LADTLHLVHAVSSSFSLQCVKN----DVVYETS 94

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             L +   ++   A ++   KSV      ++EGDA  V+C+  EK   + ++VG+ G   
Sbjct: 95  QALME---KLAVEAYQVAMVKSVA----RVVEGDAGKVICKEAEKVKPAAVIVGTRGRSL 147

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIV 489
           ++  + GSVS+YC H+     +I+
Sbjct: 148 VRSVLQGSVSEYCFHNCKSAPVII 171



>gb:AB026636_1517055 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K14A17.>gb:AY050480_1562254 Arabidopsis
           thaliana AT3g17020/K14A17_14 mRNA, complete
           cds.>gb:AF378888_1793473 Arabidopsis thaliana
           AT3g17020/K14A17_14 mRNA, complete cds.
          Length = 163

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 43/150 (28%), Positives = 69/150 (46%), Gaps = 7/150 (4%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD-S 240
           VAVD S+ S  AL W +D+          + + H        + L     +  +P  + S
Sbjct: 11  VAVDFSDCSKKALSWAIDNVVRDGDHLILITIAHDMNYEEGEMQLWETVGSPFIPMSEFS 70

Query: 241 D---LKKIAARVIERAKEI---CASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS 402
           D   +KK A +      +I    A K     + +I  GD R  +C   E+   S LV+G+
Sbjct: 71  DAAVMKKYALKPDAETLDIVNTAARKKTITVVMKIYWGDPREKICAAAEQIPLSSLVMGN 130

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            G G +KR ++GSVS++  ++  C V +VK
Sbjct: 131 RGLGGLKRMIMGSVSNHVVNNVACPVTVVK 160



>gb:AY223460_1176918 Schistosoma japonicum clone ZZZ49 mRNA
           sequence.
          Length = 184

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 10/159 (6%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS--PANAVSLAGPGAA---DI 222
           +++ VD SEHS  A  W +D+      +T  L LVH      P    +LA    +   D 
Sbjct: 31  VLMPVDGSEHSERAFNWYMDNIMK---TTDGLYLVHIVEPLLPGLNYNLACKSPSIKEDF 87

Query: 223 LPHVDSDLKK---IAARVIERAKEICASKSVDDPMFEIMEGD--ARNVLCETVEKHHASI 387
             H++S ++    + A+   R +E     S     F I  G     N++     +H A++
Sbjct: 88  STHINSLVESGRALRAKFFTRCEE-----SGLTARFTIHVGTKPGENIV-RLANEHGANL 141

Query: 388 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH 504
           +++G+ G G +KR  LGSVSD+  H+ +  V+I+  PKH
Sbjct: 142 VIIGNRGIGTVKRTFLGSVSDHVLHNVNVPVIIIPPPKH 180



>sp|Q57951|Y531_METJA Hypothetical protein MJ0531.>pir|C64366|C64366
           hypothetical protein homolog MJ0531 - Methanococcus
           jannaschii>gb:U67502_206629 Methanocaldococcus
           jannaschii DSM 2661 section 44 of 150 of the complete
           genome.>gb:L77117_1099387 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 170

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 39/148 (26%), Positives = 73/148 (49%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V+  D S+ S  A    ++         + + +V   P     V L   G+ +++  + 
Sbjct: 29  IVIPTDGSDVSLEAAKHAINIAKEFDAEVYAIYVVDVSPF----VGLPAEGSWELISEL- 83

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             LK+     +++ K++     V     E++EG   N + E  EK  A ++V+G+ G   
Sbjct: 84  --LKEEGQEALKKVKKMAEEWGVKIHT-EMLEGVPANEIVEFAEKKKADLIVMGTTGKTG 140

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           ++R +LGSV++    +AHC V++VKKPK
Sbjct: 141 LERILLGSVAERVIKNAHCPVLVVKKPK 168



>gb:VFA271816_1727095 Vicia faba mRNA for early nodulin ENOD18
           (enod18 gene), clone X9-2.
          Length = 164

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 45/153 (29%), Positives = 74/153 (48%), Gaps = 10/153 (6%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           V +D S++S  AL W + +       TF L+ +++  S  +   L     + ++P    +
Sbjct: 9   VGIDFSKNSKNALKWAIVNM-ADKGDTFYLIHINSNSSDESRSKLFAKTGSPLIP---LE 64

Query: 244 LKKIAA----------RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           LK+              VI+   EI A++     + ++  GDAR  L +++E      LV
Sbjct: 65  LKEAGVMKQYGVQTDVEVIDLL-EIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALV 123

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +GS G   IKR +LGSVS++   H+ C V IVK
Sbjct: 124 LGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK 156



>gb:VFA271815_1727094 Vicia faba mRNA for early nodulin ENOD18
           (enod18 gene), clone X9-1.
          Length = 165

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 45/153 (29%), Positives = 74/153 (48%), Gaps = 10/153 (6%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           V +D S++S  AL W + +       TF L+ +++  S  +   L     + ++P    +
Sbjct: 9   VGIDFSKNSKNALKWAIVNM-ADKGDTFYLIHINSNSSDESRSKLFAKTGSPLIPL--EE 65

Query: 244 LKKIAA----------RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           LK+              VI+   EI A++     + ++  GDAR  L +++E      LV
Sbjct: 66  LKEAGVMKQYGVQTDVEVIDLL-EIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALV 124

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +GS G   IKR +LGSVS++   H+ C V IVK
Sbjct: 125 LGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK 157



>gb:AB110169_1526882 Oryza sativa (japonica cultivar-group) mRNA for
           hypothetical protein, complete cds, clone:
           12YPG019.>gb:AC093919_1736131 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1126_D01, complete
           sequence.
          Length = 165

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GDAR  LC+ VE+     LV+GS G G+I+R +LGSV++Y   +A C V +VK
Sbjct: 111 GDAREKLCDAVEEQKIDTLVMGSRGLGSIQRILLGSVTNYVLSNASCPVTVVK 163



>pir|T48641|T48641 hypothetical protein T15N1.170 - Arabidopsis
           thaliana>gb:ATT15N1_1554541 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T15N1 (ESSA
           project).>gb:BT011776_1641298 Arabidopsis thaliana
           At5g14680 mRNA, complete cds.>gb:BT015743_1642361
           Arabidopsis thaliana At5g14680 mRNA, complete cds.
          Length = 175

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 16/167 (9%)
 Frame = +1

Query: 43  AEKPVMVVAVDDSEHSFY---------ALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVS 195
           +E   ++VAV++S    Y         A  WTL        S F+L+L+H +    +   
Sbjct: 3   SEPTRVMVAVNESTLKGYPHASISSKKAFEWTLKKIVRSNTSGFKLLLLHVQVQDED--- 59

Query: 196 LAGPGAADILPHVDSDLKKIAAR-------VIERAKEICASKSVDDPMFEIMEGDARNVL 354
             G    D +     D +++  R       ++E   + C    V    + I +GD   ++
Sbjct: 60  --GFDDMDSIYASPDDFRQMRERNKAKGLHLLEFFVKKCHDIGVGCEAW-IRKGDPTELI 116

Query: 355 CETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           C  V +     LVVGS G G  ++  +G+VS++C  HA C V+ +K+
Sbjct: 117 CHEVRRVRPDFLVVGSRGLGPFQKVFVGTVSEFCVKHAECPVITIKR 163



>gb:VFA277286_1727096 Vicia faba partial enod18 gene, exons 1-4.
          Length = 164

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 45/153 (29%), Positives = 74/153 (48%), Gaps = 10/153 (6%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           V +D S++S  AL W + +       TF L+ +++  S  +   L     + ++P    +
Sbjct: 8   VGIDFSKNSKNALKWAIVNM-ADKGDTFYLIHINSNSSDESRNKLFAKTGSPLIPL--EE 64

Query: 244 LKKIAA----------RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           LK+              VI+   EI A++     + ++  GDAR  L +++E      LV
Sbjct: 65  LKEAGVMKQYGVQTDVEVIDLL-EIAATQKEVSVVAKLYWGDARQKLMDSIEDLKLDALV 123

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +GS G   IKR +LGSVS++   H+ C V IVK
Sbjct: 124 LGSRGLSTIKRILLGSVSNFVMVHSPCPVTIVK 156



>pir|E90349|E90349 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006795_222664 Sulfolobus
           solfataricus P2 section 154 of 272 of the complete
           genome.>gb:AE006641_1108512 Sulfolobus solfataricus P2,
           complete genome.
          Length = 143

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 34/99 (34%), Positives = 48/99 (48%)
 Frame = +1

Query: 196 LAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH 375
           LAG G   I   V +++   A R +E AKE   +  V +     +EGD    + +   K 
Sbjct: 45  LAGMGLGPIPGEVINEMYNKAKRDVEEAKEKAVNSGVKNVEAVNIEGDPAAAIMDYAGKT 104

Query: 376 HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            A ++V GS G   +KR  LGSVS    H A   V++VK
Sbjct: 105 GADLIVTGSRGLSTVKRIFLGSVSSRIVHEAKIPVLVVK 143



>gb:AP005323_1850631 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0680A05.
          Length = 184

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 44/144 (30%), Positives = 67/144 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD   +S +A  W L HF         L LVHA  S  N          D++    
Sbjct: 49  LLVAVDFGPNSKHAFDWALVHFAR---MADTLHLVHAVSSVNN----------DLVYEKS 95

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
            +L +  A  IE  K      S+      I+EGDA  V+C   E+   + +++G+ G G 
Sbjct: 96  QELMEDLA--IEALKT-----SLVRTKARIVEGDAGKVICREAERLKPAAVILGTRGRGL 148

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIV 489
           I+  + GSVS+YC H+     +I+
Sbjct: 149 IQSVLQGSVSEYCFHNCKAAPVII 172



>gb:AE017180_400629 Geobacter sulfurreducens PCA, complete genome.
          Length = 147

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 30/83 (36%), Positives = 47/83 (56%)
 Frame = +1

Query: 244 LKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIK 423
           L  + A   +RA E+  + +       ++EG  ++ +    E+  A ++VVG+HGYG I+
Sbjct: 70  LNAVTADFAQRAPELSVTSA-------LLEGRPKDAILSEAERWGADLIVVGAHGYGVIR 122

Query: 424 RAVLGSVSDYCAHHAHCTVMIVK 492
           R  LGSVS   A HA C+V IV+
Sbjct: 123 RFFLGSVSLAVALHAPCSVEIVR 145



>gb:BX294153_771173 Pirellula sp. strain 1 complete genome; segment
           21/24.
          Length = 315

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 39/145 (26%), Positives = 72/145 (49%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++AVD S +S  A+ +        PV  F LV V A P   +   ++ P        ++
Sbjct: 3   VLLAVDSSPYSQQAVEFASHLPLRKPVD-FDLVSVVAPPMLVDTGGMSMPMDFGSFLEIE 61

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           +D  + A   +  A ++ +   V      +  G   + L +  ++  A ++V+G+ G+ A
Sbjct: 62  TDRSREAIDAV--ASDLKSQDHVHSVHTHVPIGPPTSALLDVADESGADLIVLGAIGHSA 119

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
           I+R +LGSVSDY A HA  + ++V+
Sbjct: 120 IERVLLGSVSDYVATHADMSTLVVR 144



 Score = 38.5 bits (88), Expect = 0.095
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +1

Query: 352 LCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           L E   +H   + V G    G + R  LGS S Y   HA C+V+I++
Sbjct: 249 LVEYARRHGCDLAVTGDSDSGLLTRVFLGSTSRYVLRHADCSVLIIR 295



>pir|B86857|B86857 conserved hypothetical protein ytcD [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006416_218760 Lactococcus lactis subsp.
           lactis IL1403 section 178 of 218 of the complete
           genome.>gb:AE005176_1095833 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 143

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 42/152 (27%), Positives = 75/152 (49%), Gaps = 7/152 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD SE ++ AL   +D        T +L   H K      + +     A+I  H+D
Sbjct: 8   ILVAVDGSEQAYDALREAVD--------TAKLNHSHLK-----ILYVLNDKLANIPVHLD 54

Query: 238 S-----DLKKIAARVIERAKEICASKSVDDPMFEIME--GDARNVLCETVEKHHASILVV 396
           +      +++ +  V+E+ +E      VD   FEI+   G  +  +     +++  ++V+
Sbjct: 55  TMTLYKSVQEHSDYVVEQVQEYLKGTEVD---FEIVRLTGSPKREIINYANENNIDLVVI 111

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GS G  AI R ++GS + Y  +HA C VM++K
Sbjct: 112 GSTGLDAIDRFIIGSTTQYIVNHASCNVMVIK 143



>gb:AY220736_1590528 Hordeum vulgare pathogen induced protein 2-4
           (PI2-4) mRNA, complete cds.
          Length = 180

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 42/148 (28%), Positives = 68/148 (45%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VA+D   +S +A  W L H          L LVHA  S  N          D++ +  
Sbjct: 45  LLVAIDFGPNSRHAFRWALAHLAR---IADTLHLVHAVSSVHN----------DLVYNKS 91

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
            +L    A  +E  KE     S+      I+EGDA  V+C   E+ + + +++G+ G   
Sbjct: 92  QELMDELA--VEAFKE-----SLVHTKARIIEGDAGKVICREAERLNPAAVIIGTRGRSL 144

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           I+  + GSVS+YC H+     +I+   K
Sbjct: 145 IQSVLQGSVSEYCFHNCKAAPVIIVPAK 172



>gb:BA000023_692178 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 157

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 42/145 (28%), Positives = 63/145 (43%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VA D S+H+  AL   +D          +L +V       +  +L G G A I   V 
Sbjct: 20  ILVAYDGSDHAARALDIGID---LAKRYEAKLDIVEV----VDTAALLGMGVAPIPGEVI 72

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             +   A   I  AK    ++ V D    ++EGD    + E   K+   ++V GS G   
Sbjct: 73  QQVYNKAKSDINNAKAKAQNQGVKDVEGVVLEGDPATAILEYAGKNGVDLIVTGSRGLST 132

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
            KR +LGSVS      A   V++VK
Sbjct: 133 FKRIILGSVSTKLVQEAKIPVLVVK 157



>gb:AY050416_1562193 Arabidopsis thaliana At1g11360/T23J18_35 mRNA,
           complete cds.>gb:AY058237_1564362 Arabidopsis thaliana
           At1g11360/T23J18_35 mRNA, complete cds.
          Length = 103

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 3/55 (5%)
 Frame = +1

Query: 352 LCETVEKHHASILVVGSHGYGAIKRAV---LGSVSDYCAHHAHCTVMIVKKPKHK 507
           LC  VE+   S L++GS G+GA KR+    LGSVSDY  HH  C V++V+ P  K
Sbjct: 5   LCLEVERLGLSTLIMGSRGFGATKRSSKGRLGSVSDYSVHHCACPVVVVRFPDDK 59



>gb:AE017180_398567 Geobacter sulfurreducens PCA, complete genome.
          Length = 155

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +1

Query: 256 AARVIERAKEICASKSVDDPMFEIM-EGDARNVLCETVEKHHASILVVGSHGYGAIKRAV 432
           AA+ ++ A E    ++ D  +  ++ EG  +N + +  E+  A ++VVGS G GA+KR  
Sbjct: 66  AAKRLKDAAETLQQRAPDLHVTPVLLEGRPKNAILDEAERWCADLIVVGSQGSGALKRFF 125

Query: 433 LGSVSDYCAHHAHCTVMIVKK 495
           LGSVS   A HA C+V I+++
Sbjct: 126 LGSVSLAVALHAPCSVEIIRR 146



>pir|C86634|C86634 conserved hypothetical protein yahB [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006246_216977 Lactococcus lactis subsp.
           lactis IL1403 section 8 of 218 of the complete
           genome.>gb:AE005176_1094050 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 155

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 29/111 (26%), Positives = 57/111 (51%)
 Frame = +1

Query: 160 VHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGD 339
           ++A  +P   V          +P ++      A  V+++A  I  ++   + +   ++G 
Sbjct: 47  IYAAGNPVPVVPAPAIPVVPAVPVLEESADNEAKEVLDKALAIINNEVKFEEIR--VDGS 104

Query: 340 ARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           A+N + +  ++H   ++V+GS G GA+ R +LGS + Y   HA C+V I+K
Sbjct: 105 AKNEIVDFAKEHEIDMIVMGSSGKGALDRMLLGSTAVYVVKHAPCSVTIIK 155



>gb:AC084817_1733843 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0419C04, complete
           sequence.>gb:AC087553_1734108 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0685E10, complete
           sequence.
          Length = 203

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 48/155 (30%), Positives = 71/155 (45%), Gaps = 11/155 (7%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPS------PANAVSLAGPGAADIL 225
           VA+D S  S  AL W             RLVLVH KPS       A+     G     ++
Sbjct: 31  VAMDFSACSKAALRWAAASLAR---PGDRLVLVHVKPSFQYEQGVAHLWEQQGSPMIPLV 87

Query: 226 PHVDSDLKKIAARVIERAKEI-----CASKSVDDPMFEIMEGDARNVLCETVEKHHASIL 390
              D  + +I   V   A+ I      A++   + + ++  G+    L E  +      L
Sbjct: 88  ELADPRVSRIYG-VAPDAETIGILTSAANQKGVEVVAKVYWGEPAKKLTEAAQGIPLHWL 146

Query: 391 VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           VVG+ G GA+KR ++GSVS Y A+HA C V +V++
Sbjct: 147 VVGNRGLGAVKRVLMGSVSTYVANHATCPVTVVRE 181



>gb:BA000035_717572 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 318

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 43/148 (29%), Positives = 69/148 (46%), Gaps = 1/148 (0%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           ++VVAVD SE S  A+ W  +      +   RL   +  P    A  +  P        +
Sbjct: 28  IVVVAVDGSEASKQAVRWAANTANKRGIP-LRLASSYTMPQFLYAEGMVPP------QEL 80

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPM-FEIMEGDARNVLCETVEKHHASILVVGSHGY 411
             DL+  A   I+ A+ I    + D  +   I EG   ++L E  +    +++V+GS G 
Sbjct: 81  FDDLQAEALEKIDEARAIAHEVAPDIKIGHTIAEGSPIDMLLEMSKS--VTMIVMGSRGL 138

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           G +   V+GSVS     HAHC V++V++
Sbjct: 139 GGLSGMVMGSVSGAVVSHAHCPVVVVRE 166



 Score = 43.9 bits (102), Expect = 0.002
 Identities = 46/145 (31%), Positives = 63/145 (43%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VV VD SE S  A   T   F         L+ VH         SLAG  AA      D
Sbjct: 179 VVVGVDGSEVSQRA---TEVAFAEASARGAELIAVHTWMDMQVQASLAGLAAAQ--QQWD 233

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
              ++    + ER + + A +  D P+ +++  D R V         A +LVVGSHG G 
Sbjct: 234 EVEREQTELLTERIQPL-ADQYPDVPVKKVITRD-RPVRALAEASEGAQLLVVGSHGRGG 291

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
            K  +LGS S      A C +M+V+
Sbjct: 292 FKGMLLGSTSRALLQSAPCPMMVVR 316



>gb:AP003242_1826082 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0414E03.
          Length = 162

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 42/155 (27%), Positives = 71/155 (45%), Gaps = 12/155 (7%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           VA+D S  S  AL W  D+      +   L + H     A  V  +  G+  ++P     
Sbjct: 12  VAMDFSPSSKKALQWAADNLLRKGDTLVLLHIRHHGRDEAKNVLWSHTGSP-LIP----- 65

Query: 244 LKKIAARVIERAKEICASKSVDDPMFEIME------------GDARNVLCETVEKHHASI 387
           L+++    + +  +I + + V D +  +              G+ R  +CE V + +   
Sbjct: 66  LEELMETAVRQRYDIPSDEEVFDMLNAVSREKELSVVLKMYWGEPREKVCEAVGELNLES 125

Query: 388 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           LV+GS G G I+R +LGSV++Y   +A C V +VK
Sbjct: 126 LVMGSRGLGQIQRILLGSVTNYVLSNASCPVTVVK 160



>gb:ATAC012328_1543412 Arabidopsis thaliana chromosome III BAC
           T17B22 genomic sequence, complete sequence.
          Length = 159

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 34/53 (64%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GD R  LC+ VE      +V+GS G G++KR +LGSVS++   +A C V +VK
Sbjct: 105 GDPREKLCDAVENLKLDSIVLGSRGLGSLKRILLGSVSNHVVTNATCPVTVVK 157



>gb:AE011302_271449 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 111 of 397 of the complete
           sequence.>gb:AE017296_434658 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 10 of 14 of the complete
           sequence.>gb:AE010300_1004848 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067669 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 160

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 22/56 (39%), Positives = 36/56 (64%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           ++EG   + + ET  K +  ++V+GS G  A+ R ++GSVSD   HHA C+V +V+
Sbjct: 105 VLEGYPADTIVETATKGNYDMIVIGSRGLSAVGRFLVGSVSDRIVHHATCSVTVVR 160



>gb:BA000043_739332 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 146

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
 Frame = +1

Query: 247 KKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE-KHHASILVVGSHGYGAIK 423
           ++ A  ++ER K    +  +DD    +  G  +  + + V  K+ A ++V G+ G  A++
Sbjct: 60  EQYANELLERYKNEAIAAGLDDVDIAVEFGSPKVKIAKDVAPKYKADLIVCGATGLNAVE 119

Query: 424 RAVLGSVSDYCAHHAHCTVMIVKKPK 501
           R ++GSVS+    HA C V++V+ PK
Sbjct: 120 RLLIGSVSENIVRHAKCDVLVVRTPK 145



>pir|AG1946|AG1946 hypothetical protein all1122 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682113 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 170

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 20/53 (37%), Positives = 32/53 (60%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GD    +CE      A +++VG  G   +   +LGSVS+Y  HHAHC+V++++
Sbjct: 105 GDPGRTICEIALSWPADLIMVGRRGRAGLSEFLLGSVSNYVLHHAHCSVLVIQ 157



>sp|P72745|YB01_SYNY3 Hypothetical protein
           slr1101.>pir|S74608|S74608 hypothetical protein slr1101
           - Synechocystis sp. (strain PCC 6803)>gb:BA000022_687539
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 108

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 20/55 (36%), Positives = 32/55 (58%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           G    ++C+  ++ ++ I+VVG  G   +   +LGSV +Y  HHAHC V +V  P
Sbjct: 53  GSPGKIICQRAKQDNSDIIVVGHRGRWGLSEILLGSVGNYVFHHAHCCVFVVPTP 107



>pir|A70942|A70942 hypothetical protein Rv2026c - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_22136
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248341_759407 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           8/14.>gb:BX842578_820101 Mycobacterium tuberculosis
           H37Rv complete genome; segment 7/13.
          Length = 294

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 46/155 (29%), Positives = 70/155 (45%), Gaps = 2/155 (1%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPG 210
           M+AA  K  ++V VD S  S  A+ W         +    + L+H       A  + G  
Sbjct: 1   MSAATAKYGILVGVDGSAQSNAAVAWAARE---AVMRQLPITLLHIV-----APVVVGWP 52

Query: 211 AADILPHVDSDLKKIAARVIERAKE-ICASKSVDDPMFEIMEGDARNVLCETVE-KHHAS 384
              +  ++    K  A +VIE+A+E +  S     P     E    NV+   ++    A 
Sbjct: 53  VGQLYANMTEWQKDNAQQVIEQAREALTNSLGESKPPQVHTELVFSNVVPTLIDASQQAW 112

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           ++VVGS G GA+ R +LGS+S    HHA C V I+
Sbjct: 113 LMVVGSQGMGALGRLLLGSISTALLHHARCPVAII 147



 Score = 36.6 bits (83), Expect = 0.36
 Identities = 17/38 (44%), Positives = 23/38 (60%)
 Frame = +1

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           A ++VVGSHG G     +LGSVS   AH     V++V+
Sbjct: 255 AQLVVVGSHGRGGFSGMLLGSVSSAVAHSVRIPVIVVR 292



>gb:AJ630657_1812770 Cicer arietinum mRNA for putative universal
           stress protein (Usp gene).
          Length = 178

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 34/145 (23%), Positives = 65/145 (44%), Gaps = 1/145 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V+A+D   +S +A  W L H          + LVHA               +D+   + 
Sbjct: 43  IVIAIDHGPNSKHAFDWALIHLCR---LADTIHLVHA--------------VSDVKNQIV 85

Query: 238 SDLKKIAA-RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG 414
            D+ ++   ++   A ++   K+V      I+EGD   V+C+  E+   + +V+G+ G  
Sbjct: 86  YDMTQVLMEKLAVEAFQVAMVKTVA----RIVEGDTGKVICKEAERTKPAAVVMGTRGRS 141

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIV 489
             +  + GSV +YC HH     +++
Sbjct: 142 LFQSVLHGSVGEYCFHHCKAAPLVI 166



>gb:AY297449_1596430 Solanum tuberosum anti-bacterial protein (ap1)
           mRNA, complete cds.
          Length = 343

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 6/65 (9%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGA------IKRAVLGSVSDYCAHHAHCTVMI 486
           + + D +  LC  VE+   S +++GS G+GA      I +  LGSVSDYC  +  C V++
Sbjct: 245 VKDRDMKERLCLEVERLRLSAMIMGSRGFGANDIRGIISKGKLGSVSDYCVKNCICPVVV 304

Query: 487 VKKPK 501
           V+ P+
Sbjct: 305 VRYPQ 309



>gb:AL935259_552253 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 8/11.
          Length = 153

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 1/103 (0%)
 Frame = +1

Query: 202 GPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLC-ETVEKHH 378
           G  + D++  +  D++K     +E  K+      V D    +  G+ + V+  E    HH
Sbjct: 53  GAVSGDVIYKLSEDVQKR----LEELKQQTIDAGVTDVDVHVRFGNPKTVIAREFPADHH 108

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
             ++++GS G  A++R ++GSV+ Y + +A C V+IVK    K
Sbjct: 109 NELIMIGSTGLSAVERLMVGSVTTYVSRNAICDVLIVKPAAKK 151



>gb:AE017202_404157 Lactobacillus johnsonii NCC 533, section 3 of 7
           of the complete genome.>gb:AE017198_1122644
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 159

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 24/94 (25%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +1

Query: 220 ILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLC-ETVEKHHASILVV 396
           ++  V  + K        RAK+      V D  + I  G  +N++  E  E+H+  ++++
Sbjct: 57  MVEQVSEEAKTKIEEYYNRAKDA----GVKDVHYSIEFGSPKNIIAHEFPEEHNIDLIIL 112

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           G+ G  A++R ++GS+++Y    A C V+++++P
Sbjct: 113 GATGLNAVERLLIGSITEYVTRTAACDVLVIRQP 146



>pir|F95336|F95336 hypothetical protein SMa1100 [imported] -
           Sinorhizobium meliloti (strain 1021) magaplasmid
           pSymA>gb:AE007249_224558 Sinorhizobium meliloti 1021
           plasmid pSymA section 55 of 121 of the complete plasmid
           sequence.>gb:AE006469_1102326 Sinorhizobium meliloti
           1021 plasmid pSymA, complete sequence.
          Length = 153

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 30/114 (26%), Positives = 52/114 (45%)
 Frame = +1

Query: 151 LVLVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIM 330
           + L   +P P   V+L      D+   V      +  R++E A E   S   D     + 
Sbjct: 44  VTLPDLQPIPETMVNLFRASHGDLGEMVSI----LGDRIVEEAAESARSIGADRVDARVE 99

Query: 331 EGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            GD    +    ++  A ++VVGS G G ++  ++GSVS     H+ C+V++V+
Sbjct: 100 PGDYAETILGVADEVDADLIVVGSRGLGGLRGLLVGSVSQKVVQHSDCSVLVVR 153



>gb:AC116986_1207547 Dictyostelium discoideum chromosome 2 map
           2234041-2567370 strain AX4, complete sequence.
          Length = 225

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 2/146 (1%)
 Frame = +1

Query: 61  VVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDS 240
           ++AVD+  ++ +++   ++H F        L+ V   P    + +++    ++ L  ++ 
Sbjct: 5   MIAVDEGSNTEHSIKEIINHVFQKDKDLLYLISVAEDPITFPSSAISAVVVSETLKAIER 64

Query: 241 DLKKIAARVIERAKEICASKSVDDPMFEIMEGD--ARNVLCETVEKHHASILVVGSHGYG 414
             K I   +I RA  +C +  V +    +  G+     V+   VEK     LVVG  G G
Sbjct: 65  KHKSI---LINRAN-LCKNLGVQNVKALLGHGNHVGEAVIKAAVEKD-IHYLVVGRRGIG 119

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
            IKR  +GS S Y   HA C V+ +K
Sbjct: 120 PIKRIFIGSTSRYILEHAKCNVICIK 145



>gb:BX248360_763527 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 7/8.
          Length = 300

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 1/153 (0%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           ++VVAVD SE S  A+ W  +      V   RL   +  P    A  +  P        +
Sbjct: 6   IVVVAVDGSEASQNAVRWAANTANKRGVP-LRLAASYTMPQFLYAEGMVPP------QEL 58

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPM-FEIMEGDARNVLCETVEKHHASILVVGSHGY 411
             +L+     +IE A+ +    + D  + + I EG   ++L +       +++V+GS G 
Sbjct: 59  FDELQSETMDMIEAARVVAHEVAPDIKIGYVIAEGSPIDMLLDM--SSDVTMIVMGSRGL 116

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
           G +   V+GSVS     HA C V++V+   H T
Sbjct: 117 GGLSGMVMGSVSAAVVSHADCPVVVVRSDNHVT 149



 Score = 38.5 bits (88), Expect = 0.095
 Identities = 20/45 (44%), Positives = 26/45 (57%)
 Frame = +1

Query: 373 HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           H+A +LVVGSHG G  +  +LGS S      A C  M+V +P  K
Sbjct: 255 HNAQLLVVGSHGRGGFRGMLLGSTSRALLQSAPCP-MVVVRPNEK 298



>gb:BA000039_728156 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 163

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 40/163 (24%), Positives = 69/163 (42%), Gaps = 17/163 (10%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLD---HFFTGPVSTFRLVLVH-------AKPSPANAVSLAGP 207
           ++VAVDDSE         LD   H+        R++L+H       + P P     LA  
Sbjct: 5   ILVAVDDSELGEQVFQTALDLAQHYQA------RMMLIHVLSPTHESYPDPIFTTPLASG 58

Query: 208 GAADILPHVD-------SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV 366
               +   V         + ++    ++    +I   K V     + + GDA   +C+  
Sbjct: 59  VYVGLHEEVMRAYAEQWENFEQKGLDMLRNLTQIATEKGVPTEFTQAL-GDAGRAICDLA 117

Query: 367 EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           +   + ++V+G  G   +    LGSVS+Y  H+AHC V+ V++
Sbjct: 118 KDWESDLIVLGRRGLKGLSEFFLGSVSNYVLHNAHCCVLTVQR 160



>gb:AE016950_365146 Enterococcus faecalis V583, section 4 of 11 of
           the complete genome.>gb:AE016830_991634 Enterococcus
           faecalis V583, complete genome.
          Length = 143

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 28/86 (32%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query: 241 DLKKIAARVIERAKEICASKSVDDPMFEIME-GDARNVLCETVEKHHA-SILVVGSHGYG 414
           DL+K  +  +   K   AS+     + +I+E G  +  L  T+ +++A  ++V+G+ G G
Sbjct: 58  DLEKHKSEEMLTGKAKQASEIGVKTVKKIVELGSPKRYLANTISENYAIDLIVLGATGRG 117

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
           AI+R ++GS +DY  +HA C V++V+
Sbjct: 118 AIQRTLIGSTTDYVVNHALCNVLVVR 143



>sp|P42297|YXIE_BACSU Hypothetical protein yxiE
           precursor.>pir|A70077|A70077 conserved hypothetical
           protein yxiE N17E [imported] - Bacillus
           subtilis>gb:BACHUTWAPA_745471 Bacillus subtilis genome
           containing the hut and wapA loci.>gb:BACHYPTP_745486
           Bacillus subtilis wapA and orf genes for wall-associated
           protein and hypothetical proteins.>gb:BSUB0021_755890
           Bacillus subtilis complete genome (section 21 of 21):
           from 4010730 to 4214630.
          Length = 148

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 29/90 (32%), Positives = 46/90 (51%)
 Frame = +1

Query: 223 LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS 402
           +  + +++KK   +++E AKE  A K V           A  +L    EK   S++VVGS
Sbjct: 60  IDEIRNEVKKEGLKILENAKEKAAEKGVQAETIYANGEPAHEILNHAKEKG-VSLIVVGS 118

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            G   +K  +LGSVS   +  + C V+IV+
Sbjct: 119 RGISGLKEMMLGSVSHKVSQLSTCPVLIVR 148



>gb:AP006618_559393 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 296

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 41/148 (27%), Positives = 64/148 (43%), Gaps = 1/148 (0%)
 Frame = +1

Query: 49  KPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILP 228
           +PV+V AVD S  +  A  W          +   L  V      +   +L G      L 
Sbjct: 10  EPVIVAAVDGSASAQQAAAWAAKEAVLHDCTLHLLTSVAVSTGYSTGRTLPGVE----LE 65

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK-HHASILVVGSH 405
            + S+ ++I A V +  +E      V   +    E     V+   +E+     ++VVGS 
Sbjct: 66  WLRSEGERIVAAVRDAVRE-----QVSAELTVTTEVTFEFVIPALLERSERVRMVVVGSR 120

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           G GA++R +LGSVS     HAHC V ++
Sbjct: 121 GLGALQRGLLGSVSTSVTRHAHCPVAVI 148



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 41/152 (26%), Positives = 70/152 (46%)
 Frame = +1

Query: 40  AAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAAD 219
           +A KPV+V  VD +++S  A+ +  +      V    +V +H+  + A  + +A      
Sbjct: 158 SAGKPVLV-GVDGTDNSVPAVDYAFEEASRRGVG---VVALHSW-TDATGLEIAVAEWDT 212

Query: 220 ILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVG 399
           I    +S L +  A   ER  ++        P+  I+  D R V     E   A ++VVG
Sbjct: 213 IATDEESLLAERLAGYAERYPDV--------PVRRIVVAD-RPVRALLSESEDAQLVVVG 263

Query: 400 SHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           SHG G     +LGS S+   H   C +++++K
Sbjct: 264 SHGRGGFTGMLLGSTSNALIHTVECPIVVIRK 295



>pir|G86734|G86734 conserved hypothetical protein yjaB [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006322_217781 Lactococcus lactis subsp.
           lactis IL1403 section 84 of 218 of the complete
           genome.>gb:AF320914_499684 Lactococcus lactis strain
           IL1403 YjaB (yjaB), HllB (hllB), and YjaD (yjaD) genes,
           complete cds.>gb:AE005176_1094854 Lactococcus lactis
           subsp. lactis IL1403, complete genome.
          Length = 141

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 5/77 (6%)
 Frame = +1

Query: 277 AKEICASKSV---DDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGS 441
           +KEI A   V   D+  FE+    G+ +  +    ++    ++VVGS+G G + R ++GS
Sbjct: 65  SKEIIAEVEVLINDEVEFEVHAFTGNPKKEIINFAKQFELDLIVVGSNGKGLLDRMLVGS 124

Query: 442 VSDYCAHHAHCTVMIVK 492
            + Y  +HA C VM+VK
Sbjct: 125 TTSYVVNHAPCNVMVVK 141



>pir|A69233|A69233 conserved hypothetical protein MTH993 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000872_28685 Methanobacterium
           thermoautotrophicum from bases 896604 to 912784 (section
           78 of 148) of the complete genome.>gb:AE000666_925767
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 143

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 1/100 (1%)
 Frame = +1

Query: 193 SLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPM-FEIMEGDARNVLCETVE 369
           SL G  A D++  +   L++ A+R +E  K++      D  +     EG     +  TVE
Sbjct: 43  SLVGLPADDLIIRLREMLEEEASRSLEAVKKLVEESGADIKLTVRTDEGSPAEAILRTVE 102

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           K    ++V+G+ G   + R +LGSV++     A C V++V
Sbjct: 103 KEGVDLVVMGTSGKHGLDRFLLGSVAEKVVRSAGCPVLVV 142



>gb:AY050353_1562132 Arabidopsis thaliana At2g21620/F2G1.11 mRNA,
           complete cds.>gb:AY094038_1575544 Arabidopsis thaliana
           At2g21620/F2G1.11 mRNA, complete cds.
          Length = 96

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 19/55 (34%), Positives = 34/55 (61%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           ++EGDA  V+C+  EK   + ++VG+ G   ++  + GSVS+YC H+     +I+
Sbjct: 20  VVEGDAGKVICKEAEKVKPAAVIVGTRGRSLVRSVLQGSVSEYCFHNCKSAPVII 74



>gb:BX294152_771171 Pirellula sp. strain 1 complete genome; segment
           20/24.
          Length = 345

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 46/79 (58%)
 Frame = +1

Query: 256 AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVL 435
           A R ++R  E+    +V     E++EG     + +  +   A ++VVG+ G+  I R +L
Sbjct: 106 ALRSLDRIAELFDGANVR-VRSELIEGVVGESIVQKAKDIRADLVVVGATGHSQISRMLL 164

Query: 436 GSVSDYCAHHAHCTVMIVK 492
           GS+SD+ A H+ C+V++V+
Sbjct: 165 GSISDFVATHSPCSVLVVR 183



 Score = 33.1 bits (74), Expect = 4.0
 Identities = 15/43 (34%), Positives = 22/43 (51%)
 Frame = +1

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           VE H  +++V+G        R +LGS S Y   H  C+V I +
Sbjct: 282 VETHDINLVVLGETPRSQFSRFLLGSTSQYVLRHVPCSVWITR 324



>gb:AE017180_399417 Geobacter sulfurreducens PCA, complete genome.
          Length = 149

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 41/152 (26%), Positives = 70/152 (46%), Gaps = 4/152 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V   D SE+S YA  + L         + RLV++H    P   V L G      +PHV 
Sbjct: 7   IVFPTDFSENSEYAFDYALT---LAKQFSARLVVIHVINEP---VDLRG----FYVPHVS 56

Query: 238 SDL--KKIAARVIERAKEICASKSVDDPMFE--IMEGDARNVLCETVEKHHASILVVGSH 405
            +   ++I A   +   + C +K  D   +   I+ G   + + +   +  AS++V+G+H
Sbjct: 57  FEKLEEEIVAAAEKMMDKFCRTKIKDHENYTSCIVSGIPYDEVLKKAAEEDASLIVMGTH 116

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           G   I   + GS ++    +A C VM V+ P+
Sbjct: 117 GRKGIDHFLFGSTAERVVRNAKCPVMTVRPPE 148



>pir|T36949|T36949 conserved hypothetical protein SCJ1.16c -
           Streptomyces coelicolor>gb:SCO939104_173843 Streptomyces
           coelicolor A3(2) complete genome; segment 1/29.
          Length = 294

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 45/148 (30%), Positives = 64/148 (43%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VV VD S+ S  A+ W +D           L LV+A  S       A P      P   
Sbjct: 8   LVVGVDGSDGSLLAIDWAVDE---AQRQGLPLRLVYA--SLWERYEGALPAMGRERPSEQ 62

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
              + I     ER +      +VD    + +  +A + L    E  HA+ +V GS G G 
Sbjct: 63  VMAENIVGTAAERVRRYDPGLTVDT---DTVPAEAVSALL--AEGRHATAVVTGSRGRGE 117

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           +K A+LGSVS   A  A C V++V+  K
Sbjct: 118 LKGALLGSVSLAVASRADCPVVVVRGEK 145



>pir|T45939|T45939 hypothetical protein F5K20.290 - Arabidopsis
           thaliana>gb:ATF5K20_1550803 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.>gb:AY052325_1562698
           Arabidopsis thaliana AT3g53990/F5K20_290 mRNA, complete
           cds.>gb:AY061900_1564919 Arabidopsis thaliana
           AT3g53990/F5K20_290 mRNA, complete
           cds.>gb:AY070476_1566859 Arabidopsis thaliana
           AT3g53990/F5K20_290 mRNA, complete
           cds.>gb:AF324682_1786394 Arabidopsis thaliana AT3g53990
           (AT3g53990/F5K20_290) mRNA, complete
           cds.>gb:AF325038_1786492 Arabidopsis thaliana AT3g53990
           (AT3g53990/F5K20_290) mRNA, complete
           cds.>gb:AF326902_1786761 Arabidopsis thaliana unknown
           protein (At3g53990) mRNA, complete
           cds.>gb:AF339721_1787765 Arabidopsis thaliana unknown
           protein (At3g53990) mRNA, complete
           cds.>gb:AF361855_1791446 Arabidopsis thaliana
           AT3g53990/F5K20_290 mRNA, complete cds.
          Length = 160

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 22/53 (41%), Positives = 32/53 (60%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GDAR  L + V+      +V+GS G  A++R ++GSVS +   HA C V +VK
Sbjct: 105 GDAREKLVDAVKDLKLDSIVMGSRGLSALQRIIMGSVSSFVIQHAPCPVTVVK 157



>gb:AE017355_463502 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 139

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 42/145 (28%), Positives = 64/145 (44%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++AVD SEHS  A    +         T  +VLV       N V +   G  ++    +
Sbjct: 5   ILLAVDGSEHSLRATQEAIKIASLANECTVEIVLVVDYAKAKNEV-IHAQGKEEL----E 59

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
              +K    + E+ K    S  V     +I+ G+    + E   K H  ++V+GS G  A
Sbjct: 60  LFRRKRLLPIEEKLKANRISYEV-----KILHGEPGPTIVEHANKGHFELVVLGSRGLNA 114

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
           ++  VLGSVS   A    C V+IVK
Sbjct: 115 LQEMVLGSVSHKVAKRVQCPVLIVK 139



>pir|H84635|H84635 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006403_1534089 Arabidopsis thaliana
           chromosome 2 clone T28I24 map mi238, complete sequence.
          Length = 816

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 45/162 (27%), Positives = 69/162 (42%), Gaps = 10/162 (6%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAK--PSPANAVSLAGPGAADILP 228
           V+ VA+D  + S +AL W +D+      S   ++LVH K  PSP N  +     +A +  
Sbjct: 19  VVAVAIDKDKSSQHALKWAVDNLLQRGQS---VILVHVKLRPSPLNNSASLHASSAKLSQ 75

Query: 229 H---VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVG 399
               V  D + I+  +    +  C  K +      + E D    L E V +    +LVVG
Sbjct: 76  DSSLVCRDPEGISKEIFLPFRCFCTRKDIQCQDVLLEESDVAKALVEYVNQAAIEVLVVG 135

Query: 400 SHGYGAIKR-----AVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
           S   G   R      + GS++        CTV I+ K K +T
Sbjct: 136 SSSKGGFLRFNKPTDIPGSITKNAPD--FCTVYIISKGKIQT 175



>gb:AY223450_1176909 Schistosoma japonicum clone ZZZ463 mRNA
           sequence.
          Length = 155

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 36/154 (23%), Positives = 66/154 (42%), Gaps = 1/154 (0%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPG 210
           M  +  K  + + VD SEHS  A+ W +   +        +  V     P+ +++     
Sbjct: 1   MNTSNRKRTVCLPVDGSEHSKRAVEWFIKEVYRPGDHVLFIHSVELPYLPSVSLTSGLKI 60

Query: 211 AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNV-LCETVEKHHASI 387
             D       +   +  ++      IC SK++    F +  G      + E  E+    +
Sbjct: 61  PVDDWTKALQENISLTNKLNNEYGYICESKNIPYE-FLVKNGSTPGAGIIEACEERPVDL 119

Query: 388 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           +++GS G G IKRA++GSVS Y  H+++   + V
Sbjct: 120 IIMGSRGLGRIKRAIIGSVSSYVVHNSNVPCITV 153



>gb:BA000036_720670 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927156_834477 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 9/10.>gb:AX063731_1458779 Sequence 13
           from Patent WO0100843.>gb:AX244013_1464597 Sequence 5
           from Patent WO0166573.>gb:AX244027_1464604 Sequence 19
           from Patent WO0166573.>gb:AX469818_1469343 Sequence 7
           from Patent WO02051231.
          Length = 301

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 47/155 (30%), Positives = 66/155 (42%), Gaps = 7/155 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAA----DIL 225
           +VV VD SE S  A  +    F         LV VH         SLAG  AA    D +
Sbjct: 157 VVVGVDGSEVSQQATEYA---FAEAEARGAELVAVHTWMDMQVQASLAGLAAAQQQWDEV 213

Query: 226 PHVDSD-LKKIAARVIERAKEICASKSV--DDPMFEIMEGDARNVLCETVEKHHASILVV 396
               +D L +  A ++E+   +   K +  D P+  + E              +A +LVV
Sbjct: 214 ERQQTDMLIERLAPLVEKYPSVTVKKIITRDRPVRALAEAS-----------ENAQLLVV 262

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           GSHG G  K  +LGS S      A C +M+V+ P+
Sbjct: 263 GSHGRGGFKGMLLGSTSRALLQSAPCPMMVVRPPE 297



 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 41/148 (27%), Positives = 68/148 (45%), Gaps = 1/148 (0%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           ++VVAVD S+ S  A+ W  +      +   RL   +  P    A  +  P        +
Sbjct: 6   IVVVAVDGSDASKQAVRWAANTANKRGIP-LRLASSYTMPQFLYAEGMVPP------QEL 58

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPM-FEIMEGDARNVLCETVEKHHASILVVGSHGY 411
             DL+  A   I  A++I    + +  +   I EG   ++L E      A+++V+GS G 
Sbjct: 59  FDDLQAEALEKINEARDIAHEVAPEIKIGHTIAEGSPIDMLLEM--SPDATMIVMGSRGL 116

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           G +   V+GSVS     HA C V++V++
Sbjct: 117 GGLSGMVMGSVSGAVVSHAKCPVVVVRE 144



>gb:AE017233_412446 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 7 of 16 of the complete
           genome.>gb:AE016958_1055850 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 294

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 42/155 (27%), Positives = 72/155 (46%), Gaps = 2/155 (1%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSL--AG 204
           MAA++++  ++V VD S  S +A+ W         +    L LVH      NA ++    
Sbjct: 1   MAASSKRCGVLVGVDGSPASNFAVCWAARD---AAMRNVPLTLVHM----VNAATVWPQV 53

Query: 205 PGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHAS 384
           P AA+ +   + D +++    ++ A++   +        E+        L +  E+  A 
Sbjct: 54  PMAAEAVAWQEDDGRRVLQEAVKIAEDATRNGRKLAITTELWHAPPAPTLAQLSEE--AE 111

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           ++VVGS G GAI R +LGSVS      A C V ++
Sbjct: 112 LVVVGSTGRGAIGRLLLGSVSSGLVRRARCPVAVI 146



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = +1

Query: 367 EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +   A + VVGSHG G +   +LGSVS+   H     V++ +
Sbjct: 251 QSESAQLTVVGSHGRGGLAGTLLGSVSNAVVHSVRMPVIVAR 292



>gb:CP000033_88465 Lactobacillus acidophilus NCFM, complete genome.
          Length = 161

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 21/63 (33%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +1

Query: 307 DDPMFEIMEGDARNVLC-ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVM 483
           DD  + I  G  + ++  + ++ HH +++V+G+ G  A++R ++GSV++Y   HA   V+
Sbjct: 84  DDIDYHIRYGSPKRIISYDFIKDHHNNLIVMGATGLNAVERMLMGSVTEYVNQHALADVL 143

Query: 484 IVK 492
           IVK
Sbjct: 144 IVK 146



>pir|AI1885|AI1885 hypothetical protein all0634 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681626 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 173

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 20/53 (37%), Positives = 31/53 (58%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GD   ++CE     +A ++V+G  G   +    LGSVS+Y  HHA C+V+ V+
Sbjct: 105 GDPSRLICEIARGWNADLIVLGRRGLHGLSEFFLGSVSNYVLHHAPCSVLTVQ 157



>gb:BA000045_743625 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 141

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 1/146 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD SE ++  +   L H    P     +VL H  P P +   +     AD+ PH  
Sbjct: 5   VLVAVDSSEFAWRVIE-ALSHLHLAP--NCLVVLAHIVPPPTSEDFVE----ADV-PHTQ 56

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMF-EIMEGDARNVLCETVEKHHASILVVGSHGYG 414
            +   +A         +  S  +D P   EI+ GDA   +      H   ++++GS G  
Sbjct: 57  QEGVPMAVEAESWLDTL--SVEIDYPTAQEIVTGDAAEEIVRLAGIHRCELILIGSRGLK 114

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
            + R + GSVS      A C+V +V+
Sbjct: 115 GLTRIIQGSVSSQVVADAPCSVYVVR 140



>gb:AP006618_559436 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 345

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 44/146 (30%), Positives = 62/146 (42%), Gaps = 2/146 (1%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGW--TLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPH 231
           +VVAVD S  S  A  W          P+     V V    +PA +V  A       L  
Sbjct: 62  IVVAVDGSPSSHQAAEWGAVAASLHDVPLHLIASVAVIGGFAPAMSVPQAE------LTW 115

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
           +  D ++I A   + A+E     +V       M+     +L  +     A  +VVGS G 
Sbjct: 116 MRDDGERIVAEAAQVAREAVRESAVPITTEVTMDLIIPTLLDRSKS---ARTVVVGSRGL 172

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIV 489
           GA +R +LGSVS     HAHC V ++
Sbjct: 173 GAFQRGLLGSVSTAVVRHAHCPVTVI 198



 Score = 32.3 bits (72), Expect = 6.8
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 2/150 (1%)
 Frame = +1

Query: 49  KPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILP 228
           KPV+V  VD SE S  A+ +         V    LV +H+  S A+ ++L      D+  
Sbjct: 211 KPVLV-GVDGSECSVAAVQYAFAEAARRKVD---LVALHSW-SDASTIALPA-NWDDVAE 264

Query: 229 HVDSDLKKIAARVIERAKEICASKSV--DDPMFEIMEGDARNVLCETVEKHHASILVVGS 402
              + L +  A   E+  ++   + V  D P+  +++  A            A ++VVGS
Sbjct: 265 EERAVLAERLAGFAEQYPDVQVRRIVVPDRPVRALLDASA-----------DAQLVVVGS 313

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            G G     +LGS S+   H   C + +++
Sbjct: 314 RGRGGFTGMLLGSTSNALLHVVECPITVIR 343



>gb:AE013140_289508 Thermoanaerobacter tengcongensis MB4, section
           167 of 244 of the complete genome.>gb:AE008691_1111573
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 139

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 23/77 (29%), Positives = 42/77 (54%)
 Frame = +1

Query: 262 RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGS 441
           +++  A+ +   K V     E++ G   + +    E H   ++VVG  G   +KR ++G+
Sbjct: 64  KLLGNARRLANEKGVK-VFTEVIVGHPVDSVIRFAENHGCDLIVVGEKGTSGLKRYIIGN 122

Query: 442 VSDYCAHHAHCTVMIVK 492
           V++  A HA C+V+IVK
Sbjct: 123 VAENIARHAKCSVLIVK 139



>gb:CR628336_111112 Legionella pneumophila str. Paris complete
           genome.
          Length = 143

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 1/119 (0%)
 Frame = +1

Query: 151 LVLVHA-KPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEI 327
           L+LVH  +P PA A     PG A     V+  +++ A + +    E+     VD+    I
Sbjct: 33  LILVHVVEPIPAYAY----PGFAGFA-EVEMSIREQAEKELN---ELAEKLGVDEKHRFI 84

Query: 328 MEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH 504
             G  +N +    ++H   ++V GSHG   +   +LGS ++   H A C V+IV+   H
Sbjct: 85  EYGSTKNEILRVAKEHKIDLIVTGSHGKHGLS-LLLGSTANAILHGAECDVLIVRPKIH 142



>gb:CR628337_115513 Legionella pneumophila str. Lens complete
           genome.
          Length = 295

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 34/146 (23%), Positives = 72/146 (49%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++A D S+H+ +AL   +       ++   +  +H    P +  S+A     ++ P+  
Sbjct: 7   LLIASDFSKHANWALQRAIG---LAKLNNAHIHFLHVVTPPLS--SIAQSSETELKPNHL 61

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           S+ K I  +++   K++ A+         ++ G A + +   V+++H  ++VVG+HG   
Sbjct: 62  SEKKAIEEKIL---KQLGANNHKLFANTSVVLGRASDEVVRYVDENHCELIVVGAHGTYY 118

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKK 495
           I   VLG+ S      +H  V+++KK
Sbjct: 119 INDYVLGTTSGSIIRQSHVPVLLIKK 144



>pir|A69220|A69220 conserved hypothetical protein MTH898 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000865_28592 Methanobacterium
           thermoautotrophicum from bases 808939 to 820180 (section
           71 of 148) of the complete genome.>gb:AE000666_925674
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 149

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 31/149 (20%), Positives = 66/149 (44%), Gaps = 1/149 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++A D SE S  A G+ ++           L +    P       L      ++   V 
Sbjct: 5   ILLATDGSECSMQAAGYAIETAAQNRAELLALTVTETYP-------LDNLPVEELTRKVT 57

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIM-EGDARNVLCETVEKHHASILVVGSHGYG 414
              +K +   +++ +++  S      + ++M +G     + +  ++ +  ++VVG+ G  
Sbjct: 58  ELFRKESEEALQKVEDLAVSLDTPVKVRKMMVDGSPAETILKVADEENVDLIVVGASGKH 117

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           A++R +LGSVS+    HA   V++V   K
Sbjct: 118 ALERFLLGSVSEKIVRHARVPVLVVHSKK 146



>gb:BA000045_744289 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 167

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 25/113 (22%), Positives = 54/113 (47%)
 Frame = +1

Query: 157 LVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEG 336
           L +  P+P +  +L G  A +    +   ++K +   +    E   +  V+    +   G
Sbjct: 47  LANPTPAPGDFYALIGATAFERYLELRETMQKESLEKLTALVEEARTAGVEANHAQYA-G 105

Query: 337 DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
              + +C+  ++  A ++V+G  G   +    LGSVS++  HHA C V+++++
Sbjct: 106 SPEHAICKMAKEWSADLIVLGRRGRSGLSELFLGSVSNHVVHHAPCAVLVLQQ 158



>gb:BA000028_696577 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 144

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 37/147 (25%), Positives = 71/147 (48%), Gaps = 1/147 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VVAVD S+ +  A   +LD       +  RL+L H   S   A + A   +  +    +
Sbjct: 7   IVVAVDGSKAAENAFNKSLD---IAKRNNSRLILAHVVDSRTFATAEAYDRS--LSDRAE 61

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK-HHASILVVGSHGYG 414
           +  K++    +E AK       + D    I  G  +  + + + K  HA +++ G+ G  
Sbjct: 62  TYAKELLNSYVETAK----GAGITDLARVIEYGSPKVKIAKEISKTFHADLIICGATGMN 117

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           A++R ++GSVS+    +A C V+++++
Sbjct: 118 AVERFLIGSVSESITRYAPCDVLVIRE 144



>gb:AE017333_446916 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856738 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 166

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 16/161 (9%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLD-------HFFTGPVSTFRLVLVHA---KPSPANAVSLAGP 207
           ++VA D  E S  AL   +D             V   R V   A   +P+       +G 
Sbjct: 7   IIVAFDGKEESKKALRKAIDLSKRLGSQLTVAHVHEPRQVRTEAAAERPAAGAPYLYSGF 66

Query: 208 GAADILPHVDSDLK------KIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVE 369
            AA  +P  DSDL       + +A     A +I  S++  D   E++EGD  N + +  E
Sbjct: 67  PAAPRIPR-DSDLAGEPMIYEDSAEEAIAAAKIILSENQYDAEIEVLEGDTANAVLQHAE 125

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
              A +++ G+     +K+ + GSVSD  +  +   V+IVK
Sbjct: 126 NIGADLVITGTRDQNRLKKLLFGSVSDKISTKSEIPVLIVK 166



>gb:AE016822_341146 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 146

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 2/146 (1%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V +D S  S  AL W       G +ST   + VHA P  + A        A   P  D
Sbjct: 9   ILVGMDGSPASIAALRWA------GRLSTVLDIPVHAVPLWSYAPWGEYVTVAIDTPETD 62

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEK--HHASILVVGSHGY 411
           ++  +         +E  A+   DDP            +  T+ K    + + V+GS G+
Sbjct: 63  AETAR---------REAIAAVFGDDPPARFRSEVIPGAVAATLVKLSRTSDLFVLGSRGH 113

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIV 489
           G     +LGSVS  CA H+ C VMI+
Sbjct: 114 GGFVGLLLGSVSAVCAAHSACPVMIM 139



>gb:AE014295_312320 Bifidobacterium longum NCC2705, complete genome.
          Length = 345

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 39/147 (26%), Positives = 70/147 (47%), Gaps = 3/147 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAA---DILP 228
           ++V VD S  S+ A  W  ++     + T ++V  ++ PS A AVS      A   D   
Sbjct: 7   ILVGVDGSHASYKATWWAANYAKHAGL-TLQIVCAYSLPSYA-AVSFDATYTAMGDDNAA 64

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHG 408
           H D      A  ++ +AK I   + V+     I+ GD  +V  E    ++  ++V+G+ G
Sbjct: 65  HSD------AQEILSKAKAIADEQGVEAATL-IVTGDPASVFVELSRNYN--LIVIGNRG 115

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIV 489
            G +   +LG+ S     +A+C +++V
Sbjct: 116 KGGLAERLLGTTSSSLPAYAYCPIVVV 142



>gb:AY596298_634841 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 294

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 27/100 (27%), Positives = 48/100 (48%)
 Frame = +1

Query: 202 GPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA 381
           GP A  +L   + +L + A  ++  A E     S+D     I  GD   V+C+ ++++  
Sbjct: 192 GPDARSVLK--EGELTERANEIMAGATEKIDDTSLDTVTSVIEHGDPSKVICDYIDENEV 249

Query: 382 SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
            + V+G+HG     R V+G VS      +   V  V++P+
Sbjct: 250 DLAVMGTHGQTDFSRYVMGGVSAKLVRKSPVPVTWVREPE 289



 Score = 32.7 bits (73), Expect = 5.2
 Identities = 17/82 (20%), Positives = 41/82 (50%)
 Frame = +1

Query: 262 RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGS 441
           R++  A +    + V   +  +++GD    + +  ++  +  +V+ +HG   I+R +LGS
Sbjct: 63  RIVAEATQYAKDEGVP-VVSAVLQGDPHKTIVDYSQQSDSDCIVMPTHGQRGIQRILLGS 121

Query: 442 VSDYCAHHAHCTVMIVKKPKHK 507
           V++   + A   V+ V   + +
Sbjct: 122 VTERVINTAEVPVIAVNPDRDR 143



>gb:AE017354_459308 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 143

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)
 Frame = +1

Query: 151 LVLVHA-KPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEI 327
           L+LVH  +P PA A     PG A     V+  +++ A + +    E+     VD+    I
Sbjct: 33  LILVHVVEPIPAYAY----PGFAGFA-EVEMSIREQAEKELN---ELAEKLGVDEKHRFI 84

Query: 328 MEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             G  +N +    ++H   ++V GSHG   +   +LGS ++   H A C V+IV+
Sbjct: 85  EYGSTKNEILRVAKEHKIDLIVTGSHGKHGLS-LLLGSTANAILHGAECDVLIVR 138



>gb:AE010314_261774 Methanopyrus kandleri AV19 section 13 of 157 of
           the complete genome.>gb:AE009439_902555 Methanopyrus
           kandleri AV19, complete genome.
          Length = 158

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 41/154 (26%), Positives = 73/154 (47%), Gaps = 6/154 (3%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTL----DHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADIL 225
           ++V  D SE +  AL W L    DH F  P+    +V         +   L G    +  
Sbjct: 5   ILVPFDGSEPAELALKWALLDAHDHGF--PIKVMYVV-------DRSLDLLTGFAPRET- 54

Query: 226 PHVDSDLKKIAARVIERAKEICASKSVDDPMFE-IMEGDA-RNVLCETVEKHHASILVVG 399
             V  +LK+   +++E A++I     VD  + + +  G   R ++ E  +    +++V+G
Sbjct: 55  --VLKELKERGEKILEEAEQIAGELGVDVKIEKKVCVGIPWREIVREAEDDEEINLIVMG 112

Query: 400 SHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           SHG    + A+LGSV++    H+   V++VK+ K
Sbjct: 113 SHGRTGPEHAILGSVAENVIRHSPVNVLVVKREK 146



>gb:CR628337_114164 Legionella pneumophila str. Lens complete
           genome.
          Length = 143

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 34/115 (29%), Positives = 56/115 (48%), Gaps = 1/115 (0%)
 Frame = +1

Query: 151 LVLVHA-KPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEI 327
           L+LVH  +P PA A     PG A     V+  +++ A + +    E+     VD+    I
Sbjct: 33  LILVHVVEPIPAYAY----PGFAGFA-EVEMSIREQAEKELN---ELAEKLGVDEKHRFI 84

Query: 328 MEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             G  +N +    ++H   ++V GSHG   +   +LGS ++   H A C V+IV+
Sbjct: 85  EYGSTKNEILRVAKEHKIDLIVTGSHGKHGLS-LLLGSTANAILHGAECDVLIVR 138



>gb:AE017306_437326 Thermus thermophilus HB27 section 6 of 7 of the
           complete genome.>gb:AE017221_1079304 Thermus
           thermophilus HB27 complete genome.
          Length = 144

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 1/146 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFT-GPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           +++  D S  S  AL   LD   T G    F  VL     +PA A+ +A P +      +
Sbjct: 5   ILMPTDGSPCSLQALEHGLDLAKTLGAKVHFLYVL----ENPAQAIWIA-PESVPYGMEL 59

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG 414
             DL+K     I++A ++  +K V+    E+ EG     + E  +++   +LV+G+HG  
Sbjct: 60  LEDLRKAGEEAIKKALDLARAKGVE-ATGEVKEGVPIPTIVEAAKEY--DLLVMGTHGRT 116

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
            + R +LGSV++   H     V++V+
Sbjct: 117 GLDRLLLGSVTEGVLHRTSVPVLVVR 142



>gb:AE013564_293407 Methanosarcina mazei strain Goe1, section 346 of
           379 of the complete genome.>gb:AE008384_967516
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 148

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 36/149 (24%), Positives = 73/149 (48%), Gaps = 4/149 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V+A D S +S  A+   ++      VS   + +VH   SP+    +   G   I   + 
Sbjct: 9   IVIATDGSANSMKAISRGIE---VAKVSGATVHVVHVVDSPSIISDVWTAGKDMIHEMMM 65

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEI----MEGDARNVLCETVEKHHASILVVGSH 405
           SD KKI ++         A K+++D   E+    ++G     + +  E+++  ++V+G+ 
Sbjct: 66  SDGKKILSK---------AKKTIEDSGVEVKDVLLDGHPGEEIIKFAERNNIDLIVMGTL 116

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G   +++ ++GSV++    H+   VMIV+
Sbjct: 117 GKTGLEKFLMGSVAEKVVRHSKVPVMIVR 145



>gb:NSP561198_156233 Actinomadura sp. ATCC 39727 gene cluster for
           biosynthesis of glycopeptide antibiotic A40926, strain
           ATCC 39727.
          Length = 281

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 37/148 (25%), Positives = 66/148 (44%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           +++V VD S     A GW         +    L + HA P     V       A++   +
Sbjct: 6   MIIVGVDGSRTGLEAAGWAAAE---AQLRQEPLTVAHAVPK---WVCEGAVRYAEVAQWM 59

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG 414
               + +     +RA+ +    S++  +   + GD R+ L +  E   A++LVVGS G G
Sbjct: 60  RDGAETVLNAACDRARRVWPQVSMEGVL---LPGDPRSALVKASEG--ATLLVVGSRGIG 114

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
            ++  ++GSV+   A HA   V+++  P
Sbjct: 115 GVRGLLVGSVAYGVAAHAPTNVILIHDP 142



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +1

Query: 322 EIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E++ G    VL E   +  A +LVVGS G+G +   ++GS+S    HHA C + +V+
Sbjct: 226 EVVHGHPVEVLKEAARR--ADLLVVGSRGHGQLAGMLIGSISQGLLHHAPCPMAVVR 280



>pir|AD1900|AD1900 hypothetical protein alr0750 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681741 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 180

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
 Frame = +1

Query: 268 IERAKEICASKSVDDPMFEIME--GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGS 441
           +   + +CA  +      E  +  G+    +C+      A ++V+G  G   +K   LGS
Sbjct: 81  VRMLQTLCAKANTQGVSTEFSQTLGNPGRTICKLATNWDADLIVMGHRGLSGVKEFFLGS 140

Query: 442 VSDYCAHHAHCTVMIV 489
           VS+Y  HH  C+V IV
Sbjct: 141 VSNYVLHHTPCSVHIV 156



>pir|H84047|H84047 hypothetical protein BH3184 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_657130 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 147

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 30/103 (29%), Positives = 58/103 (56%), Gaps = 2/103 (1%)
 Frame = +1

Query: 208 GAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIME-GDARNVLCETV-EKHHA 381
           GAA++      D KK+  R  E A+     K+  D +  I++ G  +  + +T+ +K+  
Sbjct: 56  GAAEL------DGKKLLQRYSEEAE-----KAGVDKVHTILDFGSPKANISKTIAQKYDI 104

Query: 382 SILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
            +++ G+ G  A++R ++GSVS+  A HA C V+IV+  + ++
Sbjct: 105 DLIITGATGLNAVERFLMGSVSESVARHAKCDVLIVRNDQDQS 147



>pir|A90454|A90454 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006871_223503 Sulfolobus
           solfataricus P2 section 230 of 272 of the complete
           genome.>gb:AE006641_1109351 Sulfolobus solfataricus P2,
           complete genome.
          Length = 139

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 2/93 (2%)
 Frame = +1

Query: 220 ILPHVDS--DLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           ILP +++   L++ A + ++RA E   SK V+     + EGD  N + +    +   ++V
Sbjct: 48  ILPPLEATKSLEERAKKDVKRAIEKAKSKGVNAEGITV-EGDPANSILQFATDNQIDVIV 106

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +GS G   ++R  LGSVS+     +   V++VK
Sbjct: 107 IGSRGLSKVQRIFLGSVSNKIVQESKVPVVVVK 139



>gb:BA000045_742059 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 177

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 11/157 (7%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPAN-AVSLAGPGAADILPHV 234
           ++ A D SE  F      LD       +  RL+L+H   +    + SL    A+ + P +
Sbjct: 7   ILAAFDSSETGFAVFREALD---LARATGARLLLMHVLSNDEEGSPSLPITFASQLYPSL 63

Query: 235 DSD--------LKKIAARVIERAKEICASKSVDDPMFEIME--GDARNVLCETVEKHHAS 384
           D +         K    R +E   E            E  +  G+    +C+        
Sbjct: 64  DDEPLKQYLEHWKAFERRGLELLNERQVQAEAQGVTVETHQASGNPGRKICDLARAQQVD 123

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           ++V+G  G   +   +LGSVS Y  HHA C+V +V +
Sbjct: 124 LIVLGRRGRSTLSEVLLGSVSHYVLHHAPCSVYVVHR 160



>gb:AP006627_565518 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 296

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 40/150 (26%), Positives = 67/150 (44%), Gaps = 4/150 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALG---WTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILP 228
           ++V VD S+ +  AL    W    +         L +VH +P     +   G  AA  L 
Sbjct: 153 ILVGVDGSDQAEDALSEAAWLAKQYEAA------LTIVHVEPI---GIYTGGAMAAAPLS 203

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGSH 405
           + D+   + A R++   K+      V     E + G+ R  L   + E   A +LV G+ 
Sbjct: 204 YEDNHRLE-AERMLTSYKQQAKESGVSTVKTEYVHGNPRAKLSTDLPESLQADLLVCGAT 262

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           G   + R ++GSV++    HA C V++VK+
Sbjct: 263 GTNTVTRLMIGSVAEAAMRHAPCDVLMVKR 292



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)
 Frame = +1

Query: 334 GDARNVLCETVEKHH-ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK-----K 495
           G+ R  + +T+ K H A +L+  + G   ++R   GSV++    HA C  ++VK      
Sbjct: 88  GNPRIQVAKTLTKEHGADLLITSATGRNRMERFFTGSVAEASIRHAPCDYLMVKDYETAS 147

Query: 496 PKHKT*LV 519
           P +KT LV
Sbjct: 148 PYYKTILV 155



>gb:AE017200_403499 Lactobacillus johnsonii NCC 533, section 1 of 7
           of the complete genome.>gb:AE017198_1121986
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 164

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 10/109 (9%)
 Frame = +1

Query: 211 AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLC-ETVEKHHASI 387
           + D +  +  D ++    + E AKE     +  D  + I  G  + ++  + ++ HH  +
Sbjct: 57  SGDTIYQMTQDSEEYLKSLKEWAKE---HFNFTDVSYHIRYGSPKRIIAVDFIKDHHNDL 113

Query: 388 LVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK---------KPKHK 507
           +++G+ G  A++R ++GSV+ Y   HA   V+IVK         KPK K
Sbjct: 114 IIMGATGMNAVERMLMGSVTAYVNQHALSDVLIVKTDLDNNKVAKPKKK 162



>gb:AE011122_269378 Methanosarcina acetivorans str. C2A, section 467
           of 534 of the complete genome.>gb:AE010299_909937
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 153

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/145 (20%), Positives = 71/145 (48%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V+A D SE++  A+ + ++       +   L +V    S  +++ ++  G  + +  + 
Sbjct: 9   IVIATDGSENTQRAISYGIEIAKLSGATVHALYVVDT--SSFSSIPMSSDGGWEAMFEI- 65

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             L+K     +   K+   +  V+D    + EG+  + + E  EK++  ++V+G+ G   
Sbjct: 66  --LRKEGQSAVSAVKQQGKAAGVEDIREIVWEGNPSSAILEFAEKNNVDLIVMGTLGKTG 123

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
           + R ++GSV++     +   VM+V+
Sbjct: 124 LDRFLMGSVAEKVVRSSDVPVMVVR 148



>gb:CP000033_89064 Lactobacillus acidophilus NCFM, complete genome.
          Length = 154

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +1

Query: 292 ASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHA 468
           A   V D  + I  G  + ++     EKH+  ++VVG+ G  A++R ++GSV++Y    +
Sbjct: 77  AKAGVTDSHYSIEFGSPKTIIARDFPEKHNIDLIVVGATGLNAVERLLIGSVTEYVTRTS 136

Query: 469 HCTVMIVK 492
            C V++ +
Sbjct: 137 KCDVLVCR 144



>pir|B81866|B81866 conserved hypothetical protein NMA1703 [imported]
           - Neisseria meningitidis (strain Z2491 serogroup
           A)>gb:NMA5Z2491_154587 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 5/7.
          Length = 154

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 39/152 (25%), Positives = 75/152 (49%), Gaps = 7/152 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VVAVD SE S  AL    +      V+  RL LVH   +PA  ++LA     + L H  
Sbjct: 5   LVVAVDGSETSINALKHAAE---LAGVNGARLTLVHVA-NPAEYMALA----PEFLQHES 56

Query: 238 SDLKKIAA--RVIERAKEICASKSVDDPMFEIMEGD--ARNV---LCETVEKHHASILVV 396
            +   +A    V++ A+       V++ +  ++  +  AR +   L +  +++ A +LV+
Sbjct: 57  YEAAAVAQGNEVLDAAERTARELGVENTVKHLLVANKGAREMAQDLVDYADENGADLLVL 116

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+HG   +   ++GS ++     +H  ++I++
Sbjct: 117 GTHGRTGLMHLLMGSFAETVMRQSHLPLLIIR 148



>pir|H81076|H81076 conserved hypothetical protein NMB1500 [imported]
           - Neisseria meningitidis (strain MC58 serogroup
           B)>gb:AE002499_46907 Neisseria meningitidis serogroup B
           strain MC58 section 141 of 206 of the complete
           genome.>gb:AE002098_897020 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 154

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 39/152 (25%), Positives = 75/152 (49%), Gaps = 7/152 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VVAVD SE S  AL    +      V+  RL LVH   +PA  ++LA     + L H  
Sbjct: 5   LVVAVDGSETSINALKHAAE---LAGVNGARLTLVHVA-NPAEYMALA----PEFLQHES 56

Query: 238 SDLKKIAA--RVIERAKEICASKSVDDPMFEIMEGD--ARNV---LCETVEKHHASILVV 396
            +   +A    V++ A+       V++ +  ++  +  AR +   L +  +++ A +LV+
Sbjct: 57  YEAAAVAQGNEVLDAAERTAQELGVENTVKHLLVANKGAREMAQDLVDYADENGADLLVL 116

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+HG   +   ++GS ++     +H  ++I++
Sbjct: 117 GTHGRTGLMHLLMGSFAETVMRQSHLPLLIIR 148



>gb:AP008231_579946 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 162

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = +1

Query: 337 DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           D    +C+ V+     ++VVG  G   I   ++GSVS Y  HH  C V+IV+
Sbjct: 108 DPSRGICDAVKDLGVDLVVVGRRGLSGISEILMGSVSSYVVHHVSCDVLIVQ 159



>gb:AE017000_375626 Bacillus cereus ATCC 14579 section 3 of 18 of
           the complete genome.>gb:AE016877_1015876 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 140

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 2/87 (2%)
 Frame = +1

Query: 238 SDLKKIAARVIERAKEI--CASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
           +DL+ I+A   ++ KEI     K        I+ GD  + + + V      +++ GS G 
Sbjct: 54  TDLETISASRKDKLKEIEGLLKKENISYTITILHGDPGDTIVQYVNTGDIDLVIAGSRGL 113

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++  VLGSVS   A    C VMIVK
Sbjct: 114 NTLQEMVLGSVSHKIAKRVKCPVMIVK 140



>gb:AE016956_366979 Enterococcus faecalis V583, section 10 of 11 of
           the complete genome.>gb:AE016830_993467 Enterococcus
           faecalis V583, complete genome.
          Length = 151

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = +1

Query: 328 MEGDARNVLC-ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           M G  + V+  E  EK++  +++VG  G  A++R V+GSVS Y    A C V+IV
Sbjct: 92  MFGSPKEVMSHELPEKYNVDLIMVGQSGLNAVERVVMGSVSSYIIRQAPCDVLIV 146



>gb:SAG766852_171249 Streptococcus agalactiae NEM316 complete
           genome, segment 10.>gb:AE014268_306974 Streptococcus
           agalactiae 2603V/R section 78 of 100 of the complete
           genome.>gb:AE009948_937087 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 150

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 1/91 (1%)
 Frame = +1

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGSH 405
           ++   L+K A  V+E  ++    K  D     I  G+ + +L   + EK    +++VG+ 
Sbjct: 56  YIYEKLEKEAKDVLEEYEKQAREKGADKVRQVIEFGNPKTLLAHDIPEKEKVDLIMVGAT 115

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           G    +R ++GS S+Y   HA   ++IV+ P
Sbjct: 116 GLNTFERFLIGSSSEYILRHAKVDLLIVRDP 146



>pir|AH2004|AH2004 hypothetical protein all1590 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682579 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 141

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 37/145 (25%), Positives = 64/145 (44%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VA+D SE +   +   LD     P  T  +VL H  P+  + + L        LPH +
Sbjct: 5   VLVALDGSEIAPRVVE-VLDELVLSPDGT--VVLCHVFPTADSEMELPAD-----LPHPE 56

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           S         IE+  +            E++ G+    +      +   ++++GS G   
Sbjct: 57  STTGSYFQ--IEKQLQYYQDNLSVKTELELVTGNPAEEIIRLSNIYQTDLIIIGSRGLTG 114

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
           +KR V GSVS+     A+C+V++VK
Sbjct: 115 MKRIVSGSVSNQVVEEANCSVLVVK 139



>gb:BX571966_793263 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_867503
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 155

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +1

Query: 337 DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH 504
           D  +++ E  +   A +LV+G+HG    KR VLGSV++ C  H+   V+++    H
Sbjct: 94  DVPSLIVEGAKAFGADLLVLGTHGRRGFKRLVLGSVAEQCVRHSALPVLLIPAAAH 149



>gb:AE017355_461888 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 140

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
 Frame = +1

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGY 411
           +DL+ ++A   ++ KEI      ++  ++I  + GD  + + + V      +++ GS G 
Sbjct: 54  TDLETVSASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDIDLVIAGSRGL 113

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++  VLGSVS   A    C VMI+K
Sbjct: 114 NTLQEMVLGSVSHKIAKRVKCPVMIIK 140



>gb:AE017266_421954 Bacillus cereus ATCC 10987, section 3 of 18 of
           the complete genome.>gb:AE017194_1060373 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 140

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 2/87 (2%)
 Frame = +1

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGY 411
           +DL+ I A   ++ KEI      ++  ++I  + GD  + + + V      +++ GS G 
Sbjct: 54  TDLETITASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDIDLVIAGSRGL 113

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++  VLGSVS   A    C VMI+K
Sbjct: 114 NTLQEMVLGSVSHKIAKRVKCPVMIIK 140



>gb:AE017026_380912 Bacillus anthracis str. Ames section 3 of 18 of
           the complete genome.>gb:AE017225_406026 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450761 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:CP000001_851191 Bacillus
           cereus ZK, complete genome.>gb:AE016879_1010617 Bacillus
           anthracis str. Ames complete genome.
          Length = 140

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 2/87 (2%)
 Frame = +1

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGY 411
           +DL+ ++A   ++ KEI      ++  ++I  + GD  + + + V      +++ GS G 
Sbjct: 54  TDLETVSASRKDKLKEIEGLLKKENISYKITILHGDPGDTIVQYVNTGDIDLVIAGSRGL 113

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++  VLGSVS   A    C VMI+K
Sbjct: 114 NTLQEMVLGSVSHKIAKRVKCPVMIIK 140



>gb:BX571966_794088 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_868059
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 164

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 36/153 (23%), Positives = 71/153 (46%), Gaps = 8/153 (5%)
 Frame = +1

Query: 55  VMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPH- 231
           +++VA+D S+ + +AL   L+       +  RLV V+    P  A    G   + ++   
Sbjct: 4   IILVALDGSQTASHALDAALE---LAADAHARLVPVYVVDMPVFAFDTPGYDPSILVDAF 60

Query: 232 -------VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL 390
                  +D    ++  R +  A  +   +   + + E +E  AR +         AS++
Sbjct: 61  REEGRRVLDDAQARMTRRGVAGAPRLVEVEPPGEDVAERLERAAREI--------GASLI 112

Query: 391 VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           V+G+HG   ++R +LGSV++    HA C V+++
Sbjct: 113 VMGTHGRRGVRRLMLGSVAERLLRHARCPVLMI 145



>gb:AP008226_577752 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 144

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 1/146 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFT-GPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHV 234
           +++  D S  S  AL   LD   T G    F  VL     +PA  + +A P +      +
Sbjct: 5   ILMPTDGSPCSLQALEHGLDLAKTLGAKVHFLYVL----ENPAQTIWIA-PESVPYGMEL 59

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG 414
             DL+K     I++A ++  +K V+    E+ EG     + E  +++   +LV+G+HG  
Sbjct: 60  LEDLRKAGEEAIKKALDLARAKGVE-ATGEVKEGVPIPTIVEAAKEY--DLLVMGTHGRT 116

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
            + R +LGSV++   H     V++V+
Sbjct: 117 GLDRLLLGSVTEGVLHRTSVPVLVVR 142



>gb:AE017282_428495 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 298

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 38/148 (25%), Positives = 69/148 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD SE S  AL       +  P + F +VL   +P   N +   G    +I+   D
Sbjct: 156 VLVAVDFSERSVAALRLAR---WVAPEAHF-VVLNAFQPPLENKLRQGGADEFEIMELRD 211

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           +  +   AR+ E      A    +     ++ G A + + E  ++    ++VVG HGYG 
Sbjct: 212 AARRDADARMDEVMAH--AGFPAERLTRLVLPGPALDCVLEQEQEQDCDLIVVGKHGYGW 269

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           I+  +LGS++ +    + C V++  + +
Sbjct: 270 IEEMLLGSLTKHLLALSSCDVLVASQSR 297



>gb:AE017180_398819 Geobacter sulfurreducens PCA, complete genome.
          Length = 151

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +1

Query: 295 SKSVDDPM-FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAH 471
           ++  D P+   ++ G+    L +  +K    ++V+GS G G +KR +LGSVS      A 
Sbjct: 84  AREADIPLEIRVVYGEPAEELVKFADKEQIDVIVLGSSGKGFLKRQLLGSVSHKVVKTAS 143

Query: 472 CTVMIVK 492
           C+V IVK
Sbjct: 144 CSVYIVK 150



>gb:AE013379_291784 Methanosarcina mazei strain Goe1, section 161 of
           379 of the complete genome.>gb:AE008384_965893
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 162

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 36/151 (23%), Positives = 74/151 (49%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++A D SE +  A  + +          + L ++    SP  +VSL    + ++L   +
Sbjct: 13  ILIATDGSETANEAADFGIGMVGCTGAKVYALYVIDT--SPYRSVSLDKIWSDEVLAEHE 70

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
            + ++  A +    K   A   V+    ++++G+  + +    E +   +++VGS G G 
Sbjct: 71  KEGRESTAYIERIGK--AAGVEVE---CKVLKGNPADKIITFAEDNDMDMIIVGSLGKGG 125

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
            +R VLGSVS+    H+   V++V++ KHK+
Sbjct: 126 YERFVLGSVSEKIVRHSKIPVLVVRE-KHKS 155



>gb:AE011032_268590 Methanosarcina acetivorans str. C2A, section 377
           of 534 of the complete genome.>gb:AE010299_909149
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 152

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 18/57 (31%), Positives = 36/57 (63%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           I+EG+  + + E  EK+   ++V+G+HG   ++R +LGSV+     H+   V++V++
Sbjct: 92  ILEGNPAHEIVEFAEKNDIDLIVMGTHGRTGVQRFLLGSVAQNVVRHSRKAVLVVRE 148



>gb:CR543861_103924 Acinetobacter sp. ADP1 complete genome.
          Length = 147

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 35/148 (23%), Positives = 68/148 (45%), Gaps = 2/148 (1%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDH--FFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPH 231
           ++V VDDS+ S  A    L+    F   V+   +V +         V +     A  + H
Sbjct: 6   ILVPVDDSDISSVATQHALNFAKVFGSRVTVMSVVAIDP------FVGVDFYKVAPAVTH 59

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
              + +  A   +E+ K++   + +D  +  I E      +    ++ +A ++++GSHG 
Sbjct: 60  HIMEAETHAQAHLEKLKQLFIDQGIDADIKIIREEPTPTGILNIADEVNADLIIMGSHGR 119

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
             +K+ VLGSV+   A  +   V+I+K+
Sbjct: 120 SGLKKFVLGSVAQKVASESSIPVLIIKR 147



>gb:AE004969_60677 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 154

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 39/152 (25%), Positives = 74/152 (48%), Gaps = 7/152 (4%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VVAVD SE S  AL    +      V+  RL LVH   +PA  ++LA     + L H  
Sbjct: 5   LVVAVDGSETSINALKHAAE---LAGVNGARLTLVHVA-NPAEYMALA----PEFLQHES 56

Query: 238 SDLKKIAA--RVIERAKEICASKSVDDPMFEIMEGD--ARNV---LCETVEKHHASILVV 396
            +   +A    V++ A+       V + +  ++  +  AR +   L +  +++ A +LV+
Sbjct: 57  YEAAAVAQGNEVLDAAERTARELGVGNTVKHLLVANKGAREMAQDLVDYADENGAGLLVL 116

Query: 397 GSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+HG   +   ++GS ++     +H  ++I++
Sbjct: 117 GTHGRTGLMHLLMGSFAETVMRQSHLPLLIIR 148



>pir|B89955|B89955 conserved hypothetical protein SA1532 [imported]
           - Staphylococcus aureus (strain N315)>gb:CP000046_91872
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000017_677397 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_679981
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.>gb:BA000033_711945 Staphylococcus
           aureus subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781223 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783859 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 166

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query: 247 KKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH-HASILVVGSHGYGAIK 423
           K  A  ++   KE+  +  V D    +  G  ++++ + +    +A +++ G+ G  A++
Sbjct: 61  KHFAEELLNGYKEVATNAGVKDVETRLEFGSPKSIIPKKLAHEINADLIMSGTSGLNAVE 120

Query: 424 RAVLGSVSDYCAHHAHCTVMIVK 492
           R ++GSVS+    HA C V++V+
Sbjct: 121 RFIVGSVSESIVRHAPCDVLVVR 143



>gb:BT006183_1639075 Arabidopsis thaliana clone RAFL15-32-F07
           (R50025) putative CHP-rich zinc finger protein
           (At3g21210) mRNA, complete cds.>gb:BT008519_1639736
           Arabidopsis thaliana clone U50025 putative CHP-rich zinc
           finger protein (At3g21210) mRNA, complete cds.
          Length = 804

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 34/145 (23%), Positives = 65/145 (44%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           +AV+ SE S + + W +D++         ++++H   SP   +  A  G   +       
Sbjct: 19  IAVELSEESAFTVRWAVDNYIRQGDD---IIILHV--SPTAGLFGADWGYYPLQTQPPYT 73

Query: 244 LKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIK 423
              I ++V +  K +         +  + + D R  LC   ++ + + L++G   +G   
Sbjct: 74  TASIFSKVADLGKPL-KEAGFPHTIHTVKDYDKRERLCLETQRLNLTALIMG---FGD-- 127

Query: 424 RAVLGSVSDYCAHHAHCTVMIVKKP 498
               GSVSD+C HH  C V++V+ P
Sbjct: 128 ----GSVSDFCVHHCVCQVVVVRYP 148



>gb:AB023045_1515511 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXL8.
          Length = 777

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 34/145 (23%), Positives = 65/145 (44%)
 Frame = +1

Query: 64  VAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSD 243
           +AV+ SE S + + W +D++         ++++H   SP   +  A  G   +       
Sbjct: 19  IAVELSEESAFTVRWAVDNYIRQGDD---IIILHV--SPTAGLFGADWGYYPLQTQPPYT 73

Query: 244 LKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIK 423
              I ++V +  K +         +  + + D R  LC   ++ + + L++G   +G   
Sbjct: 74  TASIFSKVADLGKPL-KEAGFPHTIHTVKDYDKRERLCLETQRLNLTALIMG---FGD-- 127

Query: 424 RAVLGSVSDYCAHHAHCTVMIVKKP 498
               GSVSD+C HH  C V++V+ P
Sbjct: 128 ----GSVSDFCVHHCVCQVVVVRYP 148



>gb:BX957220_843838 Methanococcus maripaludis S2 complete genome;
           segment 2/5.
          Length = 145

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 24/83 (28%), Positives = 43/83 (51%)
 Frame = +1

Query: 244 LKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIK 423
           L+K     +    +I   K V+    EI+EG     + E  E  +A ++V+G+ G   + 
Sbjct: 61  LEKEGHTALRTLTDIAREKGVEIKT-EILEGTPSKEIVEYAEAKNADLIVMGTTGKTGLD 119

Query: 424 RAVLGSVSDYCAHHAHCTVMIVK 492
           + +LGSV++     +HC V++VK
Sbjct: 120 KLLLGSVAERVLKKSHCPVLLVK 142



>gb:BA000045_740765 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 184

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = +1

Query: 352 LCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           +C+      A ++V G  G   I   +LGS+S+Y  HHA C+V++V
Sbjct: 112 ICQLARAWSADLIVTGRRGRRGISEMLLGSISNYVLHHAPCSVLVV 157



>gb:AE017316_440345 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 8 of 12 of the complete
           genome.>gb:AE017285_1073506 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 138

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 23/87 (26%), Positives = 43/87 (49%)
 Frame = +1

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
           ++     +A  ++++A      K V      +    A   + +  +     ++VVGS G 
Sbjct: 52  IEDKFTTMAHEIVDKAVAYAKGKGVVAHGELLKSHSAAGAVIDFAKDKGVDLIVVGSRGR 111

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           GAI+R +LGSV+     HA C+V++V+
Sbjct: 112 GAIERFLLGSVATKIVTHATCSVLVVR 138



>gb:AE013379_291786 Methanosarcina mazei strain Goe1, section 161 of
           379 of the complete genome.>gb:AE008384_965895
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 164

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 36/150 (24%), Positives = 70/150 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++A D SE +  A  + ++         F L ++    +P  +VSL    + + L   +
Sbjct: 15  ILIATDGSETANEAADFGIEMVGCSGAKVFALYVIDV--TPYRSVSLDKIWSKETLDEFE 72

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
               +  A + +  K   A   V+     +++G     +    E ++  +++VGS G G 
Sbjct: 73  KAGYEATAYIEKIGK--AAGVEVET---RVLKGHPAEKIISFAEDNNIDMIIVGSLGKGG 127

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
            +R VLGSVS+    H+   V++V++ KHK
Sbjct: 128 YERVVLGSVSEKIVRHSKVPVLVVRE-KHK 156



>gb:SCO939130_180913 Streptomyces coelicolor A3(2) complete genome;
           segment 27/29.
          Length = 300

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 42/152 (27%), Positives = 60/152 (39%), Gaps = 5/152 (3%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLD--HFFTGPVSTFRLVLVHAKPSPANA---VSLAGPGAADI 222
           ++ AVD S+    AL W LD  H    P     L +VH +   A A   V +AGP     
Sbjct: 6   VIAAVDGSDDGLRALDWALDAAHRRGAP-----LRVVHVRQYAAWAQTDVLVAGPPDTAE 60

Query: 223 LPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGS 402
            P +D     +  R      E    + V   +   +  DA+             +LV+GS
Sbjct: 61  DPALDQARAHLQGRAFAVPTEYVGMEGVPGALLPELGADAQ-------------LLVLGS 107

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
            G G     +LGS     A  A C V++V +P
Sbjct: 108 RGRGGFAGLLLGSNGMAAARDAQCPVVVVPRP 139



>pir|C69829|C69829 conserved hypothetical protein yheK - Bacillus
           subtilis>gb:BSY14080_756263 Bacillus subtilis
           chromosomal DNA, region 75 degrees: sspB upstream of
           glyB.
          Length = 184

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 18/163 (11%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAK-----------PSPANAVSLAG 204
           ++VA D SE+S  AL   +D   T   +   + + H+            P PA   S   
Sbjct: 25  IIVAFDGSENSKKALLTAIDLAKTVNAA---ITVAHSHDMKDNQTVIDPPRPAAEASYIS 81

Query: 205 PGAADILPHVDSDLKKIAARVIE-RAKEICA------SKSVDDPMFEIMEGDARNVLCET 363
            G   +   + SD+      + E R +E+ A      ++   D   +I+EGD    + E 
Sbjct: 82  GGMTSVPDPLISDVTSPEPMIYEDRTEEVIAEARMMLNEQQADGDIDILEGDPAESIIEH 141

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             +  A ++V GS     +K+ + GSVS+  +  +   V+IVK
Sbjct: 142 ANRISADMIVTGSRDQNRLKKLIFGSVSEKLSAKSDIPVLIVK 184



>sp|O07552|NHAX_BACSU Stress response protein
           nhaX.>gb:BSUB0006_752934 Bacillus subtilis complete
           genome (section 6 of 21): from 1011039 to 1209781.
          Length = 166

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 41/163 (25%), Positives = 70/163 (42%), Gaps = 18/163 (11%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAK-----------PSPANAVSLAG 204
           ++VA D SE+S  AL   +D   T   +   + + H+            P PA   S   
Sbjct: 7   IIVAFDGSENSKKALLTAIDLAKTVNAA---ITVAHSHDMKDNQTVIDPPRPAAEASYIS 63

Query: 205 PGAADILPHVDSDLKKIAARVIE-RAKEICA------SKSVDDPMFEIMEGDARNVLCET 363
            G   +   + SD+      + E R +E+ A      ++   D   +I+EGD    + E 
Sbjct: 64  GGMTSVPDPLISDVTSPEPMIYEDRTEEVIAEARMMLNEQQADGDIDILEGDPAESIIEH 123

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             +  A ++V GS     +K+ + GSVS+  +  +   V+IVK
Sbjct: 124 ANRISADMIVTGSRDQNRLKKLIFGSVSEKLSAKSDIPVLIVK 166



>gb:AY774040_2148753 Synthetic construct Francisella tularensis
           clone FLH154772.01X NT02FT1591 gene, complete cds.
          Length = 278

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 27/93 (29%), Positives = 44/93 (47%)
 Frame = +1

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           A ++P+    L       +E   +  A K+       +M G   N L E   ++   ++V
Sbjct: 184 AFVIPNDSISLMTYETDKVETTLDKFAEKNGITGEKSVMIGGISNSLLEKAAENKNDLIV 243

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           VGSH  GAI R  LGS ++   H A+  V++V+
Sbjct: 244 VGSHRRGAIGRFFLGSTANSILHQANVDVLVVR 276



 Score = 36.2 bits (82), Expect = 0.47
 Identities = 23/103 (22%), Positives = 47/103 (45%)
 Frame = +1

Query: 184 NAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
           + V+   P   D    ++ + K+   +++ +   I           E++ G+    + E 
Sbjct: 42  DCVAPFAPSIVDFQHSIEQEAKEALDKLVTKISGIKVEH-------EVLVGNPAAEIVEY 94

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            E+ +  ++V+GSH    I   +LGSV++   H A C V+ V+
Sbjct: 95  AEESNCDVIVLGSHATHGIN-LLLGSVANTVLHKAKCDVLTVR 136



>gb:AL935260_552326 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 9/11.
          Length = 156

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 1/107 (0%)
 Frame = +1

Query: 193 SLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET-VE 369
           +LAG    DI   +  D +      +++ K+        D  F I  G  + ++ +  V+
Sbjct: 50  NLAGLADGDITYQLVQDSEAYLKETVDQVKK----DGFTDIAFHIRMGSPKPIISQDFVK 105

Query: 370 KHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
            HH  ++++G+ G  A++R + GSV+ Y   +A   V++VK     T
Sbjct: 106 DHHNDLIMMGATGLNAVERVLEGSVTTYVQRNALTDVIVVKTDLQNT 152



>gb:AJ749949_530702 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 278

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 27/93 (29%), Positives = 44/93 (47%)
 Frame = +1

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           A ++P+    L       +E   +  A K+       +M G   N L E   ++   ++V
Sbjct: 184 AFVIPNDSISLMTYETDKVETTLDKFAEKNGITGEKSVMIGGISNSLLEKAAENKNDLIV 243

Query: 394 VGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           VGSH  GAI R  LGS ++   H A+  V++V+
Sbjct: 244 VGSHRRGAIGRFFLGSTANSILHQANVDVLVVR 276



 Score = 36.2 bits (82), Expect = 0.47
 Identities = 23/103 (22%), Positives = 47/103 (45%)
 Frame = +1

Query: 184 NAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
           + V+   P   D    ++ + K+   +++ +   I           E++ G+    + E 
Sbjct: 42  DCVAPFAPSIVDFQHSIEQEAKEALDKLVTKISGIKVEH-------EVLVGNPAAEIVEY 94

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            E+ +  ++V+GSH    I   +LGSV++   H A C V+ V+
Sbjct: 95  AEESNCDVIVLGSHATHGIN-LLLGSVANTVLHKAKCDVLTVR 136



>gb:AE017312_439146 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072307 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 160

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 41/147 (27%), Positives = 67/147 (45%), Gaps = 2/147 (1%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V VD SEH+  A  +  +  F   V    ++LVH++ S      L G  A D    V 
Sbjct: 26  ILVPVDGSEHARRATVYAAE--FAAMVQA-SVLLVHSRMS---IPPLLGQAAYD---EVR 76

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFE--IMEGDARNVLCETVEKHHASILVVGSHGY 411
           + L   A  ++E  +EI     +    FE  I+EG A   + + V       +++GS G 
Sbjct: 77  NSLNARAESLLEPYREILRGAGIS---FEDRILEGPAETAIVDAVRAEKCDHIILGSRGV 133

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++  +LGSV+      A C V +V+
Sbjct: 134 SELEGLLLGSVTRRVLQLAPCPVTVVR 160



>gb:AE009873_256778 Pyrobaculum aerophilum strain IM2 section 128 of
           201 of the complete genome.>gb:AE009441_899404
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 137

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 26/89 (29%), Positives = 48/89 (53%)
 Frame = +1

Query: 226 PHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSH 405
           P V + LK+ A ++I+ A       +      +I+EGD  + + +   + +AS++V+G+ 
Sbjct: 52  PAVIASLKEKAEQLIKEALAFLGQGAEG----KILEGDPAHEIVKFAREVNASLIVLGAR 107

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G   I+R ++GSVS      +   V+IVK
Sbjct: 108 GLSTIRRILMGSVSSRVVQESPIDVLIVK 136



>gb:CP000031_85193 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 145

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 32/120 (26%), Positives = 50/120 (41%)
 Frame = +1

Query: 130 GPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVD 309
           G   T   V  H  P  A+   +     AD+    D  ++  A  V E  K   A+  V 
Sbjct: 30  GAELTLLTVYRHHSPLEASMHVVRPDEPADL----DDIMRTHAREVAEHGKARAAAYGVP 85

Query: 310 DPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
            P   +  G     +    ++H   + V+GS G G+ +RA+LGSVS      +   V++V
Sbjct: 86  APRAFVKGGPVARTIAGFAKEHGHDLTVIGSRGLGSFERALLGSVSHKVTSLSETPVLVV 145



>gb:AY596297_634540 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 146

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 25/94 (26%), Positives = 43/94 (45%)
 Frame = +1

Query: 211 AADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASIL 390
           A D+L  ++S++ +     +ER  E+               G    V+ E  + H  S +
Sbjct: 68  AEDLLDDLESEVTEAGVESVERVIEV---------------GRPTKVIVEYADDHDISQI 112

Query: 391 VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           V+GSHG   + R +LGSV++     A   V +V+
Sbjct: 113 VMGSHGRSGMSRILLGSVAEIVVRRASIPVTVVR 146



>gb:AE016863_351556 Pseudomonas syringae pv. tomato str. DC3000
           section 8 of 21 of the complete
           genome.>gb:AE016853_1036731 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 143

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 37/145 (25%), Positives = 68/145 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V  D SEH+  ALG+ ++   +G ++  + + VH     A+ +  +   A D++  V 
Sbjct: 4   VLVPFDGSEHAMRALGYVIE--LSGDLN--KPLEVHVLNVQASPIDYSLYLAPDMIDGVK 59

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           + LK    RV++ A  + A+  V       +   A  V  E V++     +V+G+ G G 
Sbjct: 60  AGLKNEGKRVLDDAIALLAAAGVPFQAHVDLGNVAEQVEAE-VQRLGCDAVVMGTRGLGN 118

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
               +LGSV+    H     V ++K
Sbjct: 119 FGGLLLGSVATRVIHEVSVPVTLIK 143



>pir|D84603|D84603 hypothetical protein At2g21620 [imported] -
           Arabidopsis thaliana
          Length = 184

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 34/123 (27%), Positives = 57/123 (46%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++VAVD   +S +A  W L HF         L LVHA  S  +   +      D++    
Sbjct: 42  VIVAVDHGPNSKHAFDWALVHFCR---LADTLHLVHAVSSSFSLQCVKN----DVVYETS 94

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             L +   ++   A ++   KSV      ++EGDA  V+C+  EK   + ++VG+ G   
Sbjct: 95  QALME---KLAVEAYQVAMVKSVA----RVVEGDAGKVICKEAEKVKPAAVIVGTRGRSL 147

Query: 418 IKR 426
           ++R
Sbjct: 148 VRR 150



>gb:BA000039_725939 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 194

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = +1

Query: 310 DPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           D   EI+ GD    +      + A ++V+GS G   ++R V GSVS      A C+V++V
Sbjct: 130 DSEIEIVNGDPVEEIVRLANIYRADLIVLGSRGLTGVERVVQGSVSSAVLADAPCSVLVV 189

Query: 490 K 492
           K
Sbjct: 190 K 190



>gb:AY596297_634681 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 159

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 33/126 (26%), Positives = 52/126 (41%), Gaps = 8/126 (6%)
 Frame = +1

Query: 136 VSTFRLVLVHAKPSPANAVSLAGPGAADILPH------VDSDLKKIAARVIERAKEICAS 297
           + T    L  A  S  +A+ +   G    LPH      V   L +     ++  + + A 
Sbjct: 18  ILTHAEALATAHDSEIHALYVVDIGRFSTLPHEPTWEGVTDSLHREGEMALDMVERLVA- 76

Query: 298 KSVDDPMFE--IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAH 471
              DD        EG     + E   +H   ++V+G+HG G I R +LGSV++     AH
Sbjct: 77  ---DDVTVTRATAEGSPSREIVEYASQHGCDLIVMGTHGRGGIDRLLLGSVAERVVRSAH 133

Query: 472 CTVMIV 489
             V+ V
Sbjct: 134 VPVVTV 139



>gb:AE012789_285596 Chlorobium tepidum TLS section 10 of 194 of the
           complete genome.>gb:AE006470_932764 Chlorobium tepidum
           TLS complete genome.
          Length = 156

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 18/61 (29%), Positives = 34/61 (55%)
 Frame = +1

Query: 319 FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           F +  G     + E   K  A+++V+GSHG   + R ++GS ++    HA C V++++ P
Sbjct: 79  FAVEYGSPGATIIEYASKTGAAMIVLGSHGASNLGRLLVGSTAESVMRHAPCPVLVLRSP 138

Query: 499 K 501
           +
Sbjct: 139 E 139



>pir|AI2537|AI2537 hypothetical protein all7588 [imported] - Nostoc
           sp. (strain PCC 7120) plasmid
           pCC7120beta>gb:AP003602_554979 Nostoc sp. PCC 7120
           plasmid pCC7120beta DNA, complete genome.
          Length = 157

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGY-GAIKRAVLGSVSDYCAHHAHCTVMIV 489
           G     +CE      A ++V+G   +   I+  VLG VS+Y  HHA C+V+IV
Sbjct: 104 GQPGETICEFARNWQADLIVIGRRRWLSTIEEFVLGRVSNYLLHHAFCSVLIV 156



>pir|H98097|H98097 conserved hypothetical protein spr1810 [imported]
           - Streptococcus pneumoniae (strain
           R6)>gb:AE008545_238129 Streptococcus pneumoniae R6
           section 161 of 184 of the complete
           genome.>gb:AE007317_944287 Streptococcus pneumoniae R6,
           complete genome.
          Length = 171

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 36/151 (23%), Positives = 69/151 (45%), Gaps = 5/151 (3%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFR----LVLVHAKPSPANAVSLAGPGAADIL 225
           ++VA+D S+ +  A       F  G  S  R    L +VH   +   A+       A++ 
Sbjct: 29  IMVAIDGSKEADLA-------FVKGVHSALRNDAKLTIVHVIDT--RALQSVSTFDAEVY 79

Query: 226 PHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGS 402
             +  D + +     +RAK+      V D    I  G+ + +L  T+ +     +++VG+
Sbjct: 80  EELQVDAESLMKEYEKRAKDA----GVADVHIVIEMGNPKTLLARTIPDAEEVDLILVGA 135

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
            G  A +R ++GS S+Y   HA   +++V++
Sbjct: 136 TGLNAFERLLVGSSSEYILRHAKVDLLVVRE 166



>gb:BX248357_762434 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 146

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 27/71 (38%), Positives = 37/71 (52%)
 Frame = +1

Query: 277 AKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYC 456
           AKEI A+K        I+ G     L   V +H+A +LVVG+ G  ++   +LGSV    
Sbjct: 76  AKEIGATKIET----AILPGTPVEALMAIVREHNADLLVVGNRGINSLTGRLLGSVPADV 131

Query: 457 AHHAHCTVMIV 489
           A  + C VMIV
Sbjct: 132 ARQSDCDVMIV 142



>gb:AP006618_559293 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 293

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = +1

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           A +LVVGS G G   R ++GSV +     AHC VM+V  P
Sbjct: 254 AQLLVVGSRGRGGFGRLLVGSVGNALVQQAHCPVMVVHTP 293



>gb:AE013233_290453 Methanosarcina mazei strain Goe1, section 15 of
           379 of the complete genome.>gb:AE008384_964562
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 153

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           I+EG   N + +  EK++  ++V+G+ G   I+R +LGSV+     H+   V++VK+
Sbjct: 93  ILEGGPANEIVDFAEKNNIDLIVLGTLGKTGIERFLLGSVAQNVVRHSRKAVLVVKE 149



>pir|D86904|D86904 conserved hypothetical protein yxbE [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006452_219138 Lactococcus lactis subsp.
           lactis IL1403 section 214 of 218 of the complete
           genome.>gb:AE005176_1096211 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 145

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 16/43 (37%), Positives = 29/43 (67%)
 Frame = +1

Query: 367 EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           ++ +  ++V+G+ G   I+R V+GSV+ Y  +HA C  +IV+K
Sbjct: 103 KQENVDLIVIGATGISYIERVVVGSVASYIVNHATCNTLIVRK 145



>gb:AC121363_1740150 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0036C12, complete sequence.
          Length = 110

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 10/90 (11%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVST------FRLVLVHAKPS-PANAVSLAGPG-- 210
           +VVAVD+SE S +AL W L +  +    +        +VLVHA+P+ P     + G G  
Sbjct: 16  VVVAVDESEESMHALSWCLSNVVSAAAKSPAAAPPPAVVLVHARPARPLYYPVIDGGGYV 75

Query: 211 -AADILPHVDSDLKKIAARVIERAKEICAS 297
              +++  +D  +   A  V+ +A++IC +
Sbjct: 76  LTQEVMDSMDRYMATAADSVVAKARDICTA 105



>gb:BX321856_772419 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 1/10.
          Length = 694

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           ++  D    +    E+    +LVVG+ G    K  +LG++ +  +H+AHCTV+IV
Sbjct: 89  VINADPALAIVHAAEQEAIDVLVVGNLGMAGRKEFLLGNIPNRISHNAHCTVIIV 143



>gb:BA000011_665087 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 150

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 3/72 (4%)
 Frame = +1

Query: 241 DLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVL---CETVEKHHASILVVGSHGY 411
           D +K    +IERAK++ +++SVD   FEI++   + V     E  E+    I++ GS   
Sbjct: 58  DQRKKGEEIIERAKKLVSNESVDLE-FEIVDSGTKTVAHKAVEVAEEKGVDIIITGSRNL 116

Query: 412 GAIKRAVLGSVS 447
             + + +LGSVS
Sbjct: 117 KGLSKIILGSVS 128



>gb:CR382130_1663384 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 402

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 5/95 (5%)
 Frame = +1

Query: 223 LPHVDSDLKKIAARVIERAKE---ICASKSVDDPMFEIMEGDARNVLCETVEKHHASILV 393
           L  VD+D ++ A + +    E   I   K +   + E   G  + VL  T+E +  SILV
Sbjct: 230 LQAVDTDAREEAEQTLNSLVEQILIQYGKKISI-VLEYAIGKFQQVLDRTIEIYEPSILV 288

Query: 394 VGSHGYGAI--KRAVLGSVSDYCAHHAHCTVMIVK 492
           VG+ G   +  +  + GSVS YC  H+   V++VK
Sbjct: 289 VGTKGRKKVGFQGLIPGSVSQYCLQHSPIPVIVVK 323



>gb:CR382130_1662945 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 653

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 19/58 (32%), Positives = 35/58 (60%)
 Frame = +1

Query: 337 DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHKT 510
           +A+ +LCE ++    +++VVGS G  A+K  +LGS S+Y    +   VM+ ++   K+
Sbjct: 568 NAKLMLCEMIDHVSPTLVVVGSRGRSALKGVLLGSFSNYIVGKSSVPVMVARRRLKKS 625



>gb:BX294153_771175 Pirellula sp. strain 1 complete genome; segment
           21/24.
          Length = 303

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +1

Query: 319 FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMI 486
           F + +G     L E  E+  A  +V+GS G+ A  R +LGS SDY A+ +  T ++
Sbjct: 93  FSVSQGHPGRGLIEMSERFDADWIVIGSVGHSAFSRILLGSTSDYVANRSTRTCLV 148



 Score = 35.4 bits (80), Expect = 0.80
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E   +H   ++VVG      ++R +LGSVS +   HA+ +V+IV+
Sbjct: 259 EYANEHACDLIVVGDQDDSLMERVMLGSVSRFVVRHANQSVLIVR 303



>gb:AE013379_291782 Methanosarcina mazei strain Goe1, section 161 of
           379 of the complete genome.>gb:AE008384_965891
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 323

 Score = 40.4 bits (93), Expect = 0.025
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           +++G+    + +  E+    ++VVGS G   IKR +LGSVS+     A   V++V++ K
Sbjct: 94  VLKGNPAEEIVDFAEEQRVDMIVVGSLGKSGIKRFMLGSVSEKVVRRAKIPVLVVREQK 152



 Score = 32.3 bits (72), Expect = 6.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           ++EG+    + +  E+    ++VVGS G    ++  +GSVS     +A   V+IV
Sbjct: 240 VLEGNPAEEIVDFAEEQKVDMIVVGSLGKSGYEQFAIGSVSSKVLRNAKVPVLIV 294



>gb:AF206717_2141944 Shuttle vector pI3 hypothetical proteins, HtrU
           (htrU), ArdU (ardU), RepU (repU), and ResU (resU) genes,
           complete cds.
          Length = 139

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 37/144 (25%), Positives = 63/144 (43%)
 Frame = +1

Query: 61  VVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVDS 240
           VVA D SE S  AL   +        +   +V V  +P  +  V  AG     + P    
Sbjct: 4   VVAFDGSEPSQRALKQAIT-LGKAAGAELEVVTVIEEPPVSGFVQWAG-----LNPDYVR 57

Query: 241 DLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAI 420
           ++ +  AR  ++  +    ++      + + G    VL E    H   +LVVG+HGY  +
Sbjct: 58  EMLEQNARQAQQTAQTLIGEAGVQGRVQTLRGRPIEVLTEAA--HGVDLLVVGTHGYRGM 115

Query: 421 KRAVLGSVSDYCAHHAHCTVMIVK 492
            R +LGSV++     A   +++V+
Sbjct: 116 DRILLGSVTETLLRRAEVPLLVVR 139



>gb:BX640450_817185 Bordetella bronchiseptica strain RB50, complete
           genome; segment 14/16.
          Length = 288

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 43/170 (25%), Positives = 68/170 (40%), Gaps = 14/170 (8%)
 Frame = +1

Query: 28  RMAAAAEKPVMVV-------------AVDDSEHSFYALGWTLDHFFTGPVSTFRLVLV-H 165
           R+A  A +PV+VV             A D SE S  AL   L      P++ F    V  
Sbjct: 126 RLARQASQPVLVVKARPRKPYRDVVVATDFSEGSRQALVAALRVAGDAPLTLFHAYDVPF 185

Query: 166 AKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDAR 345
            K +P +AV          +    +D  + A   ++   E+    +   P   +  G   
Sbjct: 186 GKDAPEDAV----------VRSFYNDAAQKARAFLDGTPELAGRPA---PELVLESGQPE 232

Query: 346 NVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
            +L E V      ++V G+HG   I R  +GSV++       C V+IV++
Sbjct: 233 TLLSEYVFNRRCDLVVTGTHGLTGILRTAIGSVAEKLLEALPCDVLIVRQ 282



>gb:BA000045_741907 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 294

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 21/77 (27%), Positives = 42/77 (54%)
 Frame = +1

Query: 262 RVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGS 441
           +++E+A    A  S  +    +  GD ++V+C   E+  AS+L++GS G  ++   +  S
Sbjct: 66  QLLEKAVAELALGSEYEMRTILRTGDPKDVVCLVAEEVDASLLLMGSRGLNSLVAILKNS 125

Query: 442 VSDYCAHHAHCTVMIVK 492
           VS Y    A C +++++
Sbjct: 126 VSQYVFQRASCPMLLLR 142



>gb:AF377337_505671 Myxococcus xanthus serine/threonine kinase Pkn14
           (pkn14) and pseudouridine synthase TruA (truA) genes,
           complete cds; and unknown genes.
          Length = 140

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 1/66 (1%)
 Frame = +1

Query: 301 SVDDPMFEIME-GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCT 477
           +VD P   +ME G +R+++ E V+   A +L +G+     +  A+LGSV+      A C 
Sbjct: 70  AVDIPYHLVMESGGSRSIVLEFVDDQGADLLALGTRARSGVAFALLGSVATDLIREAKCD 129

Query: 478 VMIVKK 495
           V++V++
Sbjct: 130 VLVVRE 135



>gb:AE017333_450128 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859904 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 139

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 19/56 (33%), Positives = 27/56 (48%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +  GD    +      H   I+++GS G   ++  VLGSVS   A    C V+IVK
Sbjct: 84  MQHGDPGPAIVSYANHHDVDIVIIGSRGLNTLQEMVLGSVSHKVAKRVKCPVLIVK 139



>gb:AE017327_444028 Listeria monocytogenes str. 4b F2365, section 6
           of 10 of the complete genome.>gb:AE017262_1076384
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 154

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E  +   A +++ G+ G  A++R ++GSVS+Y   H+ C V++V+
Sbjct: 100 EAAKAFQADLIMCGATGLNAVERLLIGSVSEYIIRHSPCDVLVVR 144



>gb:AE017233_412447 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 7 of 16 of the complete
           genome.>gb:AE016958_1055851 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 293

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 43/159 (27%), Positives = 61/159 (38%), Gaps = 6/159 (3%)
 Frame = +1

Query: 34  AAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGA 213
           A AA+ PV+V   D S  S  A+    D                A       V+L     
Sbjct: 153 ARAADAPVLV-GTDGSPASEAAIALAFDE---------------ASRRGVGVVALHAWSD 196

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET------VEKH 375
             + P +  D +   A+  E   E  A      P   +     R V+C+T       E  
Sbjct: 197 VGVFPILGMDWRDSEAKGEELLAERLAGWQEQYPDVHVK----RLVVCDTPSRWLVAEAE 252

Query: 376 HASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            A ++VVGSHG G     +LGSVS + A  A   V++V+
Sbjct: 253 RAQLVVVGSHGRGGFPGMLLGSVSSHVAQSATAPVIVVR 291



 Score = 39.7 bits (91), Expect = 0.043
 Identities = 19/42 (45%), Positives = 25/42 (59%)
 Frame = +1

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKH 504
           A ++V GS G GA+ R +LGSV+     HAHC V +V    H
Sbjct: 110 AWMIVAGSQGLGALGRLLLGSVTAALLAHAHCPVAVVHADDH 151



>gb:AE015010_314125 Streptococcus mutans UA159 section 158 of 185 of
           the complete genome.>gb:AE014133_941126 Streptococcus
           mutans UA159 complete genome.
          Length = 149

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 15/48 (31%), Positives = 30/48 (62%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           E  E+ H  ++++G+ G  A +R ++GS S+Y   HA   +++V+ P+
Sbjct: 99  EIPEREHVDLIMLGATGLNAFERLLIGSSSEYILRHAKVDLLVVRDPE 146



>pir|AF1634|AF1634 hypothetical protein homolog lin1615 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596169_538960
           Listeria innocua Clip11262 complete genome, segment
           7/12.
          Length = 152

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E  +   A +++ G+ G  A++R ++GSVS+Y   H+ C V++V+
Sbjct: 100 EAAKAFQADLIMCGATGLNAVERLLIGSVSEYIIRHSPCDVLVVR 144



>pir|AD1272|AD1272 hypothetical protein lmo1580 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591979_536071
           Listeria monocytogenes strain EGD, complete genome,
           segment 7/12.
          Length = 154

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E  +   A +++ G+ G  A++R ++GSVS+Y   H+ C V++V+
Sbjct: 100 EAAKAFQADLIMCGATGLNAVERLLIGSVSEYIIRHSPCDVLVVR 144



>pir|F95233|F95233 universal stress protein family [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007488_227124 Streptococcus pneumoniae TIGR4
           section 171 of 194 of the complete
           genome.>gb:AE005672_1104892 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 150

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 23/95 (24%), Positives = 48/95 (50%), Gaps = 1/95 (1%)
 Frame = +1

Query: 214 ADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASIL 390
           A++   +  D + +     +RAK+      V D    I  G+ + +L  T+ +     ++
Sbjct: 55  AEVYEELQVDAESLMKEYEKRAKDA----GVADVHIVIEMGNPKTLLARTIPDAEEVDLI 110

Query: 391 VVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
           +VG+ G  A +R ++GS S+Y   HA   +++V++
Sbjct: 111 LVGATGLNAFERLLVGSSSEYILRHAKVDLLVVRE 145



>gb:BX294140_767628 Pirellula sp. strain 1 complete genome; segment
           8/24.
          Length = 309

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 18/56 (32%), Positives = 31/56 (55%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           I  G     + +   +    ++VVG+ G+ A+ R +LGS SDY A H   +V++V+
Sbjct: 96  IRNGHPGETIVKLANELQPDLVVVGAKGHSAVARILLGSTSDYVATHVLSSVLVVR 151



 Score = 39.3 bits (90), Expect = 0.056
 Identities = 37/163 (22%), Positives = 65/163 (39%), Gaps = 1/163 (0%)
 Frame = +1

Query: 7   TGHVKWLRMAAAAE-KPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPA 183
           +G  + LR+A   E  P   +A ++    F  LGW++D+                     
Sbjct: 156 SGRRRHLRVAIGCEPSPPAEMAFEE----FTQLGWSIDN-------------------DV 192

Query: 184 NAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCET 363
             VS+    + D     DS + + A   +ER K+     S       I      + L + 
Sbjct: 193 QVVSVTDRSSVD-----DSSVDEAAKEYLERIKDRLVEDSRSARARVIHSDHIGDGLVDY 247

Query: 364 VEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +E +   ++VVG    G  +R +LGS + +   HA  +V+I +
Sbjct: 248 IESNQVDLIVVGETSRGGFERLLLGSTTRFVLRHAPSSVLIAR 290



>gb:CP000027_80273 Dehalococcoides ethenogenes 195, complete genome.
          Length = 108

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 15/56 (26%), Positives = 32/56 (57%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           + EG A  V+ +T E+    ++ + +HG     R +LGSV++    H++  +M+++
Sbjct: 50  LREGGAAEVILKTAEEEKVDVIAMSTHGRSGAARWLLGSVAERVVRHSNIPIMLIR 105



>pir|F70572|F70572 hypothetical protein Rv2623 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_22785
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248343_760013 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           10/14.>gb:BX842580_820713 Mycobacterium tuberculosis
           H37Rv complete genome; segment 9/13.>gb:AX023862_1456784
           Sequence 33 from Patent WO0021983.>gb:AX463837_1469078
           Sequence 3 from Patent WO0248391.
          Length = 297

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 43/147 (29%), Positives = 64/147 (43%), Gaps = 3/147 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V +DDS  +  A+ W         +    L LVHA  SP  A  L  P    +L    
Sbjct: 10  IIVGIDDSPAAQVAVRWAARD---AELRKIPLTLVHAV-SPEVATWLEVPLPPGVLRWQQ 65

Query: 238 SDLKKI---AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHG 408
              + +   A +V+E+A       +V     EI+   A   L +  +   A ++VVG  G
Sbjct: 66  DHGRHLIDDALKVVEQASLRAGPPTVHS---EIVPAAAVPTLVDMSKD--AVLMVVGCLG 120

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIV 489
            G     +LGSVS     HAHC V+I+
Sbjct: 121 SGRWPGRLLGSVSSGLLRHAHCPVVII 147



>pir|A75310|A75310 hypothetical protein - Deinococcus radiodurans
           (strain R1)>gb:AE002048_42379 Deinococcus radiodurans R1
           section 185 of 229 of the complete chromosome
           1.>gb:AE000513_883274 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 150

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 15/47 (31%), Positives = 31/47 (65%)
 Frame = +1

Query: 352 LCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           + +  ++   S++V+ +HG   + RA+LGSV++   HHAH  V++++
Sbjct: 94  IIDVAKEEGVSMIVMTTHGRAGLGRALLGSVAEAVLHHAHVPVVLIR 140



>sp|P74148|YD88_SYNY3 Hypothetical protein
           sll1388.>pir|S75674|S75674 hypothetical protein sll1388
           - Synechocystis sp. (strain PCC 6803)>gb:BA000022_689014
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 154

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 17/58 (29%), Positives = 31/58 (53%)
 Frame = +1

Query: 319 FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +++  G+    + +  +   A ++V+G  G   +    LGSVS Y  HH  C+V+IV+
Sbjct: 96  WDVKVGEPGRWIRDMAKNWDADLVVLGRRGLKGLAEVFLGSVSSYVIHHVQCSVLIVQ 153



>gb:CR382137_1669910 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 473

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 20/55 (36%), Positives = 32/55 (58%)
 Frame = +1

Query: 343 RNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           R+++ E +E    ++ VVGS G  AIK  +LGS+S+Y        VM+V++   K
Sbjct: 393 RHLILEIIENLQPTLAVVGSKGQSAIKGVLLGSLSNYLVTKLTVPVMVVREKLKK 447



>gb:BX572604_803047 Rhodopseudomonas palustris CGA009 complete
           genome; segment 12/16.
          Length = 214

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 1/146 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +++  D S ++  AL W +            LVLV+A P PA    L G  A  +     
Sbjct: 76  ILLPYDGSANAGRALDWVIA--LAHDNVPIELVLVYAHPEPA----LYGEIAVYVSKEKM 129

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMF-EIMEGDARNVLCETVEKHHASILVVGSHGYG 414
            +L++  +  I +   I    + + P+  E++ GD    + +  E+ + S +V+G+ G  
Sbjct: 130 DELQREHSDDILQPA-IAKLNAANIPLTSEVLTGDTAQRIVKRAEELNCSGIVMGTRGRS 188

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
           AI   VLGSV++   H     V +VK
Sbjct: 189 AIGNLVLGSVANKVVHLTKLPVTLVK 214



>gb:BX571966_795200 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_867595
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 156

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 22/81 (27%), Positives = 44/81 (54%), Gaps = 4/81 (4%)
 Frame = +1

Query: 262 RVIERAKEICASKSV--DDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGYGAIKRA 429
           + +  A++  A+  V  D  +FE   +  +    L    + + A ++V+G+HG   ++R 
Sbjct: 66  KALAEAEQALAAAQVPGDAELFETAGIGEEVAQALERCAKSNGADLVVLGTHGRRGVRRV 125

Query: 430 VLGSVSDYCAHHAHCTVMIVK 492
           VLGSV++     +HC V++V+
Sbjct: 126 VLGSVAERFLRASHCPVLLVR 146



>gb:BA000030_699161 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 290

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 43/145 (29%), Positives = 59/145 (40%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +VV VD SE S  A+ W  D      V   RLV          A    G G        D
Sbjct: 5   LVVGVDGSESSMRAVDWAADEAALRGVP-LRLVYASLWERYEGAALADGLGRPPEQVIAD 63

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             ++  A R   R  ++  S  V      + E  A  +L E  E   A  LV+GS G   
Sbjct: 64  DIVEAAAQRAHRRHADVKISTDV------LPEEPAPALLREGNE---AFALVLGSRGRSG 114

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVK 492
           +   +LGSVS   A  A+C V++++
Sbjct: 115 LAELLLGSVSLAVAARAYCPVIVLR 139



>gb:AL935255_551156 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 4/11.
          Length = 168

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 10/91 (10%)
 Frame = +1

Query: 268 IERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSV 444
           + +A++   +  V D    +  G+++ +L  T+ +++   ++VVG+ G   + R ++GS 
Sbjct: 75  LAKARQQAMAAGVSDVRVHLHSGNSKLLLATTLPDRYGTDLIVVGATGLNNVARVLIGSN 134

Query: 445 SDYCAHHAHCTVMI---------VKKPKHKT 510
           + Y   +A C  ++         VK PKH T
Sbjct: 135 AAYVIRNATCDTLVVRTDADQQPVKLPKHTT 165



>gb:AE017233_412459 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 7 of 16 of the complete
           genome.>gb:AE016958_1055863 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 294

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +1

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           +LV+GS G+G + R +LGSVS     HA+C V +V+
Sbjct: 113 MLVLGSAGHGLLARGLLGSVSSAVVRHANCPVAVVR 148



 Score = 38.9 bits (89), Expect = 0.073
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = +1

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           A ++VVGSHG G + R +LGSVS+   H     V++ + P
Sbjct: 254 AQLVVVGSHGRGGLARLLLGSVSNAVLHSVRVPVIVARPP 293



>gb:AE016925_359261 Chromobacterium violaceum ATCC 12472 section 16
           of 16 of the complete genome.>gb:AE016825_1044415
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 158

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 34/150 (22%), Positives = 65/150 (43%), Gaps = 5/150 (3%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++ A+D S +S  AL   +        +  RL L+H       AV   G  A D  P  D
Sbjct: 5   IIAAIDGSNNSDKALHEAIR---VAKFTEARLTLIHVASLRDLAVDSLGVYAGD--PGYD 59

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEG-----DARNVLCETVEKHHASILVVGS 402
             L++     + RA+EI  +  + + +  + +      D  ++L        A ++V+G+
Sbjct: 60  LALQQ-GQEALARAQEIARNAGLSNVVSHLEKSWEGGHDLADLLIGYASAQQADLIVLGT 118

Query: 403 HGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           HG   +    LGS ++     + C +++V+
Sbjct: 119 HGRSGLAHLFLGSFAEDILRRSQCPLLVVR 148



>gb:CR522870_100185 Desulfotalea psychrophila LSv54 chromosome.
          Length = 174

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 20/90 (22%), Positives = 43/90 (47%)
 Frame = +1

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
           ++  +KK+ A   E+ +       + D   +++ GD    + E      A ++++G+HGY
Sbjct: 81  LEGAMKKMEA-FCEKLQPTLDESGISDVKSKVLTGDVAERIIEYAAGADAGMIIMGTHGY 139

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
             +++ + GSV+      A C V+ +   K
Sbjct: 140 KGLEKIMFGSVAGKVVRAAGCPVLTINPYK 169



>gb:CR378680_98519 Photobacterium profundum SS9 chromosome 2;
           segment 6/7.
          Length = 311

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 16/56 (28%), Positives = 35/56 (62%)
 Frame = +1

Query: 325 IMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           ++EGDAR+VL + VEK    ++++GS     +   ++G+ ++   +  +C+V+ +K
Sbjct: 246 LLEGDARSVLPQFVEKESVDVVILGSLSRSGVAGFLMGNTAESMLNQLNCSVITLK 301



>pir|G70572|G70572 hypothetical protein Rv2624c - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_22786
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248343_760014 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           10/14.>gb:BX842580_820714 Mycobacterium tuberculosis
           H37Rv complete genome; segment 9/13.
          Length = 272

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 1/146 (0%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADI-LPHV 234
           ++V +D S  +  A  W +D   +  V   RLV V     P+       P   D  L H 
Sbjct: 12  IIVGIDGSHAAITAALWGVDEAISRAVP-LRLVSVIKPTHPS-------PDDYDRDLAHA 63

Query: 235 DSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYG 414
           +  L++ A   +E A ++   ++      +I  G A  VL E      A ++ VGS G G
Sbjct: 64  ERSLRE-AQSAVEAAGKLVKIET------DIPRGPAGPVLVEA--SRDAEMICVGSVGIG 114

Query: 415 AIKRAVLGSVSDYCAHHAHCTVMIVK 492
               ++LGS +   A  AHC V +++
Sbjct: 115 RYASSILGSTATELAEKAHCPVAVMR 140



>pir|A86854|A86854 conserved hypothetical protein ytaA [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006413_218735 Lactococcus lactis subsp.
           lactis IL1403 section 175 of 218 of the complete
           genome.>gb:AE005176_1095808 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 145

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 1/89 (1%)
 Frame = +1

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA-SILVVGSHG 408
           V  D  K A  +I    +      V      +  G  + +L +T+ K    S++V+G+ G
Sbjct: 57  VADDTHKGAENLINDFADEAKKAGVKKVKTRVEFGSPKVMLGQTLPKEEEISLIVLGATG 116

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
              I+R  +GSV+DY   +A C V++V++
Sbjct: 117 LSYIERIFIGSVADYIIKNAPCDVLVVRQ 145



>sp|Q10851|YK05_MYCTU Hypothetical protein
           Rv2005c/MT2061/Mb2028c.>pir|C70759|C70759 hypothetical
           protein Rv2005c - Mycobacterium tuberculosis  (strain
           H37RV)>gb:AE000516_22110 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248341_759384
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 8/14.>gb:BX842578_820079 Mycobacterium
           tuberculosis H37Rv complete genome; segment 7/13.
          Length = 295

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 39/146 (26%), Positives = 65/146 (44%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V +D S  S  A     D      V    L+ VHA  S    V L G   + +    +
Sbjct: 162 VLVGIDGSPVSELATAVAFDEASRRGVE---LIAVHAW-SDVEVVELPGLDFSAVQQEAE 217

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
             L +  A   ER  ++  S+ V      + +  AR ++ ++     A ++VVGSHG G 
Sbjct: 218 LSLAERLAGWQERYPDVPVSRVV------VCDRPARKLVQKSAS---AQLVVVGSHGRGG 268

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKK 495
           +   +LGSVS+   H A   V++ ++
Sbjct: 269 LTGMLLGSVSNAVLHAARVPVIVARQ 294



 Score = 36.6 bits (83), Expect = 0.36
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 247 KKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKR 426
           ++I A  ++ AKE   +        E++       + E    + A ++V+GS G GA+ R
Sbjct: 69  RQIVANAVKLAKEAVGADRKLSVKSELVFSTPVPTMVEI--SNEAEMVVLGSSGRGALAR 126

Query: 427 AVLGSVSDYCAHHAHCTVMIV 489
            +LGSVS      A C V ++
Sbjct: 127 GLLGSVSSSLVRRAGCPVAVI 147



>gb:BA000036_719097 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927152_832950 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 5/10.
          Length = 147

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 21/56 (37%), Positives = 28/56 (50%)
 Frame = +1

Query: 322 EIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           E+  G     L   V  H A +LVVG+ G  ++   +LGSV    A  + C VMIV
Sbjct: 88  EVRTGTPVEALMAIVNDHQADLLVVGNRGINSLTGRLLGSVPADVARQSDCDVMIV 143



>gb:AL935258_552008 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 7/11.
          Length = 160

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 22/94 (23%), Positives = 47/94 (50%), Gaps = 10/94 (10%)
 Frame = +1

Query: 256 AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHA-SILVVGSHGYGAIKRAV 432
           A + +++      +  +D+  + I  G  + ++   V K     ++++G+ G  A++R +
Sbjct: 67  AQKTLDKYVAEAKADGLDNVDYSIEYGAPKTIIARDVPKDMGIDLIMIGATGLNAVERLL 126

Query: 433 LGSVSDYCAHHAHCTVMIVK---------KPKHK 507
           +GSV++Y    A C V++V+         KPK K
Sbjct: 127 IGSVTEYVTRMAVCDVLVVRTDLENKPAPKPKKK 160



>pir|C90503|C90503 conserved hypothetical protein [imported] -
           Sulfolobus solfataricus>gb:AE006907_223897 Sulfolobus
           solfataricus P2 section 266 of 272 of the complete
           genome.>gb:AE006641_1109745 Sulfolobus solfataricus P2,
           complete genome.
          Length = 130

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 37/147 (25%), Positives = 64/147 (43%), Gaps = 2/147 (1%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           +V+  D S+H+  AL +TL+            ++  A  SP   +  +   A  +   V 
Sbjct: 3   VVIGYDGSDHAKKALFFTLNLIKKEDEIHLVTIVKEAPRSPEQVIIQSEQRAKQMQDEVV 62

Query: 238 SDLK--KIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGY 411
           ++L   KI  +++E       S  V D + +       N+ C         ++V GS G 
Sbjct: 63  NELGDYKIVQKILE-------SNEVADSILQY----CNNIGC--------GLIVTGSRGL 103

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             IK+A+LGSVS      ++  V++VK
Sbjct: 104 TGIKKAILGSVSSALVSKSNVPVLVVK 130



>gb:AY588238_630448 Lactobacillus sakei universal stress protein
           (usp) gene, complete cds.
          Length = 144

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = +1

Query: 232 VDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETV-EKHHASILVVGSHG 408
           ++++ K     + E+AKE    + V D       G  R  L  T+ ++    + +VG  G
Sbjct: 58  LEAERKSTKLYLEEKAKE-AKDQGVADVQTIFKVGSPRRELAITIPQEADIDLTIVGVSG 116

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            GAI+R ++GSV+ + + H+   V++VK
Sbjct: 117 KGAIERLLIGSVAQFISIHSTTNVLLVK 144



>gb:AE017331_445069 Listeria monocytogenes str. 4b F2365, section 10
           of 10 of the complete genome.>gb:AE017262_1077425
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 156

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 17/35 (48%), Positives = 26/35 (74%)
 Frame = +1

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           +++VG+ G  A ++ +LGSVS+Y A HA C V+IV
Sbjct: 108 LILVGATGLSATEQFILGSVSEYTAAHAPCDVIIV 142



>gb:AE016966_369162 Coxiella burnetii strain RSA 493, section 7 of 7
           of the complete genome.>gb:AE016828_1009898 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 144

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 20/69 (28%), Positives = 38/69 (55%)
 Frame = +1

Query: 283 EICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAH 462
           E+C +  V       + G  ++++ E  EK +  ++VVG+HG+  + + +LGS ++   H
Sbjct: 73  ELCHTVKVPSERQHTLSGVVKHMVIELAEKLNIDLIVVGTHGHHGLDK-LLGSRANAILH 131

Query: 463 HAHCTVMIV 489
            A C V+ V
Sbjct: 132 VATCDVLAV 140



>gb:TACID2_196358 Thermoplasma acidophilum complete genome; segment
           2/5.
          Length = 147

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 3/85 (3%)
 Frame = +1

Query: 241 DLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNV---LCETVEKHHASILVVGSHGY 411
           D +K A  +IE+AK++ +++++D   F+I++   + V   + E  E+    +++ GS   
Sbjct: 57  DERKKAEDIIEKAKKLVSNENLDID-FQIVDSGTKTVAKKIVEVAEESGVDLIITGSRNL 115

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMI 486
             + + +LGSVS      ++  VM+
Sbjct: 116 KGLTKIILGSVSSELLKLSNVPVMV 140



>gb:CR522870_99227 Desulfotalea psychrophila LSv54 chromosome.
          Length = 161

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 16/69 (23%), Positives = 36/69 (52%)
 Frame = +1

Query: 295 SKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHC 474
           +K+  +   +++ GD    +          ++V+G+HGY  +++ + GSV++    ++HC
Sbjct: 87  NKNCKEITTKVLAGDISEQIIGYASSLETGMIVMGTHGYKGLEKIMFGSVANKVVQNSHC 146

Query: 475 TVMIVKKPK 501
            V+ V   K
Sbjct: 147 PVLTVNPYK 155



>gb:CP000029_81874 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016748_323035 Staphylococcus epidermidis
           ATCC 12228, section 5 of 9 of the complete
           genome.>gb:AE015929_1147704 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 166

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 19/83 (22%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = +1

Query: 247 KKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKH-HASILVVGSHGYGAIK 423
           K  +  +++  KE+  +  V +    +  G  + ++ + + +   A +++ G+ G  A++
Sbjct: 61  KHFSEELLKGYKEVATNAGVKNVDTRLEFGSPKAIIPKKLARDVGADLIMSGTSGLNAVE 120

Query: 424 RAVLGSVSDYCAHHAHCTVMIVK 492
           R ++GSVS+    HA C V++V+
Sbjct: 121 RFIVGSVSEAIVRHAPCDVLVVR 143



>pir|AH1408|AH1408 conserved hypothetical protein lmo2673 [imported]
           - Listeria monocytogenes (strain
           EGD-e)>gb:AL591984_537163 Listeria monocytogenes strain
           EGD, complete genome, segment 12/12.
          Length = 156

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 17/35 (48%), Positives = 26/35 (74%)
 Frame = +1

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           +++VG+ G  A ++ +LGSVS+Y A HA C V+IV
Sbjct: 108 LILVGATGLSATEQFILGSVSEYTATHAPCDVIIV 142



>pir|AF1784|AF1784 conserved hypothetical protein lin2820 [imported]
           - Listeria innocua (strain Clip11262)>gb:AL596173_540160
           Listeria innocua Clip11262 complete genome, segment
           11/12.
          Length = 156

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 17/35 (48%), Positives = 26/35 (74%)
 Frame = +1

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           +++VG+ G  A ++ +LGSVS+Y A HA C V+IV
Sbjct: 108 LILVGATGLSATEQFILGSVSEYTAAHAPCDVIIV 142



>sp|O27222|YB54_METTH Hypothetical protein
           MTH1154.>pir|G69020|G69020 conserved hypothetical
           protein MTH1154 - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000885_28839 Methanobacterium
           thermoautotrophicum from bases 1062002 to 1076191
           (section 91 of 148) of the complete
           genome.>gb:AE000666_925921 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 146

 Score = 38.5 bits (88), Expect = 0.095
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +1

Query: 331 EGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           EGD  + + +  E+    ++V+G+ G   + + +LGSVS+   H+A CT+ +V+
Sbjct: 92  EGDPADEIVKVAEEEDVDVIVMGT-GKSLVDKHLLGSVSEKVVHYAPCTIHLVR 144



>gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD22.
          Length = 819

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 40/174 (22%), Positives = 77/174 (44%), Gaps = 32/174 (18%)
 Frame = +1

Query: 31  MAAAAEKPVMVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPG 210
           +AA +E   + +A+  S  S   + W L+ F +    TF+L+ +H K +         P 
Sbjct: 25  LAAPSEPMTVALAISGSIKSKNVIKWALNKFGSDKNVTFKLIHIHPKITTL-------PT 77

Query: 211 AADILPHVDSDLKKIAA----RVIERAKE--------ICASK--SVDDPMFE-------- 324
           A+  +  +  +L+++AA    +V++  KE        +C  K   +D+  FE        
Sbjct: 78  ASGNIVSISEELEEVAAAYRQKVMQETKETLLKPFKKMCERKKLKIDETRFESSLTKVAV 137

Query: 325 ---IMEGDARNV-LCETVEKHHASILVVGSHGYGAIKR------AVLGSVSDYC 456
              ++E ++  V + + V +H  S L++G     A  R      ++  SVS+ C
Sbjct: 138 ELQVLESNSVAVAITKEVNQHLISNLIIGRSSQAASSRNYDITASISASVSNLC 191



>gb:BA000035_716283 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 147

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 24/74 (32%), Positives = 34/74 (45%)
 Frame = +1

Query: 268 IERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVS 447
           +E+A E   +        EI  G     L   V   +A +LVVG+ G  ++   +LGSV 
Sbjct: 70  LEKASEAARNVGATKIETEIRPGTPVEALMGIVTDRNADLLVVGNRGINSLTGRLLGSVP 129

Query: 448 DYCAHHAHCTVMIV 489
              A  + C VMIV
Sbjct: 130 ADVARQSDCDVMIV 143



>gb:AY596297_634391 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 157

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 22/84 (26%), Positives = 41/84 (48%)
 Frame = +1

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           +D+K+ A       ++  A   V+     I  G+    + + VE +   ++V+GSHG   
Sbjct: 65  TDIKEDADEATGYVRDRAAEHGVEVEE-HITAGEPARAIRKFVEDNDIDLVVMGSHGRSG 123

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIV 489
           +KR +LGSV++         V++V
Sbjct: 124 LKRVILGSVTEKVLRRTRLPVLVV 147



>gb:AE017302_436179 Thermus thermophilus HB27 section 2 of 7 of the
           complete genome.>gb:AE017221_1078157 Thermus
           thermophilus HB27 complete genome.
          Length = 137

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 3/148 (2%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHA-KPSPANAVSLAGPGAADIL--P 228
           +++A D SEH+  A G              RL++VHA +P P            D L  P
Sbjct: 5   ILLAYDGSEHAKRAAGVAKAE---AEAHGARLIVVHAYEPVP------------DYLGEP 49

Query: 229 HVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHG 408
             +  L++   R     +E  A   V      ++EG     + +      A ++V+G+ G
Sbjct: 50  FFEEALRRRLERAEGVLEEARALTGVPKEDALLLEGVPAEAILQAARAEKADLIVMGTRG 109

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            GA+    LGS S      A C V++V+
Sbjct: 110 LGALGSLFLGSQSQRVVAEAPCPVLLVR 137



>pir|AD2010|AD2010 hypothetical protein alr1634 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682623 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 287

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/91 (18%), Positives = 50/91 (54%)
 Frame = +1

Query: 220 ILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVG 399
           +L    S+  + A+  +  AK++   K+  +P+  ++EG+    +   V+++  ++L++G
Sbjct: 198 LLTVAKSNSDQTASTRLNEAKQLL-QKARFEPICSLLEGEPEKAIARYVQENKINLLMMG 256

Query: 400 SHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           ++G+  I+  ++GS +      ++  V++ +
Sbjct: 257 AYGHSRIRHLIIGSTTTQILRSSNIPVLVFR 287



>pir|D69008|D69008 conserved hypothetical protein MTH1065 -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000877_28750 Methanobacterium
           thermoautotrophicum from bases 966225 to 976858 (section
           83 of 148) of the complete genome.>gb:AE000666_925832
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 147

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +1

Query: 217 DILPHVDSDLKKIAARVIERAKEICASKSVDDPMFE------IMEGDARNVLCETVEKHH 378
           DI   ++  LKK A + I   KE  +S+     M E      I+EG+   V+ E +E   
Sbjct: 50  DISRRLEEILKKQAEKAISILKEEFSSQQELGHMTETRLDTVILEGNPAEVILEVMEDED 109

Query: 379 ASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
             ++V+GS G   + R + GS++      A   +M+V
Sbjct: 110 VDLVVMGSSGKHGLDRIISGSITRKVLKSATKPMMVV 146



>gb:CP000001_854968 Bacillus cereus ZK, complete genome.
          Length = 152

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E    H   +++ G+ G  A++R ++GSVS++   +A C V++V+
Sbjct: 100 EIAPNHKVDLIMCGATGLNAVERFLIGSVSEHIIRYAKCDVLVVR 144



>gb:BX321859_773356 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 4/10.
          Length = 148

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 29/118 (24%), Positives = 53/118 (44%), Gaps = 3/118 (2%)
 Frame = +1

Query: 148 RLVLVHAK---PSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPM 318
           RL L+H     P P      A P   +       D++K      ++  +I  +  +D   
Sbjct: 34  RLSLIHVLDNIPMPDTPYGTAIPLDTETTYDAMLDVEK------QKLSQIGNTLGIDPAH 87

Query: 319 FEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
             ++ G+ R  +    E+ +  ++VVGSHG   +   +LGS ++   H+A C V+ V+
Sbjct: 88  RWLVWGEPREEIIRIAEQENVDLIVVGSHGRHGL-ALLLGSTANSVLHYAKCDVLAVR 144



>gb:BA000040_733942 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 477

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +1

Query: 337 DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
           D    + E  E +H   +++G+   G+ +R +LGSVS   A  A CTV +V+ P+
Sbjct: 411 DPAAAILEFAEVNHVDHVIIGAR-QGSFRRTLLGSVSAKVAAEAACTVTVVRPPR 464



>gb:BA000031_705779 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 145

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 6/88 (6%)
 Frame = +1

Query: 247 KKIAARVIERAKE---ICASKSVDDPMF---EIMEGDARNVLCETVEKHHASILVVGSHG 408
           K  AA++ +  K+     AS+ +DD +     + EG A   + +  E+  A ++++ SH 
Sbjct: 55  KDAAAKMKQDVKQQLKAFASEHIDDEVIYKVHVAEGKAYATILDYAERLGADLIIMPSHK 114

Query: 409 YGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
              I + +LGSV+     ++   VM+VK
Sbjct: 115 RSKINKVMLGSVASKVVEYSPINVMVVK 142



>gb:BA000023_693055 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 130

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)
 Frame = +1

Query: 322 EIMEG-DARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           EI+E  D  + + E  +K + +++V GS G   +K+ +LGSVS      A   V++VK
Sbjct: 73  EILESPDVSSAIIEYCKKINCNMIVTGSRGLTGLKKVILGSVSSALVSKADVPVLVVK 130



>gb:AE017013_379488 Bacillus cereus ATCC 14579 section 16 of 18 of
           the complete genome.>gb:AE017039_384804 Bacillus
           anthracis str. Ames section 16 of 18 of the complete
           genome.>gb:AE017225_409897 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017279_425960 Bacillus
           cereus ATCC 10987, section 16 of 18 of the complete
           genome.>gb:AE017334_454651 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_465650 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1014509 Bacillus anthracis str. Ames
           complete genome.>gb:AE016877_1019738 Bacillus cereus
           ATCC 14579 complete genome.>gb:AE017194_1064379 Bacillus
           cereus ATCC 10987, complete genome.
          Length = 152

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 14/45 (31%), Positives = 28/45 (62%)
 Frame = +1

Query: 358 ETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           E    H   +++ G+ G  A++R ++GSVS++   +A C V++V+
Sbjct: 100 EIAPNHKVDLIMCGATGLNAVERFLIGSVSEHIIRYAKCDVLVVR 144



>gb:CP000027_79677 Dehalococcoides ethenogenes 195, complete genome.
          Length = 296

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+   ++ + +  +   +L V SHGY  IK+ VLGSVS+      +  V++VK
Sbjct: 84  GELLPLILKCIRDNDIDLLCVASHGYTGIKKMVLGSVSEKLIKSTNLPVLLVK 136



>gb:CP000027_79643 Dehalococcoides ethenogenes 195, complete genome.
          Length = 287

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+   ++ + +  +   +L V SHGY  IK+ VLGSVS+      +  V++VK
Sbjct: 75  GELLPLILKCIRDNDIDLLCVASHGYTGIKKMVLGSVSEKLIKSTNLPVLLVK 127



>sp|P45680|YJ16_COXBU Hypothetical protein
           CBU1916.>pir|I40650|I40650 hypothetical protein 146 -
           Coxiella burnetii>gb:AE016966_369097 Coxiella burnetii
           strain RSA 493, section 7 of 7 of the complete
           genome.>gb:CBU10529_845480 Coxiella burnetii Nine Mile
           strain phase I clone 7 minimal autonomous replication
           sequence and ribosomal protein L34 (ORF44), RNase P
           protein component (ORF121), 9 kDa protein (ORF88) and 60
           kDa inner membrane protein (ORF487) genes, complete
           cds.>gb:AE016828_1009833 Coxiella burnetii strain RSA
           493, complete genome.
          Length = 146

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 21/74 (28%), Positives = 38/74 (51%)
 Frame = +1

Query: 271 ERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSD 450
           +R  EI +  ++      +  G A+ ++ E  +     +++VGSHG   I + +LGS S+
Sbjct: 70  KRMNEIASQLNISSDHQIVKVGPAKFLILEQAKNWGVDLIIVGSHGRHGI-QLLLGSTSN 128

Query: 451 YCAHHAHCTVMIVK 492
              H A C V+ V+
Sbjct: 129 AVLHGAKCDVLAVR 142



>gb:CP000003_861432 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 180

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 334 GDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+ +N+L   + ++ +A +++VG+ G    +R ++GS S+Y   HA   +++V+
Sbjct: 121 GNPKNLLAHDIPDRENADLIMVGATGLNTFERLLIGSSSEYIMRHAKIDLLVVR 174



>gb:BX569694_776881 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 282

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 8/90 (8%)
 Frame = +1

Query: 256 AARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSH--------GY 411
           A  +++ A +   S  V+     +   D    +C+  E+ +A +LV+ S         G 
Sbjct: 191 ADELLQAAAQRARSFGVELKCLTVQGKDIGRAVCQAAEQANADLLVIASQDRRPLVARGL 250

Query: 412 GAIKRAVLGSVSDYCAHHAHCTVMIVKKPK 501
             + + + GSVSDY   HA   V++V++P+
Sbjct: 251 VDLDKLLGGSVSDYIRVHAPAPVLLVREPE 280



>gb:BA000045_744243 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 153

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +1

Query: 334 GDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMI 486
           GD  + +CE      A +LV+     G   R V GSV++Y   HA C+++I
Sbjct: 101 GDPGSKICELAAAQRADLLVMTRRSLGFWDRLVGGSVTEYVLRHAPCSLLI 151



>gb:BA000039_728053 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 129

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 22/88 (25%), Positives = 41/88 (46%)
 Frame = +1

Query: 226 PHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSH 405
           P  D +L+   A  + R KE  A +++      +  G    V+C+  ++ +AS++++G  
Sbjct: 42  PEPDPELEAAIAEFLNRVKEAFAQQAIVAETL-LRRGKPAFVICDVADEINASLIIMGCR 100

Query: 406 GYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           G          SVS    + A C V++V
Sbjct: 101 GTALTPEGFQESVSTRVINLAPCPVLVV 128



>gb:AE016953_365989 Enterococcus faecalis V583, section 7 of 11 of
           the complete genome.>gb:AE016830_992477 Enterococcus
           faecalis V583, complete genome.
          Length = 157

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 15/54 (27%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +1

Query: 334 GDARNVLCETVEK-HHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G  +N++ + + K ++  ++++G+ G  A++R  +GSVS+    +A C V++V+
Sbjct: 91  GSPKNIIAKELPKEYNIDLIMLGATGLNAVERLFIGSVSESVIRNASCDVLVVR 144



>gb:AE016784_332070 Pseudomonas putida KT2440 section 11 of 21 of
           the complete genome.>gb:AE015451_947147 Pseudomonas
           putida KT2440 complete genome.
          Length = 309

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 25/112 (22%), Positives = 52/112 (46%)
 Frame = +1

Query: 151 LVLVHAKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIM 330
           ++L+HA  +P  A         D L H  + ++K A   +    E   +  + D    ++
Sbjct: 199 IILLHAYEAPFEASVRFAHLDHDTLTHYRNVIRKDAQVQLAALSE---AAGLADARQILV 255

Query: 331 EGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMI 486
            GD    + E  ++    ++VVG  G  A++  ++GSV+ +  + + C V++
Sbjct: 256 HGDPGWRIAEQEQELECDLIVVGKQGASALEELLVGSVTKHVLNESQCDVLV 307



 Score = 32.7 bits (73), Expect = 5.2
 Identities = 14/57 (24%), Positives = 27/57 (47%)
 Frame = +1

Query: 322 EIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           ++  G     +   V+  H+ +LV G+ G    +R +LGS      +   C +++VK
Sbjct: 107 QVASGSVITEINRVVQDKHSDLLVCGARGQSVARRLLLGSTVQKLLNRMPCPLLVVK 163



>gb:AE014165_305023 Streptococcus pyogenes MGAS315, section 30 of 37
           of the complete genome.>gb:AE014074_928202 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 150

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 334 GDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+ +N+L   + ++ +A +++VG+ G    +R ++GS S+Y   HA   +++V+
Sbjct: 91  GNPKNLLAHDIPDRENADLIMVGATGLNTFERLLIGSSSEYIMRHAKIDLLVVR 144



>gb:AE013379_291783 Methanosarcina mazei strain Goe1, section 161 of
           379 of the complete genome.>gb:AE008384_965892
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 150

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 21/62 (33%), Positives = 33/62 (53%)
 Frame = +1

Query: 310 DPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIV 489
           D  F I EG     + +  EK    ++VVGS G    +R +LGSVS+    +A   V++V
Sbjct: 86  DVEFVIREGHPAEKILDFAEKQDIDMIVVGSLGKTDAERFLLGSVSEKVVRNAKVPVLVV 145

Query: 490 KK 495
           ++
Sbjct: 146 RE 147



>gb:AE010090_259249 Streptococcus pyogenes strain MGAS8232, section
           138 of 173 of the complete genome.>gb:AE009949_905631
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 168

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 334 GDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+ +N+L   + ++ +A +++VG+ G    +R ++GS S+Y   HA   +++V+
Sbjct: 109 GNPKNLLAHDIPDRENADLIMVGATGLNTFERLLIGSSSEYIMRHAKIDLLVVR 162



>gb:AE006605_220640 Streptococcus pyogenes M1 GAS, section 134 of
           167 of the complete genome.>gb:BA000034_713244
           Streptococcus pyogenes SSI-1 DNA, complete
           genome.>gb:AE004092_1106486 Streptococcus pyogenes M1
           GAS, complete genome.
          Length = 168

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 15/54 (27%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +1

Query: 334 GDARNVLCETV-EKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
           G+ +N+L   + ++ +A +++VG+ G    +R ++GS S+Y   HA   +++V+
Sbjct: 109 GNPKNLLAHDIPDRENADLIMVGATGLNTFERLLIGSSSEYIMRHAKIDLLVVR 162



>gb:SPAC57A7_1718090 S.pombe chromosome I cosmid c57A7.
          Length = 131

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/56 (30%), Positives = 33/56 (58%)
 Frame = +1

Query: 340 ARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           A++++ E ++    S++V+GS G   +K  +LGS S+Y  + +   VM+ +K   K
Sbjct: 49  AKHLIIEMIDYIEPSLVVMGSRGRSHLKGVLLGSFSNYLVNKSSVPVMVARKKLKK 104



>gb:BX640435_812299 Bordetella parapertussis strain 12822, complete
           genome; segment 13/14.
          Length = 288

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 42/170 (24%), Positives = 66/170 (38%), Gaps = 14/170 (8%)
 Frame = +1

Query: 28  RMAAAAEKPVMVV-------------AVDDSEHSFYALGWTLDHFFTGPVSTFRLVLV-H 165
           R+A  A +PV+VV             A D SE S  AL   L      P++ F    V  
Sbjct: 126 RLARQASQPVLVVKARPRKPYRDVVVATDFSEGSRQALVAALRVAGDAPLTLFHAYDVPF 185

Query: 166 AKPSPANAVSLAGPGAADILPHVDSDLKKIAARVIERAKEICASKSVDDPMFEIMEGDAR 345
            K +P +AV          +    +   + A   ++   E+    +   P   +  G   
Sbjct: 186 GKDAPEDAV----------VRRFYNGAAQKARAFLDGTPELAGRPA---PELVLESGQPE 232

Query: 346 NVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKK 495
            +L E V      + V G+HG   I R  +GSV++       C V+IV++
Sbjct: 233 TLLSEYVFNRRCDLAVTGTHGLTGILRTAIGSVAEKLLEALPCDVLIVRQ 282



>gb:AL935257_551513 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 6/11.
          Length = 166

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 29/147 (19%), Positives = 60/147 (40%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAKPSPANAVSLAGPGAADILPHVD 237
           ++V +D S++++YAL   +          F L ++        +  +    A D++    
Sbjct: 5   ILVPLDGSDNAYYALEHAIALAKVFDSQLFLLNVIDVNRFGVYSPDVFTSAAPDMMSFDQ 64

Query: 238 SDLKKIAARVIERAKEICASKSVDDPMFEIMEGDARNVLCETVEKHHASILVVGSHGYGA 417
           +  KK+    +ERA++  A+  +              +  +  +  +  ++V+G  G  A
Sbjct: 65  AQSKKL----LERAQDQVAAHQLHAETIRQTGVPKVTIAVDVPKAQNIDLIVIGRSGTNA 120

Query: 418 IKRAVLGSVSDYCAHHAHCTVMIVKKP 498
           I R  LGS + Y   +    V +V  P
Sbjct: 121 ISRLFLGSTTAYVVRNTEANVTVVNMP 147



>gb:AE016799_335442 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:BA000037_721289
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1045166 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 145

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 2/84 (2%)
 Frame = +1

Query: 247 KKIAARVIERAKEICASKSVDDPMFEI--MEGDARNVLCETVEKHHASILVVGSHGYGAI 420
           +K+   V+++ K        D+ ++++   EG     + E  EK  A ++++ SH    I
Sbjct: 59  QKMKQDVVQQLKNFADQHIADEIVYKVHVAEGKPYATILEYAEKLGADLIIMPSHKRSKI 118

Query: 421 KRAVLGSVSDYCAHHAHCTVMIVK 492
            + VLGSV+     ++   V++VK
Sbjct: 119 DKVVLGSVASKVVENSPINVLVVK 142



>pir|T37029|T37029 hypothetical protein SCJ12.10c - Streptomyces
           coelicolor>gb:SCO939104_173874 Streptomyces coelicolor
           A3(2) complete genome; segment 1/29.
          Length = 288

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 43/156 (27%), Positives = 66/156 (42%), Gaps = 11/156 (7%)
 Frame = +1

Query: 58  MVVAVDDSEHSFYALGWTLDHFFTGPVSTFRLVLVHAK-----PSPANAVSLAGPGAADI 222
           MVV VD SE S  A+ W  D      V    L +VHA         + A  L  P     
Sbjct: 5   MVVGVDGSESSLGAVDWAADEAALHEVP---LRIVHAYRWDRYEGASLARELGKPSG--- 58

Query: 223 LPHVDSDLKKIAARVIERAKE------ICASKSVDDPMFEIMEGDARNVLCETVEKHHAS 384
             HV +D   I A    RA+       +    + ++P + ++  +ARN          AS
Sbjct: 59  --HVTTD--DILAVATRRARRHHPDLAVTTEATAEEPEYVLLR-EARN----------AS 103

Query: 385 ILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVK 492
            +++G+ G G +   +LGSVS   A  + C V++ +
Sbjct: 104 AVILGTRGRGELAGLLLGSVSLTVATMSDCPVVVTR 139



>sp|P87132|YFK5_SCHPO Hypothetical protein C167.05 in chromosome
           I.>pir|T37738|T37738 hypothetical protein SPAC167.05 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC167_1716600 S.pombe chromosome I cosmid
           c167.
          Length = 601

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/56 (30%), Positives = 33/56 (58%)
 Frame = +1

Query: 340 ARNVLCETVEKHHASILVVGSHGYGAIKRAVLGSVSDYCAHHAHCTVMIVKKPKHK 507
           A++++ E ++    S++V+GS G   +K  +LGS S+Y  + +   VM+ +K   K
Sbjct: 519 AKHLIIEMIDYIEPSLVVMGSRGRSHLKGVLLGSFSNYLVNKSSVPVMVARKKLKK 574


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 654,834,085
Number of Sequences: 1806583
Number of extensions: 13576457
Number of successful extensions: 39477
Number of sequences better than 10.0: 376
Number of HSP's better than 10.0 without gapping: 38238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39399
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33391048418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)