BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2397
         (624 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P49637|R27C_ARATH|R27C_ARATH 60S ribosomal protein L27a-3.>pir|S71256|S7...   278   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb:AY085573_1570642 Arabidopsis thaliana clone 15789 mRNA, compl...   276   2e-73   
sp|Q9LR33|R27B_ARATH|R27B_ARATH 60S ribosomal protein L27a-2.>gb:AE005172_8...   273   2e-72   Arabidopsis thaliana [mouse-ear cress]
gb:AF088913_1767278 Petunia x hybrida ribosomal protein L27a mRN...   268   7e-71   
gb:AB042856_1519951 Panax ginseng mRNA for 60S ribosomal protein...   268   7e-71   
gb:AC135559_1742521 Oryza sativa chromosome 3 BAC OSJNBa0030J19 ...   256   2e-67   
gb:AP003992_1836049 Oryza sativa (japonica cultivar-group) genom...   253   1e-66   
gb:AP003700_1832107 Oryza sativa (japonica cultivar-group) genom...   246   3e-64   
gb:CR382400_1375007 Plasmodium falciparum chromosome 6, complete...   216   2e-55   
gb:AF526199_1279300 Argopecten irradians isolate iolsaicl2ct4cn4...   214   9e-55   
sp|P48160|RL2A_DICDI|RL2A_DICDI 60S ribosomal protein L27a.>pir|JE0320|JE03...   208   5e-53   Dictyostelium discoideum
gb:AC087079_1205450 Caenorhabditis elegans cosmid Y37E3, complet...   204   7e-52   
sp|O01358|RL2A_OSCBR|RL2A_OSCBR 60S ribosomal protein L27a (Ribosomal prote...   204   1e-51   Oscheius brevesophaga
gb:AK007837_1154230 Mus musculus 10 day old male pancreas cDNA, ...   203   2e-51   
pir|S13071|R5RTLA ribosomal protein L27a, cytosolic [validated] ...   203   2e-51   
gb:AF401582_2492009 Ictalurus punctatus ribosomal protein L27a m...   202   5e-51   
pir|S55914|S55914 ribosomal protein L27a - human>gb:CR857381_118...   202   5e-51   Homo sapiens [man]
sp|P18445|RL2A_RAT|RL2A_RAT 60S ribosomal protein L27a.                        202   5e-51   Rattus norvegicus [brown rat]
gb:AY853171_1353962 Pectinaria gouldii ribosomal protein L27a mR...   201   6e-51   
gb:AB020237_2044131 Mus musculus gene for ribosomal protein L27A...   201   1e-50   
gb:AY555268_1613585 Cyanidioschyzon merolae strain 10D ribosomal...   201   1e-50   
gb:AB188277_1874297 Pan troglodytes rpl27a mRNA for ribosomal pr...   200   1e-50   
gb:AY752829_1179972 Culicoides sonorensis clone CsRPL27A ribosom...   200   1e-50   
sp|P46776|RL2A_HUMAN|RL2A_HUMAN 60S ribosomal protein L27a.>gb:BC020169_197...   200   1e-50   Homo sapiens [man]
gb:BC064441_2553860 Danio rerio zgc:77235, mRNA (cDNA clone MGC:...   199   3e-50   
gb:AE016819_1748801 Ashbya gossypii (= Eremothecium gossypii) AT...   199   3e-50   
sp|P14115|RL2A_MOUSE|RL2A_MOUSE 60S ribosomal protein L27a (L29).                199   3e-50   Mus musculus [mouse]
gb:BC066326_1987065 Homo sapiens ribosomal protein L27a, mRNA (c...   198   5e-50   
pir|S11557|R5MS27 ribosomal protein L27a - mouse>gb:MMCCL3R_2114...   198   5e-50   
gb:BC053769_2550722 Xenopus laevis ribosomal protein L27a, mRNA ...   197   9e-50   
gb:AY769297_1350448 Bombyx mori ribosomal protein L27A (RpL27A) ...   197   9e-50   
gb:XLRPL22_2583118 X.laevis rpl22 mRNA for ribosmoal protein L22.     197   2e-49   
gb:OMY312339_2577055 Oncorhynchus mykiss partial mRNA for putati...   196   2e-49   
gb:AE017342_1754902 Cryptococcus neoformans var. neoformans JEC2...   196   2e-49   
gb:MAL249749_1685565 Mortierella alpina rpl27A gene for putative...   196   2e-49   
gb:AB180411_1202429 Plutella xylostella mRNA for Ribosomal prote...   196   2e-49   
gb:CR380956_1652440 Candida glabrata strain CBS138 chromosome J ...   196   3e-49   
gb:AY260551_1313719 Branchiostoma belcheri tsingtaunese ribosoma...   196   3e-49   
gb:AY826145_1180105 Aedes albopictus clone AL_181 60S ribosomal ...   196   3e-49   
gb:CR382128_1661215 Yarrowia lipolytica chromosome B of strain C...   195   4e-49   
sp|P47830|RL2A_XENLA|RL2A_XENLA 60S ribosomal protein L27a (L22).                195   4e-49   Xenopus laevis [clawed frog]
gb:AF502247_2498389 Epinephelus coioides ribosomal protein L27a ...   195   6e-49   
gb:AF400186_1268285 Spodoptera frugiperda ribosomal protein L27A...   194   1e-48   
pir|A02782|R6BY29 ribosomal protein L27a.e, cytosolic - yeast (S...   194   1e-48   
gb:AB099492_1199257 Plutella xylostella L27A mRNA for ribosomal ...   193   2e-48   
gb:CR382126_1658654 Kluyveromyces lactis strain NRRL Y-1140 chro...   192   4e-48   
sp|P02406|RL28_YEAST|RL28_YEAST 60S ribosomal protein L28 (L27A) (L29) (YL2...   192   5e-48   Saccharomyces cerevisiae [brewer's yeast]
sp|Q00454|RL2A_TETTH|RL2A_TETTH 60S ribosomal protein L27a (L29).>pir|A5640...   191   6e-48   Tetrahymena thermophila
sp|P08978|RL28_NEUCR|RL28_NEUCR 60S ribosomal protein L28 (L27A) (L29) (CRP...   190   1e-47   
sp|P78987|RL2A_ERYGR|RL2A_ERYGR 60S ribosomal protein L27a (L29).>gb:EGH60S...   189   3e-47   
gb:AY232080_1177373 Drosophila yakuba clone yak-ad_RpL27A mRNA s...   188   5e-47   
gb:AY231794_1177087 Drosophila yakuba clone yak-em_RpL27A mRNA s...   188   5e-47   
sp|P41092|RL2A_DROME|RL2A_DROME 60S ribosomal protein L27a.>pir|JC6202|JC62...   188   5e-47   Drosophila melanogaster
pir|JC2392|JC2392 ribosomal protein L27a - fruit fly (Drosophila...   188   7e-47   Drosophila melanogaster
gb:TETRPL29B_1400063 T.thermophila rpL29 gene, complete cds.          185   6e-46   
gb:AY223204_1176667 Schistosoma japonicum clone ZZD233 mRNA sequ...   183   2e-45   
gb:AY125980_1301735 Paracentrotus lividus 60S ribosomal protein ...   182   4e-45   
gb:CR382133_1666851 Debaryomyces hansenii chromosome A of strain...   181   9e-45   
gb:AY188520_2517927 Sparus aurata putative ribosomal protein L27...   181   1e-44   
gb:U13207_1401822 Euplotes crassus large subunit ribosomal prote...   180   2e-44   
sp|P48161|RL2A_EUPCR|RL2A_EUPCR 60S ribosomal protein L27a (L29).                180   2e-44   Moneuplotes crassus
sp|P57728|R28B_SCHPO|R28B_SCHPO 60S ribosomal protein L28-B.>pir|S60001|S60...   178   7e-44   Schizosaccharomyces pombe
sp|P36585|R28A_SCHPO|R28A_SCHPO 60S ribosomal protein L28-A (L27A) (L29).>p...   177   1e-43   Schizosaccharomyces pombe
gb:EHI311622_1384479 Entamoeba histolytica rpl27a-4 gene for rib...   177   2e-43   
gb:EHI409107_1384489 Entamoeba histolytica rpl27a-1 gene for rib...   176   2e-43   
gb:BTORFCHR3_1437275 B.taurus mRNA (from chromosome 3, with unkn...   176   4e-43   
gb:EHI311621_1384478 Entamoeba histolytica rpl27a-3 gene for rib...   175   5e-43   
sp|Q27021|RL2A_TENMO|RL2A_TENMO 60S ribosomal protein L27a.>gb:TML27APR_140...   172   4e-42   Tenebrio molitor
gb:PFL305223_2577904 Platichthys flesus partial mRNA for 60S rib...   166   2e-40   
sp|O15883|RL2A_TRYBB|RL2A_TRYBB 60S ribosomal protein L27a (L29).>gb:TBU967...   166   3e-40   Trypanosoma brucei brucei
gb:HSA400879_2004888 Homo sapiens ST5 gene for suppression of tu...   154   1e-36   
pir|A99113|A99113 60S ribosomal protein L27A [imported] - Guilla...   151   1e-35   Guillardia theta
gb:A63909_1450135 Sequence 34 from Patent WO9723633.                  146   3e-34   
gb:AF051252_1764239 Picea mariana probable 60S ribosomal protein...   140   2e-32   
pir|E86263|E86263 F13K23.22 protein - Arabidopsis thaliana>gb:AE...   137   1e-31   Arabidopsis thaliana [mouse-ear cress]
sp|O62581|RL2A_ENCCU|RL2A_ENCCU 60S ribosomal protein L27a.>gb:AF054829_123...   133   2e-30   Encephalitozoon cuniculi
gb:AF031466_1234578 Entamoeba dispar ribosomal protein rpl-27 mR...   120   2e-26   
gb:AF456341_2495891 Epinephelus coioides ribosomal protein L22, ...   115   5e-25   
gb:AF051765_1764279 Picea mariana putative 60S ribosomal protein...   113   2e-24   
gb:AY650297_1958244 Macaca fascicularis ribosomal protein L27A m...   112   5e-24   
gb:AF051764_1764278 Picea mariana putative 60S ribosomal protein...   108   9e-23   
gb:AC087079_1205451 Caenorhabditis elegans cosmid Y37E3, complet...   104   1e-21   
sp|Q29333|RL2A_PIG|RL2A_PIG 60S ribosomal protein L27a (Fragment).             100   3e-20   Sus scrofa [pigs]
gb:AY829784_1180183 Lonomia obliqua ribosomal protein 26 mRNA, c...    87   2e-16   
sp|P14032|RL15_METVA|RL15_METVA 50S ribosomal protein L15P.>pir|S05626|R6MX...    80   3e-14   Methanococcus vannielii
sp|O26133|RL15_METTH|RL15_METTH 50S ribosomal protein L15P.>pir|C69131|C691...    78   1e-13   Methanothermobacter thermautotrophicus
gb:BX957222_844674 Methanococcus maripaludis S2 complete genome;...    77   2e-13   
sp|P54047|RL15_METJA|RL15_METJA 50S ribosomal protein L15P.>pir|E64359|E643...    77   2e-13   Methanocaldococcus jannaschii
gb:AF222926_1252595 Penaeus monodon ribosomal protein L27a mRNA,...    76   5e-13   
gb:AB001584_1508482 Solanum melongena mRNA for ribosomal protein...    72   1e-11   
sp|Q9YF98|RL15_AERPE|RL15_AERPE 50S ribosomal protein L15P.>pir|F72725|F727...    71   1e-11   Aeropyrum pernix
gb:BA000023_690981 Sulfolobus tokodaii str. 7 DNA, complete genome.    63   3e-09   
gb:AY240876_1592264 Saccharomyces paradoxus 60S ribosomal protei...    62   6e-09   
sp|O05643|RL15_SULAC|RL15_SULAC 50S ribosomal protein L15P.>gb:SSSPCOPER_19...    61   1e-08   Sulfolobus acidocaldarius
gb:AE009930_257538 Pyrobaculum aerophilum strain IM2 section 185...    60   3e-08   
sp|Q9UX85|RL15_SULSO|RL15_SULSO 50S ribosomal protein L15P.>pir|F90217|F902...    60   4e-08   Saccharolobus solfataricus
gb:AP006878_576671 Thermococcus kodakaraensis strain KOD1 DNA, c...    59   9e-08   
gb:AE010278_261369 Pyrococcus furiosus DSM 3638, section 153 of ...    54   3e-06   
pir|F71184|F71184 probable ribosomal protein L15 - Pyrococcus ho...    52   6e-06   Pyrococcus horikoshii
sp|Q9V1V7|RL15_PYRAB|RL15_PYRAB 50S ribosomal protein L15P.>pir|B75145|B751...    52   8e-06   Pyrococcus abyssi
sp|O59441|RL15_PYRHO|RL15_PYRHO 50S ribosomal protein L15P.                       51   1e-05   Pyrococcus horikoshii
gb:AE013454_292476 Methanosarcina mazei strain Goe1, section 236...    49   5e-05   
gb:AE010775_266455 Methanosarcina acetivorans str. C2A, section ...    48   1e-04   
gb:AY534910_626220 Uncultured marine group II euryarchaeote Deep...    48   2e-04   
sp|P47831|RL28_CANAL|RL28_CANAL 60S ribosomal protein L28 (L27A) (L29) (Fra...    48   2e-04   Candida albicans
gb:AE010303_261659 Methanopyrus kandleri AV19 section 2 of 157 o...    47   2e-04   
gb:TACID5_197003 Thermoplasma acidophilum complete genome; segme...    43   0.004   
gb:BA000011_664793 Thermoplasma volcanium GSS1 DNA, complete gen...    42   0.011   
sp|Q9X1J0|RL15_THEMA|RL15_THEMA 50S ribosomal protein L15.>pir|A72248|A7224...    40   0.032   Thermotoga maritima
sp|O67561|RL15_AQUAE|RL15_AQUAE 50S ribosomal protein L15.>pir|H70441|H7044...    39   0.054   Aquifex aeolicus
pir|S22349|R6HS15 ribosomal protein L15 [validated] - Haloarcula...    39   0.070   
pir|S22604|S22604 ribosomal protein L27a - African clawed frog (...    38   0.12    Xenopus laevis [clawed frog]
pir|H97897|H97897 50S ribosomal protein L15 [imported] - Strepto...    37   0.27    Streptococcus pneumoniae R6
sp|P12737|RL15_HALMA|RL15_HALMA 50S ribosomal protein L15P (Hmal15) (Hl9).        37   0.27    Haloarcula marismortui
pir|T51469|T51469 glycine/proline-rich protein - Arabidopsis tha...    36   0.60    Arabidopsis thaliana [mouse-ear cress]
gb:AP008231_581258 Synechococcus elongatus PCC 6301 DNA, complet...    35   0.78    
gb:AE017199_403143 Nanoarchaeum equitans Kin4-M, complete genome.      35   0.78    
gb:AE016947_364355 Enterococcus faecalis V583, section 1 of 11 o...    35   1.0     
gb:BC026876_2095612 Mus musculus DNA segment, Chr 5, Wayne State...    35   1.3     
gb:AE017261_419679 Picrophilus torridus DSM 9790, complete genome.     35   1.3     
gb:AE017180_401128 Geobacter sulfurreducens PCA, complete genome.      35   1.3     
gb:HSTITINN2_2021100 H.sapiens mRNA for titin protein (clone hsk...    34   2.3     
gb:HSA277892_2002255 Homo sapiens partial TTN gene for titin.          34   2.3     
gb:AF525413_1905988 Homo sapiens cardiac titin N2BA isoform (TTN...    34   2.3     
gb:SAG766844_169800 Streptococcus agalactiae NEM316 complete gen...    34   2.3     
pir|I38346|I38346 elastic titin - human (fragment)                     34   2.3     Homo sapiens [man]
gb:AF000196_1230471 Caenorhabditis elegans cosmid B0041, complet...    33   3.0     
gb:AF000196_1230470 Caenorhabditis elegans cosmid B0041, complet...    33   3.0     
pir|T34034|T34034 hypothetical protein B0041.2 - Caenorhabditis ...    33   3.0     Caenorhabditis elegans [roundworm]
gb:AY434474_2084940 Rattus norvegicus cardiac titin N2BA isoform...    33   5.0     
gb:AY429600_2084934 Rattus norvegicus cardiac titin fetal N2BA P...    33   5.0     
gb:AP005396_1851089 Oryza sativa (japonica cultivar-group) genom...    33   5.0     
gb:AY136513_1425655 Canis familiaris N2BA cardiac titin (TTN) mR...    33   5.0     
pir|T33997|T33997 hypothetical protein W03G1.5 - Caenorhabditis ...    33   5.0     Caenorhabditis elegans [roundworm]
sp|O78486|RR20_GUITH|RR20_GUITH Chloroplast 30S ribosomal protein S20.>gb:A...    33   5.0     Guillardia theta
gb:AY872185_2150349 Synthetic construct hypothetical protein (FT...    32   6.6     
gb:BC000556_1966828 Homo sapiens hypothetical protein FLJ20257, ...    32   6.6     
gb:AP004304_1839902 Oryza sativa (japonica cultivar-group) genom...    32   6.6     
gb:AC115598_1205798 Dictyostelium discoideum chromosome 2 map 58...    32   6.6     
pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo s...    32   6.6     Homo sapiens [man]
sp|O14686|MLL2_HUMAN|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    32   6.6     Homo sapiens [man]
gb:AP003840_1834052 Oryza sativa (japonica cultivar-group) genom...    28   7.0     
gb:BA000030_703735 Streptomyces avermitilis MA-4680 genomic DNA,...    32   8.6     


>sp|P49637|R27C_ARATH 60S ribosomal protein
           L27a-3.>pir|S71256|S71256 ribosomal protein L27a,
           cytosolic - Arabidopsis thaliana>gb:AE005173_894644
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537119 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.>gb:AC011663_1537328 Arabidopsis thaliana
           chromosome 1 BAC F5A18 genomic sequence, complete
           sequence.>gb:AT60SRL27_1542675 A.thaliana mRNA for 60S
           ribosomal protein L27a.>gb:AY039519_1560234 Arabidopsis
           thaliana At1g70600/F5A18_22 mRNA, complete
           cds.>gb:AY048228_1561690 Arabidopsis thaliana
           At1g70600/F5A18_22 mRNA, complete
           cds.>gb:AY091706_1574717 Arabidopsis thaliana
           At1g70600/F5A18_22 mRNA, complete cds.
          Length = 146

 Score =  278 bits (712), Expect = 4e-74
 Identities = 130/146 (89%), Positives = 140/146 (95%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FHKLRNKF+CPIVN+DKLWS+VP +VKAK++KD+VPLIDVTQ GFFKVLGKG LP N+P 
Sbjct: 61  FHKLRNKFFCPIVNLDKLWSLVPEDVKAKSTKDNVPLIDVTQHGFFKVLGKGHLPENKPF 120

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKL+SK AEKKIKEAGGAV+LTA
Sbjct: 121 VVKAKLISKTAEKKIKEAGGAVVLTA 146



>gb:AY085573_1570642 Arabidopsis thaliana clone 15789 mRNA, complete
           sequence.
          Length = 146

 Score =  276 bits (707), Expect = 2e-73
 Identities = 129/146 (88%), Positives = 140/146 (95%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FHKLRNKF+CPIVN+DKLWS+VP +VKAK++K++VPLIDVTQ GFFKVLGKG LP N+P 
Sbjct: 61  FHKLRNKFFCPIVNLDKLWSLVPEDVKAKSTKNNVPLIDVTQHGFFKVLGKGHLPENKPF 120

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKL+SK AEKKIKEAGGAV+LTA
Sbjct: 121 VVKAKLISKTAEKKIKEAGGAVVLTA 146



>sp|Q9LR33|R27B_ARATH 60S ribosomal protein
           L27a-2.>gb:AE005172_891279 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC005292_1532422 Genomic sequence for
           Arabidopsis thaliana BAC F26F24 from chromosome I,
           complete sequence.>gb:BT000542_1634820 Arabidopsis
           thaliana 60s ribosomal protein l27a.
           (At1g23290/F26F24_23) mRNA, complete
           cds.>gb:AF324716_1786428 Arabidopsis thaliana At1g23290
           (At1g23290/F26F24_23) mRNA, complete
           cds.>gb:AF349525_1790211 Arabidopsis thaliana putative
           60s ribosomal protein l27a (At1g23290) mRNA, complete
           cds.>gb:AF410280_1797094 Arabidopsis thaliana
           At1g23290/F26F24_23 mRNA, complete cds.
          Length = 146

 Score =  273 bits (698), Expect = 2e-72
 Identities = 128/146 (87%), Positives = 137/146 (93%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MATALKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FHKLRNKF+CPIVN+DKLWS+VP +VKAK+SKD+VPLIDVTQ GFFKVLGKG LP N+P 
Sbjct: 61  FHKLRNKFFCPIVNLDKLWSLVPEDVKAKSSKDNVPLIDVTQHGFFKVLGKGHLPENKPF 120

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKL+SK AEKKIKEAGGAV+LTA
Sbjct: 121 VVKAKLISKTAEKKIKEAGGAVVLTA 146



>gb:AF088913_1767278 Petunia x hybrida ribosomal protein L27a mRNA,
           complete cds.
          Length = 150

 Score =  268 bits (684), Expect = 7e-71
 Identities = 129/150 (86%), Positives = 135/150 (90%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK----ASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHKLRNKFYCP VN+DKLWS+VP +VK K     +K   PLIDVTQ G+FKVLGKGVLP 
Sbjct: 61  FHKLRNKFYCPTVNIDKLWSLVPQDVKDKVAAGGAKGTAPLIDVTQYGYFKVLGKGVLPE 120

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           NQ VVVKAKLVSK AEKKIKEAGGAV+LTA
Sbjct: 121 NQAVVVKAKLVSKNAEKKIKEAGGAVVLTA 150



>gb:AB042856_1519951 Panax ginseng mRNA for 60S ribosomal protein
           L27a, complete cds.
          Length = 146

 Score =  268 bits (684), Expect = 7e-71
 Identities = 123/146 (84%), Positives = 134/146 (91%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKN KKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNXKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FH+LRNKFYCP+VN+DKLWS++P E K KA   + P+IDVTQ G+FKVLGKG LPS+ P+
Sbjct: 61  FHRLRNKFYCPVVNIDKLWSLLPQEAKEKADAQNAPVIDVTQHGYFKVLGKGFLPSSHPI 120

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKLVSK AEKKIKEAGGAV+LTA
Sbjct: 121 VVKAKLVSKTAEKKIKEAGGAVVLTA 146



>gb:AC135559_1742521 Oryza sativa chromosome 3 BAC OSJNBa0030J19
           genomic sequence, complete sequence.
          Length = 146

 Score =  256 bits (654), Expect = 2e-67
 Identities = 118/146 (80%), Positives = 131/146 (89%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FHKL N+F+CP VNV++LWSMVP +  A+A     P+IDVTQ G+ KVLGKG+LP  +P+
Sbjct: 61  FHKLSNRFHCPAVNVERLWSMVPTDKAAEAGAGKAPVIDVTQFGYTKVLGKGMLPPQRPI 120

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKL+SK+AEKKIK AGGAVLLTA
Sbjct: 121 VVKAKLISKVAEKKIKAAGGAVLLTA 146



>gb:AP003992_1836049 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_E05.
          Length = 144

 Score =  253 bits (647), Expect = 1e-66
 Identities = 119/146 (81%), Positives = 131/146 (89%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FH+L N+F+CP VNV++LWSMVP E  A A K   P+IDVTQ G+ KVLGKG+LP  +P+
Sbjct: 61  FHRLSNRFHCPAVNVERLWSMVPAEAGAGAGK--APVIDVTQFGYTKVLGKGMLPPERPI 118

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VVKAKL+SK+AEKKIK AGGAVLLTA
Sbjct: 119 VVKAKLISKVAEKKIKAAGGAVLLTA 144



>gb:AP003700_1832107 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1003_H02.>gb:AP005198_1849309 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0616D06.
          Length = 146

 Score =  246 bits (627), Expect = 3e-64
 Identities = 117/147 (79%), Positives = 131/147 (89%), Gaps = 1/147 (0%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTT  +KNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
Sbjct: 1   MTTSLRKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKAS-KDDVPLIDVTQLGFFKVLGKGVLPSNQP 390
           FH+LRNKFY P VNV++LWSMVP E  A+A+     PL+DVTQ G+FKVLGKG+LP  +P
Sbjct: 61  FHRLRNKFYSPAVNVERLWSMVPAEQAAEAAGAGKAPLLDVTQFGYFKVLGKGLLP-EKP 119

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VVKAKL+SK+AEKKIK AGGAV+LTA
Sbjct: 120 IVVKAKLISKVAEKKIKAAGGAVVLTA 146



>gb:CR382400_1375007 Plasmodium falciparum chromosome 6, complete
           sequence; segment 3/5.
          Length = 148

 Score =  216 bits (551), Expect = 2e-55
 Identities = 101/148 (68%), Positives = 118/148 (79%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRFKKNRKKRGHVSAGHGR+GKHRKHPGGRG AGG+HH RI FDKYHPGYFGKVGMR+
Sbjct: 1   MATRFKKNRKKRGHVSAGHGRVGKHRKHPGGRGKAGGLHHMRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKAS--KDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
            + L+N+ YCP +NVDKLW ++P E K + S  KD  P+IDVT+ G+FKVLG G L  NQ
Sbjct: 61  LNLLKNRTYCPTINVDKLWGLLPEEKKKEFSENKDIAPVIDVTRKGYFKVLGNGKLKHNQ 120

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           P+VVKA+  S +AEKKIK  GG  +L A
Sbjct: 121 PIVVKARYFSSVAEKKIKAVGGQCILVA 148



>gb:AF526199_1279300 Argopecten irradians isolate iolsaicl2ct4cn4
           ribosomal protein L22 mRNA, partial cds.
          Length = 152

 Score =  214 bits (545), Expect = 9e-55
 Identities = 101/146 (69%), Positives = 118/146 (80%), Gaps = 2/146 (1%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           T+ KK RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI FDKYHPGYFGKVGMRY+H
Sbjct: 8   TKLKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINFDKYHPGYFGKVGMRYYH 67

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVKAK--ASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           K +NKF+CP VN+DKLWS+V  + + K  +SKD  P+IDV + G++KVLGKG LP  QPV
Sbjct: 68  KTQNKFFCPTVNLDKLWSLVSDQTREKYASSKDKAPVIDVVRAGYYKVLGKGHLP-KQPV 126

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VKA+  S+ AE KIK AGGA +L A
Sbjct: 127 IVKARFFSRSAELKIKAAGGACVLVA 152



>sp|P48160|RL2A_DICDI 60S ribosomal protein L27a.>pir|JE0320|JE0320
           ribosomal protein Ddl27a - slime mold (Dictyostelium
           discoideum)>gb:D50338_1376164 Dictyostelium discoideum
           DNA for ribosomal protein, complete cds.
          Length = 148

 Score =  208 bits (530), Expect = 5e-53
 Identities = 97/149 (65%), Positives = 124/149 (83%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF K+RK RG V AG+GR+GKHRKHPGGRGNAGG+ HHRI FDKYHPGYFGK+GMR+
Sbjct: 1   MPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEV-KAKASKDD--VPLIDVTQLGFFKVLGKGVLPSN 384
           FH LRN+++CP V+++K+W++VP  V K+ A+K+D   P++DVTQ GFFKVLG G+LP+ 
Sbjct: 61  FHLLRNQYHCPTVSLEKIWTLVPESVRKSLAAKNDGTAPVVDVTQKGFFKVLGHGILPT- 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QP++VKA+  SK+AEKKIK  GGA +L A
Sbjct: 120 QPIIVKARYFSKVAEKKIKAVGGACILVA 148



>gb:AC087079_1205450 Caenorhabditis elegans cosmid Y37E3, complete
           sequence.
          Length = 145

 Score =  204 bits (520), Expect = 7e-52
 Identities = 97/146 (66%), Positives = 115/146 (78%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M    +K RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGKVGMR 
Sbjct: 1   MAHALRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINRDKYHPGYFGKVGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FH  +N+ YCP VNV++LWS+VP EV+ KA+    P+ID T+LG+FKVLGKG+LP   P+
Sbjct: 61  FHLNKNQHYCPTVNVERLWSLVPQEVRDKATGGKSPVIDCTKLGYFKVLGKGLLPET-PL 119

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VKA+  S  AE+KIK+AGGA +L A
Sbjct: 120 IVKARFFSHEAEQKIKKAGGACVLVA 145



>sp|O01358|RL2A_OSCBR 60S ribosomal protein L27a (Ribosomal protein
           RPL-27).>pir|T10266|T10266 ribosomal protein L27 -
           Oscheius brevesophaga>gb:OBU90830_1391041 Oscheius
           brevesophaga ribosomal protein rpl-27 and ribosomal
           protein rpl-21 genes, complete cds.
          Length = 145

 Score =  204 bits (519), Expect = 1e-51
 Identities = 97/146 (66%), Positives = 110/146 (75%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M    +K RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGKVGMR 
Sbjct: 1   MAHSLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGQHHHRINRDKYHPGYFGKVGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FH  +N  YCP VNVD+LW++VP E K K S +  P+ID  + G+FKVLGKG+LP  QP+
Sbjct: 61  FHLNKNHHYCPTVNVDRLWALVPEEQKTKVSAEKAPVIDCVKAGYFKVLGKGLLP-KQPL 119

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VKAK  S  AE KIK AGGA +L A
Sbjct: 120 IVKAKFFSHEAENKIKAAGGACILVA 145



>gb:AK007837_1154230 Mus musculus 10 day old male pancreas cDNA,
           RIKEN full-length enriched library, clone:1810049C01
           product:ribosomal protein L27a, full insert
           sequence.>gb:AK008531_1154632 Mus musculus adult male
           small intestine cDNA, RIKEN full-length enriched
           library, clone:2010305L10 product:ribosomal protein
           L27a, full insert sequence.>gb:AK010286_1155649 Mus
           musculus ES cells cDNA, RIKEN full-length enriched
           library, clone:2400004P05 product:ribosomal protein
           L27a, full insert sequence.>gb:BC056958_2102494 Mus
           musculus ribosomal protein L27a, mRNA (cDNA clone
           MGC:66730 IMAGE:6817520), complete
           cds.>gb:BC081430_2107907 Mus musculus ribosomal protein
           L27a, mRNA (cDNA clone MGC:101958 IMAGE:6411497),
           complete cds.>gb:BC086939_2109864 Mus musculus ribosomal
           protein L27a, mRNA (cDNA clone MGC:107695
           IMAGE:6760797), complete cds.>gb:MMU307670_2120686 Mus
           musculus St5 gene, L27a gene and Kiaa0298 gene.
          Length = 148

 Score =  203 bits (517), Expect = 2e-51
 Identities = 96/149 (64%), Positives = 117/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148



>pir|S13071|R5RTLA ribosomal protein L27a, cytosolic [validated] -
           rat>gb:RRRPL27A_2138204 Rat mRNA for ribosomal protein
           L27a.
          Length = 148

 Score =  203 bits (517), Expect = 2e-51
 Identities = 96/149 (64%), Positives = 117/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148



>gb:AF401582_2492009 Ictalurus punctatus ribosomal protein L27a
           mRNA, complete cds.
          Length = 148

 Score =  202 bits (513), Expect = 5e-51
 Identities = 98/149 (65%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TR  K RK RGHVS GHGR+GKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPTRTSKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK-ASKDD--VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN  +CP +N+DKLW++V  + +   A K D   P+IDV + G+FKVLGKG LP  
Sbjct: 61  YHLKRNTIFCPTINLDKLWTLVSEQTRLNHAQKPDGPAPIIDVVRAGYFKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIKEAG   +LTA
Sbjct: 120 QPVIVKAKFFSRRAEEKIKEAGRTGVLTA 148



>pir|S55914|S55914 ribosomal protein L27a -
           human>gb:CR857381_1181623 Pongo pygmaeus mRNA; cDNA
           DKFZp468N1916 (from clone
           DKFZp468N1916).>gb:AB020236_1865206 Homo sapiens gene
           for ribosomal protein L27A, complete
           cds.>gb:BC005326_1969775 Homo sapiens ribosomal protein
           L27a, mRNA (cDNA clone MGC:12412 IMAGE:4052417),
           complete cds.>gb:HSU14968_2022406 Human ribosomal
           protein L27a mRNA, complete cds.
          Length = 148

 Score =  202 bits (513), Expect = 5e-51
 Identities = 94/149 (63%), Positives = 117/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKSVGGACVLVA 148



>sp|P18445|RL2A_RAT 60S ribosomal protein L27a.
          Length = 147

 Score =  202 bits (513), Expect = 5e-51
 Identities = 95/147 (64%), Positives = 116/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H
Sbjct: 2   SRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYH 61

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSNQP 390
             RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  QP
Sbjct: 62  LKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLP-KQP 120

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           V+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 121 VIVKAKFFSRRAEEKIKGVGGACVLVA 147



>gb:AY853171_1353962 Pectinaria gouldii ribosomal protein L27a mRNA,
           complete cds.
          Length = 147

 Score =  201 bits (512), Expect = 6e-51
 Identities = 95/142 (66%), Positives = 113/142 (79%), Gaps = 1/142 (0%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGR+GKHRKHPGGRGNAGGMHHHRI +DKYHPGYFGKVGMR+FH  +
Sbjct: 7   KKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGGMHHHRINYDKYHPGYFGKVGMRHFHMTK 66

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKDD-VPLIDVTQLGFFKVLGKGVLPSNQPVVVKA 405
            K+YCP +NVDKLW++V  +V+  A  +  VP+I+    G +KVLGKG+LP  QPV+VKA
Sbjct: 67  QKYYCPTINVDKLWTLVSEKVRDDAKNNQKVPVINCLNGGVYKVLGKGLLP-KQPVIVKA 125

Query: 406 KLVSKIAEKKIKEAGGAVLLTA 471
           K  SK AEKKIK+ GGA +L A
Sbjct: 126 KFFSKQAEKKIKDVGGACVLIA 147



>gb:AB020237_2044131 Mus musculus gene for ribosomal protein L27A,
           complete cds.
          Length = 148

 Score =  201 bits (510), Expect = 1e-50
 Identities = 95/149 (63%), Positives = 116/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DK W++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148



>gb:AY555268_1613585 Cyanidioschyzon merolae strain 10D ribosomal
           protein L29 (Rpl29) gene, complete cds.
          Length = 151

 Score =  201 bits (510), Expect = 1e-50
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 6/152 (3%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHP--GGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M TRFKKNRKKRGHVSAGHGRIGKHRK    GGRG AGGMHHHR L DKYHPGYFGKVGM
Sbjct: 1   MATRFKKNRKKRGHVSAGHGRIGKHRKGGARGGRGMAGGMHHHRTLLDKYHPGYFGKVGM 60

Query: 208 RYFH--KLRNKFYCPIVNVDKLWSMVPPEVKAK--ASKDDVPLIDVTQLGFFKVLGKGVL 375
           RYF+    +N  Y P +N+DKLW+++PP  K K  ++K+  P++DVT+ GFFKVLG+G L
Sbjct: 61  RYFNAGADKNAKYTPCINIDKLWTLIPPAEKEKYASNKEAAPVLDVTRAGFFKVLGRGHL 120

Query: 376 PSNQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           P  QP++VKAK  SK AEK+IK AGG  +LTA
Sbjct: 121 P-KQPLIVKAKYFSKTAEKRIKAAGGVCVLTA 151



>gb:AB188277_1874297 Pan troglodytes rpl27a mRNA for ribosomal
           protein L27a, complete cds.
          Length = 148

 Score =  200 bits (509), Expect = 1e-50
 Identities = 93/147 (63%), Positives = 116/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDV---PLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           QPV+VKAK  S+ AE+KIK  GGA +L
Sbjct: 120 QPVIVKAKFFSRRAEEKIKSVGGACVL 146



>gb:AY752829_1179972 Culicoides sonorensis clone CsRPL27A ribosomal
           protein L27A mRNA, partial cds.
          Length = 144

 Score =  200 bits (509), Expect = 1e-50
 Identities = 96/143 (67%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 3   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLNR 62

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKD--DVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
           N  +CP +N+DKLWS+V  E + + +KD   VP++D+ Q G++K+LG G LP  QP++VK
Sbjct: 63  NHQFCPTINLDKLWSLVGEEKRLECAKDPKKVPVVDIVQFGYYKLLGHGHLP-KQPIIVK 121

Query: 403 AKLVSKIAEKKIKEAGGAVLLTA 471
           AK VS  AE KIK AGGA +L A
Sbjct: 122 AKYVSHKAENKIKAAGGACVLRA 144



>sp|P46776|RL2A_HUMAN 60S ribosomal protein
           L27a.>gb:BC020169_1976966 Homo sapiens, clone
           IMAGE:3543815, mRNA, partial cds.
          Length = 147

 Score =  200 bits (509), Expect = 1e-50
 Identities = 93/147 (63%), Positives = 116/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGM+++H
Sbjct: 2   SRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYH 61

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSNQP 390
             RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG LP  QP
Sbjct: 62  LKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLP-KQP 120

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           V+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 121 VIVKAKFFSRRAEEKIKSVGGACVLVA 147



>gb:BC064441_2553860 Danio rerio zgc:77235, mRNA (cDNA clone
           MGC:77235 IMAGE:6963142), complete cds.
          Length = 148

 Score =  199 bits (506), Expect = 3e-50
 Identities = 94/149 (63%), Positives = 114/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T+  K RK RGHVS GHGR+GKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPTKKSKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASK---DDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN  +CP +N+DKLW++V  + +   S+      P+IDV + G+FKVLGKG LP  
Sbjct: 61  YHLKRNTTFCPTINLDKLWTLVSEQTRVNYSQKPDGPAPIIDVVRAGYFKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +LTA
Sbjct: 120 QPVIVKAKFFSRRAEEKIKGVGGACVLTA 148



>gb:AE016819_1748801 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 149

 Score =  199 bits (506), Expect = 3e-50
 Identities = 97/150 (64%), Positives = 114/150 (76%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TR  K RK RGHVSAG GRIGKHRKHPGGRG AGGMHHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTRLTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGMHHHRTNLDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK----AKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK +N F+ P++N+DKLW++VP E +    + ASK   P+ID    G+ KVLGKG +P 
Sbjct: 61  FHKQKNHFWRPVLNLDKLWTLVPEEKREQYLSSASKSAAPVIDTLAAGYGKVLGKGRIP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           N PV+VKA+ VSK+AE+KIK AGG + L A
Sbjct: 120 NVPVIVKARFVSKLAEEKIKAAGGVIELIA 149



>sp|P14115|RL2A_MOUSE 60S ribosomal protein L27a (L29).
          Length = 147

 Score =  199 bits (506), Expect = 3e-50
 Identities = 94/147 (63%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H
Sbjct: 2   SRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYH 61

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSNQP 390
             RN+ +CP VN+DK W++V  + +  A+K+     P+IDV + G++KVLGKG LP  QP
Sbjct: 62  LKRNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLP-KQP 120

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           V+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 121 VIVKAKFFSRRAEEKIKGVGGACVLVA 147



>gb:BC066326_1987065 Homo sapiens ribosomal protein L27a, mRNA (cDNA
           clone MGC:87238 IMAGE:5311530), complete cds.
          Length = 148

 Score =  198 bits (504), Expect = 5e-50
 Identities = 93/149 (62%), Positives = 118/149 (79%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           ++  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLGKG L + 
Sbjct: 61  YNLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKL-AK 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAKL S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKLFSRRAEEKIKSVGGACVLVA 148



>pir|S11557|R5MS27 ribosomal protein L27a - mouse>gb:MMCCL3R_2114442
           Murine mRNA with homology to yeast L29 ribosomal protein
           gene.
          Length = 148

 Score =  198 bits (504), Expect = 5e-50
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHP GRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPSGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN+ +CP VN+DK W++V  + +  A+K+     P+IDV + G++KVLGKG LP  
Sbjct: 61  YHLKRNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVVRSGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148



>gb:BC053769_2550722 Xenopus laevis ribosomal protein L27a, mRNA
           (cDNA clone MGC:64291 IMAGE:6874361), complete cds.
          Length = 148

 Score =  197 bits (502), Expect = 9e-50
 Identities = 92/149 (61%), Positives = 114/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M ++ +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSKLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H  +N+ +CP +N+DKLW++V  + +   AK  +   P+ID    G++KVLGKG LP  
Sbjct: 61  YHLKKNQSFCPTINLDKLWTLVSEQTRLNHAKNLEGPAPIIDAVHAGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRKAEEKIKSVGGACVLVA 148



>gb:AY769297_1350448 Bombyx mori ribosomal protein L27A (RpL27A)
           mRNA, complete cds.
          Length = 148

 Score =  197 bits (502), Expect = 9e-50
 Identities = 96/149 (64%), Positives = 117/149 (78%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  KK RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MATSKKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGEHHHRINMDKYHPGYFGKLGMRN 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK-ASKDD--VPLIDVTQLGFFKVLGKGVLPSN 384
           FH  +NK +CP++N+DKLW++V  + + K AS  D  VP+I++ + G++K+LGKG LP  
Sbjct: 61  FHFRKNKNFCPVLNLDKLWTLVSEQTRLKYASAPDGKVPVINIVKAGYYKLLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  SK AEKKIK+ GGA +L+A
Sbjct: 120 QPVIVKAKFFSKSAEKKIKDVGGACVLSA 148



>gb:XLRPL22_2583118 X.laevis rpl22 mRNA for ribosmoal protein L22.
          Length = 148

 Score =  197 bits (500), Expect = 2e-49
 Identities = 92/149 (61%), Positives = 114/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M ++ +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPSKLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H  +N+ +CP +N+DKLW++V  + +   AK  +   P+ID    G++KVLGKG LP  
Sbjct: 61  YHLKKNQSFCPTINLDKLWTLVSEQTRLNHAKNLEGPAPIIDAVHAGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRKAEEKIKSVGGACVLGA 148



>gb:OMY312339_2577055 Oncorhynchus mykiss partial mRNA for putative
           ribosomal protein L27A protein.
          Length = 144

 Score =  196 bits (499), Expect = 2e-49
 Identities = 94/143 (65%), Positives = 110/143 (76%), Gaps = 3/143 (2%)
 Frame = +1

Query: 52  KNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRN 231
           K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H  RN
Sbjct: 3   KTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRN 62

Query: 232 KFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
             +CP VN+DKLW++V  + +   AK  +   P+ID  + G+FKVLGKG LP  QPV+VK
Sbjct: 63  TVHCPTVNLDKLWTLVSEQTRLNYAKKPEGPAPIIDAVRAGYFKVLGKGKLP-KQPVIVK 121

Query: 403 AKLVSKIAEKKIKEAGGAVLLTA 471
           AK  S+ AE+KIK  GGA +L A
Sbjct: 122 AKFFSRRAEEKIKAVGGACVLMA 144



>gb:AE017342_1754902 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 142

 Score =  196 bits (499), Expect = 2e-49
 Identities = 95/146 (65%), Positives = 113/146 (77%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF   RK RGHVSAGHGRIGKHRKHPGGRG AGG HHHR  FDKYHPGYFGKVGMR+
Sbjct: 1   MPTRFSNTRKHRGHVSAGHGRIGKHRKHPGGRGLAGGQHHHRTNFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           +H L+N +Y P +N+DKL S+  PE K  A + +VP+ID+  LG FK+LGKG +  N+P 
Sbjct: 61  YHLLKNHYYRPTINLDKLISL--PEAKVDAPEGNVPVIDLVHLGKFKLLGKGRI--NKPF 116

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VK + VSK+AE+KIKEAGG V L A
Sbjct: 117 IVKTRFVSKLAEEKIKEAGGVVKLVA 142



>gb:MAL249749_1685565 Mortierella alpina rpl27A gene for putative
           60S ribosomal protein L27A, exons 1-3.
          Length = 147

 Score =  196 bits (499), Expect = 2e-49
 Identities = 97/148 (65%), Positives = 112/148 (75%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TR   NRKKRGHVSAGHGR+GKHRKHPGGRG AGG HHHRI  DKYHPGYFGKVGMR 
Sbjct: 1   MPTRLHHNRKKRGHVSAGHGRVGKHRKHPGGRGLAGGQHHHRINMDKYHPGYFGKVGMRR 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD--VPLIDVTQLGFFKVLGKGVLPSNQ 387
           FH  RN  +CPIVN+D LWS+V  + +  A+K+   VP+ID  + G+ KVL KG LP  Q
Sbjct: 61  FHLTRNGQHCPIVNLDTLWSLVSEQTRKNAAKNTEVVPVIDTLRAGYGKVLAKGRLP-EQ 119

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           PV+VKA+ VS+ AE+KIK  GGAV L A
Sbjct: 120 PVIVKARYVSRAAEQKIKAVGGAVQLVA 147



>gb:AB180411_1202429 Plutella xylostella mRNA for Ribosomal protein
           L27A2, complete cds.
          Length = 148

 Score =  196 bits (499), Expect = 2e-49
 Identities = 93/149 (62%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  KK RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MATSKKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGEHHHRINMDKYHPGYFGKLGMRN 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           FH  +NK +CP++N+DKLW++V  + +   A A+   VP+I++ + G++K+LGKG LP  
Sbjct: 61  FHLRKNKEFCPVLNLDKLWTLVSEQSRLRYANATDGKVPVINIVKAGYYKLLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  SK AEKKIK+ GG  +L+A
Sbjct: 120 QPVIVKAKFFSKTAEKKIKDVGGVCVLSA 148



>gb:CR380956_1652440 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 149

 Score =  196 bits (498), Expect = 3e-49
 Identities = 96/150 (64%), Positives = 112/150 (74%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF K RK RGHVSAG GRIGKHRKHPGGRG AGG HHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVP----PEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK +N F+ P++N+DKLW+++P     E    +SK   P+ID    G+ KVLGKG +P 
Sbjct: 61  FHKQQNHFWRPVLNLDKLWTLIPEDKRDEYLKSSSKSAAPVIDTLAAGYGKVLGKGRIP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           N PV+VKA+ VSK+AE+KIK AGG V L A
Sbjct: 120 NVPVIVKARFVSKLAEEKIKAAGGVVELIA 149



>gb:AY260551_1313719 Branchiostoma belcheri tsingtaunese ribosomal
           protein L27a mRNA, complete cds.
          Length = 147

 Score =  196 bits (498), Expect = 3e-49
 Identities = 96/148 (64%), Positives = 114/148 (77%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MT + KK RK RGHVS G GRIGKHRKHPGGRGNAGG HHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MTAKLKKTRKLRGHVSHGKGRIGKHRKHPGGRGNAGGQHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK-AKASKDDV-PLIDVTQLGFFKVLGKGVLPSNQ 387
            H  RN+ +CP VN+DKLW++V  + +   A K DV P+IDV + G++KV+GKG LP  Q
Sbjct: 61  LHMKRNQKHCPAVNLDKLWTLVSDQTRDVYAKKTDVAPVIDVVRAGYYKVIGKGRLP-KQ 119

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           PV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 PVIVKAKFFSRRAEEKIKGVGGACILVA 147



>gb:AY826145_1180105 Aedes albopictus clone AL_181 60S ribosomal
           protein L27a mRNA, complete cds.
          Length = 149

 Score =  196 bits (497), Expect = 3e-49
 Identities = 93/143 (65%), Positives = 110/143 (76%), Gaps = 2/143 (1%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 8   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLNR 67

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKDD--VPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
           N  YCP +N+ KLWS+V  + + +  KD   VP++D+ + G+FK+LG G +P  QP++VK
Sbjct: 68  NHKYCPTINLTKLWSLVGEDKRIECKKDQTKVPVVDLVKFGYFKLLGTGHIP-KQPIIVK 126

Query: 403 AKLVSKIAEKKIKEAGGAVLLTA 471
           AK  S+ AE KIK AGGA +L A
Sbjct: 127 AKFFSRKAENKIKMAGGACILRA 149



>gb:CR382128_1661215 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 149

 Score =  195 bits (496), Expect = 4e-49
 Identities = 99/150 (66%), Positives = 112/150 (74%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF K RK RGHVSAG+GRIGKHRK PGGRG AGG HHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTRFSKTRKHRGHVSAGYGRIGKHRKSPGGRGMAGGQHHHRTNMDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK----ASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK  N F+ P+VNV+ LW++VP E + K    AS+   P+ID    G+ KVLGKG LP 
Sbjct: 61  FHKQPNHFWKPVVNVENLWALVPAENRDKYLSSASESAAPVIDTLAHGYGKVLGKGKLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           N PV+VKA+ VS+IAEKKIK AGG V L A
Sbjct: 120 NVPVIVKARFVSEIAEKKIKAAGGVVELIA 149



>sp|P47830|RL2A_XENLA 60S ribosomal protein L27a (L22).
          Length = 147

 Score =  195 bits (496), Expect = 4e-49
 Identities = 91/147 (61%), Positives = 113/147 (76%), Gaps = 3/147 (2%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           ++ +K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H
Sbjct: 2   SKLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYH 61

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSNQP 390
             +N+ +CP +N+DKLW++V  + +   AK  +   P+ID    G++KVLGKG LP  QP
Sbjct: 62  LKKNQSFCPTINLDKLWTLVSEQTRLNHAKNLEGPAPIIDAVHAGYYKVLGKGKLP-KQP 120

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           V+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 121 VIVKAKFFSRKAEEKIKSVGGACVLGA 147



>gb:AF502247_2498389 Epinephelus coioides ribosomal protein L27a
           mRNA, complete cds.
          Length = 148

 Score =  195 bits (495), Expect = 6e-49
 Identities = 93/149 (62%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T+  K RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR+
Sbjct: 1   MPTKKTKTRKVRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN  +CP +N+DKLW++V  + +    K      P+ID  + G++KVLGKG LP  
Sbjct: 61  YHLKRNTAHCPTINLDKLWTLVSEQTRLNYGKKPDGPAPIIDAVRAGYYKVLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 120 QPVIVKAKFFSRRAEEKIKAVGGACVLMA 148



>gb:AF400186_1268285 Spodoptera frugiperda ribosomal protein L27A
           mRNA, complete cds.
          Length = 148

 Score =  194 bits (493), Expect = 1e-48
 Identities = 92/149 (61%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  KK RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MATSKKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGEHHHRINMDKYHPGYFGKLGMRN 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK---ASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H+ +NK + P++N+DKLW++V  + + K   A+   VP+I++ + G++K+LGKG LP  
Sbjct: 61  YHERKNKLFNPVLNLDKLWTLVSEQARLKYATATDGKVPVINIVKAGYYKLLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           QPV+VKAK  SK AEKKIK  GGA +L+A
Sbjct: 120 QPVIVKAKFFSKTAEKKIKAVGGACVLSA 148



>pir|A02782|R6BY29 ribosomal protein L27a.e, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SCCYH2_1707466 Yeast CYH2
           gene for ribosomal protein L29.>gb:SCYGL103W_1712025
           S.cerevisiae chromosome VII reading frame ORF
           YGL103w.>gb:CVU30497_2152036 Cloning vector pAS2-1,
           complete sequence.
          Length = 149

 Score =  194 bits (493), Expect = 1e-48
 Identities = 93/150 (62%), Positives = 114/150 (76%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +RF K RK RGHVSAG GRIGKHRKHPGGRG AGG HHHRI  DKYHPGYFGKVGMRY
Sbjct: 1   MPSRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRINMDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK----AKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK +  F+ P++N+DKLW+++P + +      ASK+  P+ID    G+ K+LGKG +P 
Sbjct: 61  FHKQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           N PV+VKA+ VSK+AE+KI+ AGG V L A
Sbjct: 120 NVPVIVKARFVSKLAEEKIRAAGGVVELIA 149



>gb:AB099492_1199257 Plutella xylostella L27A mRNA for ribosomal
           protein L27A, complete cds.
          Length = 148

 Score =  193 bits (490), Expect = 2e-48
 Identities = 92/149 (61%), Positives = 114/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  KK RK RGHVS GHGRIGKHRKHPGGRGNAGG HHHRI  DKYHPGYFGK+GMR 
Sbjct: 1   MATSKKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGEHHHRINMDKYHPGYFGKLGMRN 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           FH  +NK +CP++N+DKLW++V  + +   A A+   VP+I++ + G++K+LGKG LP  
Sbjct: 61  FHLRKNKEFCPVLNLDKLWTLVSEQSRLRYANATDGKVPVINIVKAGYYKLLGKGKLP-K 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           Q V+VKAK  SK AEKKIK+ GG  +L+A
Sbjct: 120 QRVIVKAKFFSKTAEKKIKDVGGVCVLSA 148



>gb:CR382126_1658654 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.>gb:AF493565_1805017 Kluyveromyces lactis
           hypothetical protein, YGL104C, YGL102C-like protein, and
           RPL28 genes, complete cds.
          Length = 149

 Score =  192 bits (488), Expect = 4e-48
 Identities = 94/150 (62%), Positives = 113/150 (75%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TR  K RK RGHVSAG GR+GKHRKHPGGRG AGG+HHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTRLTKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGLHHHRTNLDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK----ASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK +  F+ P++N+DKLW++VP E + +    ASK   P+ID    G+ KVLGKG +P 
Sbjct: 61  FHKQQAHFWKPVLNLDKLWTLVPEEKREEYLKSASKSAAPVIDTLAAGYGKVLGKGRIP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           + PV+VKA+ VSK+AE+KIK AGG V L A
Sbjct: 120 DVPVIVKARFVSKLAEEKIKAAGGVVELIA 149



>sp|P02406|RL28_YEAST 60S ribosomal protein L28 (L27A) (L29) (YL24)
           (RP62).
          Length = 148

 Score =  192 bits (487), Expect = 5e-48
 Identities = 92/148 (62%), Positives = 113/148 (76%), Gaps = 4/148 (2%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +RF K RK RGHVSAG GRIGKHRKHPGGRG AGG HHHRI  DKYHPGYFGKVGMRYFH
Sbjct: 2   SRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGEHHHRINMDKYHPGYFGKVGMRYFH 61

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVK----AKASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           K +  F+ P++N+DKLW+++P + +      ASK+  P+ID    G+ K+LGKG +P N 
Sbjct: 62  KQQAHFWKPVLNLDKLWTLIPEDKRDQYLKSASKETAPVIDTLAAGYGKILGKGRIP-NV 120

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           PV+VKA+ VSK+AE+KI+ AGG V L A
Sbjct: 121 PVIVKARFVSKLAEEKIRAAGGVVELIA 148



>sp|Q00454|RL2A_TETTH 60S ribosomal protein L27a
           (L29).>pir|A56403|A56403 ribosomal protein L27a.e -
           Tetrahymena thermophila>gb:TETRPL29A_1400062
           T.thermophila rpL29 mRNA, complete cds.
          Length = 149

 Score =  191 bits (486), Expect = 6e-48
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHP--GGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M +  KK RK RGHVS GHGR+GKHRK    GGRG AGGMHHHRIL +K+HPGY+GK+GM
Sbjct: 1   MVSHLKKTRKLRGHVSHGHGRVGKHRKGGCRGGRGKAGGMHHHRILMEKWHPGYYGKLGM 60

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKD--DVPLIDVTQLGFFKVLGKGVLPS 381
           R FH  +N  +CP+VN+DKLWS+V    + K ++D   VP+IDVT+ GFFKVLGKG LP 
Sbjct: 61  RTFHLKKNPLHCPVVNIDKLWSLVSDATRQKYAEDKKKVPVIDVTKAGFFKVLGKGRLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           NQPVVVKAK  SK AE++I   GGA +LTA
Sbjct: 120 NQPVVVKAKYFSKTAERRIVAVGGACVLTA 149



>sp|P08978|RL28_NEUCR 60S ribosomal protein L28 (L27A) (L29)
           (CRP1).>pir|S01744|R6NC7A ribosomal protein L27a.e -
           Neurospora crassa>gb:NC99H12_1688832 Neurospora crassa
           DNA linkage group V Cosmid contig
           99H12.>gb:NCCRP1G_1690499 Neurospora crassa crp-1 gene
           for ribosomal protein homologous to yeast cyH2 gene
           encoding L29.>gb:NCCRP1R_1690500 Neurospora crassa crp-1
           mRNA for ribosomal protein homologous to yeast cyH2 gene
           encoding L29.
          Length = 149

 Score =  190 bits (483), Expect = 1e-47
 Identities = 92/150 (61%), Positives = 112/150 (74%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF K RK RGHVSAG GR+GKHRKHPGGRG AGG HHHR   DKYHPGYFGKVGMR+
Sbjct: 1   MPTRFSKTRKHRGHVSAGKGRVGKHRKHPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK----ASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FH LRN  + PI+N++KLW++VP E + K    A+ +  P+ID+   G+ K+LGKG LP 
Sbjct: 61  FHLLRNHQWAPILNIEKLWTLVPAEAREKYVSGAATETAPVIDLLSHGYAKLLGKGRLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
             P+VV+A+ VS  AE+KIKEAGG + L A
Sbjct: 120 QVPIVVRARYVSAEAERKIKEAGGVIELVA 149



>sp|P78987|RL2A_ERYGR 60S ribosomal protein L27a
           (L29).>gb:EGH60SL29_1676432 Blumeria graminis f. sp.
           hordei mRNA for 60S ribosomal protein L29.
          Length = 149

 Score =  189 bits (480), Expect = 3e-47
 Identities = 91/150 (60%), Positives = 111/150 (74%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T   K RK RGHVSAGHGR+GKHRKHPGGRG AGG HHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTHLSKTRKHRGHVSAGHGRVGKHRKHPGGRGLAGGQHHHRTNMDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK----AKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK  N F+ P++N++KLWS++P E +    +  + D +P+ID+  LG+ KVLGKG +P 
Sbjct: 61  FHKQGNHFWKPVLNLEKLWSLIPAEKREAYLSSTNPDVIPVIDLLPLGYSKVLGKGRIP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
             P+VV+A+  SK AE+KI EAGG V L A
Sbjct: 120 KVPLVVRARWFSKEAERKITEAGGVVELVA 149



>gb:AY232080_1177373 Drosophila yakuba clone yak-ad_RpL27A mRNA
           sequence.
          Length = 144

 Score =  188 bits (478), Expect = 5e-47
 Identities = 93/144 (64%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 2   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRR 61

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKD---DVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
              + P +N+DKLWS+V  E  A+  K+     P+ID+ + G++K+LG+G LP+ +PV+V
Sbjct: 62  QHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA-RPVIV 120

Query: 400 KAKLVSKIAEKKIKEAGGAVLLTA 471
           KAK  SK AE KIK+AGG  LL+A
Sbjct: 121 KAKYFSKKAEDKIKKAGGVCLLSA 144



>gb:AY231794_1177087 Drosophila yakuba clone yak-em_RpL27A mRNA
           sequence.
          Length = 148

 Score =  188 bits (478), Expect = 5e-47
 Identities = 93/144 (64%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 6   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRR 65

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKD---DVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
              + P +N+DKLWS+V  E  A+  K+     P+ID+ + G++K+LG+G LP+ +PV+V
Sbjct: 66  QHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA-RPVIV 124

Query: 400 KAKLVSKIAEKKIKEAGGAVLLTA 471
           KAK  SK AE KIK+AGG  LL+A
Sbjct: 125 KAKYFSKKAEDKIKKAGGVCLLSA 148



>sp|P41092|RL2A_DROME 60S ribosomal protein L27a.>pir|JC6202|JC6202
           ribosomal protein L27a - fruit fly (Drosophila
           melanogaster)>gb:AE014134_1127494 Drosophila
           melanogaster chromosome 2L, complete
           sequence.>gb:AE003576_1216144 Drosophila melanogaster
           chromosome 2L, section 15 of 83 of the complete
           sequence.>gb:AY071144_1295228 Drosophila melanogaster
           RE17991 full length cDNA.>gb:DMU66357_1380975 Drosophila
           melanogaster ribosomal protein RpL27a gene, complete
           cds.>gb:DMU66358_1380976 Drosophila melanogaster
           ribosomal protein L27a homolog mRNA, complete cds.
          Length = 149

 Score =  188 bits (478), Expect = 5e-47
 Identities = 93/144 (64%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 7   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRNFHLRR 66

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKD---DVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
              + P +N+DKLWS+V  E  A+  K+     P+ID+ + G++K+LG+G LP+ +PV+V
Sbjct: 67  QHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA-RPVIV 125

Query: 400 KAKLVSKIAEKKIKEAGGAVLLTA 471
           KAK  SK AE KIK+AGG  LL+A
Sbjct: 126 KAKYFSKKAEDKIKKAGGVCLLSA 149



>pir|JC2392|JC2392 ribosomal protein L27a - fruit fly (Drosophila
           melanogaster)>gb:DMRPL27A_1380098 D.melanogaster mRNA
           for ribosomal protein L27a.
          Length = 149

 Score =  188 bits (477), Expect = 7e-47
 Identities = 93/144 (64%), Positives = 110/144 (76%), Gaps = 3/144 (2%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGRIGKHRKHPGGRGN GGMHHHRI FDKYHPGYFGKVGMR FH  R
Sbjct: 7   KKTRKLRGHVSHGHGRIGKHRKHPGGRGNLGGMHHHRINFDKYHPGYFGKVGMRNFHLRR 66

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKD---DVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
              + P +N+DKLWS+V  E  A+  K+     P+ID+ + G++K+LG+G LP+ +PV+V
Sbjct: 67  QHKFRPEINLDKLWSLVGAEKFAELEKEKSTKAPVIDLVKFGYYKLLGRGHLPA-RPVIV 125

Query: 400 KAKLVSKIAEKKIKEAGGAVLLTA 471
           KAK  SK AE KIKEAGG  LL+A
Sbjct: 126 KAKYFSKKAEDKIKEAGGVCLLSA 149



>gb:TETRPL29B_1400063 T.thermophila rpL29 gene, complete cds.
          Length = 149

 Score =  185 bits (469), Expect = 6e-46
 Identities = 92/150 (61%), Positives = 111/150 (74%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHP--GGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M +  +K RK RGHVS GHGR+GKHRK    GGRG AGGMHHHRIL +K+HPGY+GK+GM
Sbjct: 1   MVSHLRKTRKLRGHVSHGHGRVGKHRKGGCRGGRGKAGGMHHHRILMEKWHPGYYGKLGM 60

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKD--DVPLIDVTQLGFFKVLGKGVLPS 381
           R FH  +N  +CP+VN+DKLW       + K ++D   VP+IDVT+ GFFKVLGKG LP 
Sbjct: 61  RTFHLKKNPLHCPVVNIDKLWRKETDATRQKYAEDKKKVPVIDVTKAGFFKVLGKGRLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           NQPVVVKAK  SK AE++I   GGA +LTA
Sbjct: 120 NQPVVVKAKYFSKTAERRIVAVGGACVLTA 149



>gb:AY223204_1176667 Schistosoma japonicum clone ZZD233 mRNA
           sequence.
          Length = 149

 Score =  183 bits (464), Expect = 2e-45
 Identities = 88/144 (61%), Positives = 106/144 (73%), Gaps = 3/144 (2%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           KK RK RGHVS GHGR+GKHRKHPGGRGNAG  HHHRI  DKYHPGY GKVGMR++H  R
Sbjct: 7   KKTRKLRGHVSHGHGRVGKHRKHPGGRGNAGLEHHHRINMDKYHPGYIGKVGMRHYHLKR 66

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAK---ASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
           N +YCP +N+DKLWS+V      K   ++    P+ID  + G+FKVLGKG LP   PV+V
Sbjct: 67  NPYYCPTINLDKLWSLVSQATYEKYRDSTDGKAPVIDCLRKGYFKVLGKGYLP-KVPVIV 125

Query: 400 KAKLVSKIAEKKIKEAGGAVLLTA 471
           KA+  S+ AE+KI+  GGA +LTA
Sbjct: 126 KARFFSRKAEEKIRAIGGACVLTA 149



>gb:AY125980_1301735 Paracentrotus lividus 60S ribosomal protein
           L27A-related mRNA, complete cds.
          Length = 146

 Score =  182 bits (462), Expect = 4e-45
 Identities = 88/148 (59%), Positives = 109/148 (73%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K   +RGHVS GHGRIGK RKHPGGRGNAGG HHHRI +DKYHPGYFGKVGMR+
Sbjct: 1   MPSRIRKTGTRRGHVSHGHGRIGKPRKHPGGRGNAGGQHHHRINYDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKA--KASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           FH  + K+Y P +N DKLWS+V  + +   +   D  P+ID  +    K+LGKGVLP  Q
Sbjct: 61  FHLTKQKYYKPAINCDKLWSLVSEQTRLQYEGKTDKAPVIDAVR-EVTKILGKGVLP-KQ 118

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           PV+VKAK  S++AE+KIK+AGG  +L A
Sbjct: 119 PVIVKAKFFSRLAEEKIKKAGGCCVLVA 146



>gb:CR382133_1666851 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 149

 Score =  181 bits (459), Expect = 9e-45
 Identities = 91/150 (60%), Positives = 107/150 (71%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TR  K RK RGHVSAG GRIGKHRK+PGGRG AGG HHHR   DKYHPGYFGKVGMRY
Sbjct: 1   MPTRLTKTRKHRGHVSAGKGRIGKHRKNPGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK----AKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FHK RN F+ P +N+DKLW++V  + K      +S    P+ID    G+ KVLGKG LP 
Sbjct: 61  FHKQRNHFWKPEINLDKLWTLVDEDKKDEYLKSSSASAAPVIDTLAHGYGKVLGKGRLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
             PV+VKA+ VS++AE+KI+  GG V L A
Sbjct: 120 QVPVIVKARFVSELAEEKIRAVGGVVELVA 149



>gb:AY188520_2517927 Sparus aurata putative ribosomal protein L27a
           mRNA, partial cds.
          Length = 134

 Score =  181 bits (458), Expect = 1e-44
 Identities = 85/135 (62%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +1

Query: 76  VSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPIVN 255
           VS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H  RN  +CP +N
Sbjct: 1   VSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNTTHCPTIN 60

Query: 256 VDKLWSMVPPEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIA 426
           +DKLW++V  + +    K  +   P+ID  + G++KVLGKG LP  QPV+VKAK  S+ A
Sbjct: 61  LDKLWTLVSEQTRVNYGKKPEGPAPIIDAVRAGYYKVLGKGKLP-KQPVIVKAKFFSRRA 119

Query: 427 EKKIKEAGGAVLLTA 471
           E+KIK  GGA +L A
Sbjct: 120 EEKIKAVGGACVLMA 134



>gb:U13207_1401822 Euplotes crassus large subunit ribosomal protein
           29 (rpl29) gene, complete cds.
          Length = 147

 Score =  180 bits (456), Expect = 2e-44
 Identities = 89/148 (60%), Positives = 109/148 (73%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MT   +  RK RGHVS GHGR+GKHRKHPGGRG AG  HHHRI   KYHPG+ GK GMR+
Sbjct: 1   MTHSKRNTRKLRGHVSHGHGRVGKHRKHPGGRGMAGPEHHHRINVFKYHPGHIGKHGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPE--VKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           FH +RN++YCP +N+ KLWS+V  E   KA+  K  V LIDV + G++KVLGKG+LP   
Sbjct: 61  FHLMRNQYYCPSINLSKLWSLVTEEERQKAQTDKSKVILIDVVKHGYYKVLGKGLLP-EV 119

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           P+VVKAKL +  AEK+IK+ GGA +L A
Sbjct: 120 PLVVKAKLFTPTAEKRIKQVGGACVLRA 147



>sp|P48161|RL2A_EUPCR 60S ribosomal protein L27a (L29).
          Length = 148

 Score =  180 bits (456), Expect = 2e-44
 Identities = 89/148 (60%), Positives = 109/148 (73%), Gaps = 2/148 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MT   +  RK RGHVS GHGR+GKHRKHPGGRG AG  HHHRI   KYHPG+ GK GMR+
Sbjct: 1   MTHSKRNTRKLRGHVSHGHGRVGKHRKHPGGRGMAGPEHHHRINVFKYHPGHIGKHGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPE--VKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           FH +RN++YCP +N+ KLWS+V  E   KA+  K  V LIDV + G++KVLGKG+LP   
Sbjct: 61  FHLMRNQYYCPSINLSKLWSLVTEEERQKAQTDKSKVILIDVVKHGYYKVLGKGLLP-EV 119

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           P+VVKAKL +  AEK+IK+ GGA +L A
Sbjct: 120 PLVVKAKLFTPTAEKRIKQVGGACVLRA 147



>sp|P57728|R28B_SCHPO 60S ribosomal protein L28-B.>pir|S60001|S60001
           60s ribosomal protein ll28B 27a - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC776_1720414 S.pombe
           chromosome II cosmid c776.>gb:SPRPLL29P_1722074 S.pombe
           Rp129p gene for ribosomal protein L29.
          Length = 148

 Score =  178 bits (451), Expect = 7e-44
 Identities = 88/149 (59%), Positives = 110/149 (73%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T   K RK RGHVSAGHGRIGKHRKHPGGRG AGG+ H R  FDKYHPGYFGKVGMR 
Sbjct: 1   MPTHTSKTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRR 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK---ASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           FH ++N  + P VN+D+LW++VP E + K    + +  P+I+V Q G+ KVLGKG LP +
Sbjct: 61  FHLMKNPLWRPTVNLDRLWTLVPNETREKYLGKNTEVAPVINVLQSGYGKVLGKGRLP-D 119

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            PV+++ + VS+ AE+KIK+AGG V L A
Sbjct: 120 TPVIIQTRYVSRRAEEKIKQAGGVVELIA 148



>sp|P36585|R28A_SCHPO 60S ribosomal protein L28-A (L27A)
           (L29).>pir|S60002|S25593 60s ribosomal protein l27a -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPCC5E4_1721462 S.pombe chromosome III cosmid
           c5E4.>gb:SPRAD18_1722016 S.pombe rad18 and rpgL29
           genes.>gb:SPRPGL29_1722066 S.pombe rpgL29 gene for
           ribosomal protein L29.
          Length = 148

 Score =  177 bits (449), Expect = 1e-43
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T   K RK RGHVSAGHGRIGKHRKHPGGRG AGG+ H R  FDKYHPGYFGKVGMR 
Sbjct: 1   MPTHVSKTRKLRGHVSAGHGRIGKHRKHPGGRGKAGGLQHLRSHFDKYHPGYFGKVGMRR 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK---ASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           FH ++N  + P VN+D+LW+++P E + K    + +  P+I+V Q G+ KVLGKG LP  
Sbjct: 61  FHLMKNPLWRPTVNLDRLWTLLPNEARDKYLGKNTEVAPVINVLQSGYGKVLGKGRLPET 120

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            PV+V+ + VS+ AE+KIK+AGG V L A
Sbjct: 121 -PVIVQTRYVSRRAEEKIKQAGGVVELIA 148



>gb:EHI311622_1384479 Entamoeba histolytica rpl27a-4 gene for
           ribosomal protein 27a-4, exons 1-2.>gb:EHI409108_1384490
           Entamoeba histolytica rpl27a-2 gene for ribosomal
           protein large subunit 27a-2, exons 1-2.
          Length = 149

 Score =  177 bits (448), Expect = 2e-43
 Identities = 85/150 (56%), Positives = 109/150 (72%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF++ R++RGHVS G+GRIGKHRK  GGRGNAGG HH +  F  +HP YFGK GMR 
Sbjct: 1   MATRFRQTRRRRGHVSMGYGRIGKHRKQRGGRGNAGGQHHRKTWFTTFHPDYFGKHGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASK----DDVPLIDVTQLGFFKVLGKGVLPS 381
           FH   NK+YCP +NVD LWS+V  +V+A+       ++VP+ID  + G+FKVLGKG LP 
Sbjct: 61  FHLKANKYYCPSINVDSLWSLVGKDVQAQYKNAKVGEEVPVIDCVKHGYFKVLGKGFLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct: 120 KQPVIVRARYFSEKAQQKIKAVGGACELTA 149



>gb:EHI409107_1384489 Entamoeba histolytica rpl27a-1 gene for
           ribosomal protein large subunit 27a, exons 1-2.
          Length = 149

 Score =  176 bits (447), Expect = 2e-43
 Identities = 84/150 (56%), Positives = 109/150 (72%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF++ R++RGHVS G+GRIGKHRK  GGRGNAGG HH +  F  +HP YFGK GMR 
Sbjct: 1   MATRFRQTRRRRGHVSMGYGRIGKHRKQRGGRGNAGGQHHRKTWFTTFHPDYFGKHGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASK----DDVPLIDVTQLGFFKVLGKGVLPS 381
           FH   NK+YCP +NVD LWS+V  +++A+       ++VP+ID  + G+FKVLGKG LP 
Sbjct: 61  FHLKANKYYCPSINVDSLWSLVGKDIQAQYKNAKVGEEVPVIDCVKHGYFKVLGKGFLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct: 120 KQPVIVRARYFSEKAQQKIKAVGGACELTA 149



>gb:BTORFCHR3_1437275 B.taurus mRNA (from chromosome 3, with unknown
           function).
          Length = 165

 Score =  176 bits (445), Expect = 4e-43
 Identities = 88/154 (57%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = +1

Query: 28  ATMTTRFKKNRKKRGHVSAGHGRI-----GKHRKHPGGRGNAGGMHHHRILFDKYHPGYF 192
           A M +R +K RK RGHVS GHG I      +  + PG RGNAGGMHHHRI FDKYHPGYF
Sbjct: 1   ADMPSRLRKTRKLRGHVSHGHGAIVMCSCRQTPETPGSRGNAGGMHHHRINFDKYHPGYF 60

Query: 193 GKVGMRYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQLGFFKVLG 363
           GKVGMR++H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + G++KVLG
Sbjct: 61  GKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLG 120

Query: 364 KGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           KG LP  QPV+VKAK  S+ AE+KIK  GGA +L
Sbjct: 121 KGKLP-KQPVIVKAKFFSRRAEEKIKGVGGACVL 153



>gb:EHI311621_1384478 Entamoeba histolytica rpl27a-3 gene for
           ribosomal protein large subunit 27a-3, exons 1-2.
          Length = 149

 Score =  175 bits (444), Expect = 5e-43
 Identities = 85/150 (56%), Positives = 108/150 (72%), Gaps = 4/150 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF++ R++RGHVS G+GRIGKHRK  GGRGNAGG HH +  F  +HP YFGK GMR 
Sbjct: 1   MATRFRQTRRRRGHVSMGYGRIGKHRKQRGGRGNAGGQHHRKTWFTTFHPDYFGKHGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEV----KAKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           FH   NK+YCP +NVD LWS+V  +V    K   + ++VP+ID  + G+FKVLGKG LP 
Sbjct: 61  FHLKANKYYCPSINVDSLWSLVGKDVQEQYKNAKTGEEVPVIDCVKHGYFKVLGKGFLP- 119

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            QPV+V+A+  S+ A++KIK  GGA  LTA
Sbjct: 120 KQPVIVRARYFSEKAQQKIKAVGGACELTA 149



>sp|Q27021|RL2A_TENMO 60S ribosomal protein
           L27a.>gb:TML27APR_1400379 T.molitor mRNA for ribosomal
           protein L27a.
          Length = 148

 Score =  172 bits (436), Expect = 4e-42
 Identities = 81/149 (54%), Positives = 109/149 (73%), Gaps = 3/149 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M+T  KK RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYHPGYFGK+GMR 
Sbjct: 1   MSTHKKKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKLGMRN 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKAS---KDDVPLIDVTQLGFFKVLGKGVLPSN 384
           +H  RN  + P +N+DKLW++V  + ++K     +   P+ID+ + G++K+LGKG   +N
Sbjct: 61  YHLRRNSKWAPAINLDKLWTLVSEQTRSKYQNHPEGKAPVIDIVKAGYYKLLGKGACLTN 120

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
             ++  +  ++++ E KIK  GGA +L+A
Sbjct: 121 LSLLKPSFSLNRL-EDKIKAVGGACVLSA 148



>gb:PFL305223_2577904 Platichthys flesus partial mRNA for 60S
           ribosomal protein L27A / L22 (rpl27A or rpl22 gene).
          Length = 125

 Score =  166 bits (421), Expect = 2e-40
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)
 Frame = +1

Query: 103 KHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFYCPIVNVDKLWSMVP 282
           KHRKHPGGRGNAGGMHHHRI FDKYHPGYFGKVGMR++H  RN  +CP +N+DKLW++V 
Sbjct: 1   KHRKHPGGRGNAGGMHHHRINFDKYHPGYFGKVGMRHYHLKRNTTHCPTINLDKLWTLVS 60

Query: 283 PEVK---AKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGG 453
            + +    K S+   P+ID  + G++K+LGKG LP  QPV+VKAK  S+ AE+KIK  GG
Sbjct: 61  EQTRLNYGKESEGPAPIIDAVRAGYYKILGKGKLP-KQPVIVKAKFFSRRAEEKIKAVGG 119

Query: 454 AVLLTA 471
           A +L A
Sbjct: 120 ACVLMA 125



>sp|O15883|RL2A_TRYBB 60S ribosomal protein L27a
           (L29).>gb:TBU96757_1399496 Trypanosoma brucei brucei
           ribosomal protein L27a mRNA, complete cds.
          Length = 145

 Score =  166 bits (420), Expect = 3e-40
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 1/147 (0%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRFKK R +RG    G+GR+GKHRKHP GRGNAGG HHHRI F KYHPGYFGK GM +
Sbjct: 1   MPTRFKKTRHQRGSTFCGYGRVGKHRKHPSGRGNAGGEHHHRINFRKYHPGYFGKCGMNH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDV-PLIDVTQLGFFKVLGKGVLPSNQP 390
           +HK +N  + P +N+D L  ++  +   KA K +V P+ID+   G+ K+LG G L +  P
Sbjct: 61  YHKKKNTTWKPTINLDNLTKLMAKDEAMKAKKGEVLPVIDLLANGYSKLLGNGHLQA--P 118

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            +VKA+ VSK+A+KKI++AGGAV+L A
Sbjct: 119 CIVKARWVSKLADKKIRKAGGAVVLQA 145



>gb:HSA400879_2004888 Homo sapiens ST5 gene for suppression of
           tumorigenicity 5, L27a gene for ribosomal protein L27a
           and KIAA0298 gene.
          Length = 106

 Score =  154 bits (389), Expect = 1e-36
 Identities = 67/105 (63%), Positives = 84/105 (80%), Gaps = 3/105 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M +R +K RK RGHVS GHGRIGKHRKHPGGRGNAGG+HHHRI FDKYHPGYFGKVGM++
Sbjct: 1   MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQ 339
           +H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV +
Sbjct: 61  YHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVR 105



>pir|A99113|A99113 60S ribosomal protein L27A [imported] -
           Guillardia theta nucleomorph>gb:GTAJ10592_1681143
           Guillardia theta DNA for complete sequence of
           nucleomorph chromosome 2.
          Length = 144

 Score =  151 bits (381), Expect = 1e-35
 Identities = 72/145 (49%), Positives = 101/145 (69%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M T  +++RKKRGHVS+GHGR+GKHRKHPGGRGN+GG HHH+I F+KYH  +FGK GMRY
Sbjct: 1   MPTDIRRSRKKRGHVSSGHGRVGKHRKHPGGRGNSGGQHHHKIFFEKYHKKHFGKTGMRY 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           + KL+   +   +N+DK+   +   +    +K+     D++ +G  KVLG+G +   +P 
Sbjct: 61  YRKLKQNNFNKSINLDKISDKLVKNMHLH-TKNSSDSFDLSLIGMSKVLGRGRM-VQKPF 118

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLT 468
           V+KA   SK+A KKIK+AGG  +LT
Sbjct: 119 VIKANSFSKVAVKKIKKAGGYCILT 143



>gb:A63909_1450135 Sequence 34 from Patent WO9723633.
          Length = 100

 Score =  146 bits (368), Expect = 3e-34
 Identities = 63/87 (72%), Positives = 69/87 (79%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           M TRF   RK RGHVSAGHGR+GKHRKHPGGRG AGG HHHR  FDKYHPGYFGKVGMR+
Sbjct: 1   MPTRFSNTRKHRGHVSAGHGRVGKHRKHPGGRGLAGGQHHHRTNFDKYHPGYFGKVGMRH 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVK 294
           FH  R   +CP VN+D LW++VP E K
Sbjct: 61  FHLTRXSSWCPTVNIDXLWTLVPAEEK 87



>gb:AF051252_1764239 Picea mariana probable 60S ribosomal protein
           L27a (Sb72) mRNA, partial cds.
          Length = 86

 Score =  140 bits (353), Expect = 2e-32
 Identities = 67/87 (77%), Positives = 80/87 (91%)
 Frame = +1

Query: 211 YFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQP 390
           +FHKLRN ++CPIVN++KLWS+VP +VKAKA+ D VPLIDVTQ G+FKVLGKG LPS QP
Sbjct: 1   HFHKLRNHYHCPIVNIEKLWSLVPEDVKAKATADSVPLIDVTQFGYFKVLGKGELPS-QP 59

Query: 391 VVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           +VVKAKL+SK+AEKKIKEAGGAV+LTA
Sbjct: 60  IVVKAKLISKLAEKKIKEAGGAVMLTA 86



>pir|E86263|E86263 F13K23.22 protein - Arabidopsis
           thaliana>gb:AE005172_890308 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F13K23_1677403 Sequence of BAC F13K23 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 104

 Score =  137 bits (345), Expect = 1e-31
 Identities = 80/145 (55%), Positives = 83/145 (57%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MTT  KK R  R HVS GHGR GKHRK PG RGNAG                   VGMRY
Sbjct: 1   MTTSRKKTRNLREHVSVGHGRFGKHRKLPGSRGNAG-------------------VGMRY 41

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPV 393
           FHKLRNKFYC IVN+DKLWSMV                          LGKG LP N+PV
Sbjct: 42  FHKLRNKFYCQIVNLDKLWSMV--------------------------LGKGFLPENKPV 75

Query: 394 VVKAKLVSKIAEKKIKEAGGAVLLT 468
           VVKAKLVS   EKKIKEAG AV+LT
Sbjct: 76  VVKAKLVSNTDEKKIKEAGSAVVLT 100



>sp|O62581|RL2A_ENCCU 60S ribosomal protein
           L27a.>gb:AF054829_1236985 Encephalitozoon cuniculi
           ribosomal protein L27a gene, complete
           cds.>gb:CNS07EGG_1374084 chromosome X of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 147

 Score =  133 bits (335), Expect = 2e-30
 Identities = 66/147 (44%), Positives = 94/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           MT R KK RK RGHVS G+GR+GKHRKH GGRG AGG  H +  F ++HP Y GK GMR 
Sbjct: 1   MTDRVKKTRKLRGHVSHGYGRVGKHRKHSGGRGLAGGFSHMKTFFTRFHPDYHGKRGMRV 60

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPPEVKAK--ASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           +H+  N  Y   ++  +LW M+P E +     + + VP+IDV + G+  V+G G L   +
Sbjct: 61  YHRKENSDYARPISSARLWGMIPKEQRYDFLDNPEKVPVIDVREFGYHVVVG-GKLSLER 119

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLT 468
           P+VVKA+  +  A+++I + GG  ++T
Sbjct: 120 PIVVKARYFTPSAKEEITKVGGKWIIT 146



>gb:AF031466_1234578 Entamoeba dispar ribosomal protein rpl-27 mRNA,
           partial cds.
          Length = 107

 Score =  120 bits (301), Expect = 2e-26
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 4/98 (4%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           ++ R++RGHVS G+GRIGKHRK  GGRGNAGG HH +  F  +HP  FGK GMR FH   
Sbjct: 1   RQTRRRRGHVSMGYGRIGKHRKQRGGRGNAGGQHHRKTWFTTFHPENFGKHGMRVFHLKA 60

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASK----DDVPLID 330
           NK+YCP +NVD LWS+V  +V+A+       ++VP+ID
Sbjct: 61  NKYYCPSINVDSLWSLVGKDVQAQYKNAKVGEEVPVID 98



>gb:AF456341_2495891 Epinephelus coioides ribosomal protein L22,
           partial sequence.
          Length = 106

 Score =  115 bits (289), Expect = 5e-25
 Identities = 56/105 (53%), Positives = 73/105 (69%), Gaps = 3/105 (2%)
 Frame = +1

Query: 166 FDKYHPGYFGKVGMRYFHKLRNKFYCPIVNVDKLWSMVPPEVK---AKASKDDVPLIDVT 336
           FDKYHPGYFGKVGM ++H  RN  +CP +N+DKLW++V  + +    K      P+ID  
Sbjct: 3   FDKYHPGYFGKVGMIHYHLKRNTAHCPTINLDKLWTLVSEQTRLNYGKKPDGPAPIIDAV 62

Query: 337 QLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           + G++KVLGKG LP  QPV+VKAK  S+ AE+KIK  GGA +L A
Sbjct: 63  RAGYYKVLGKGKLP-KQPVIVKAKFFSRRAEEKIKAVGGACVLMA 106



>gb:AF051765_1764279 Picea mariana putative 60S ribosomal protein
           L27a (Sb72) gene, Sb72-523 allele, partial cds.
          Length = 71

 Score =  113 bits (283), Expect = 2e-24
 Identities = 56/72 (77%), Positives = 66/72 (91%)
 Frame = +1

Query: 256 VDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKK 435
           ++KLWS+VP +VKAKA+ D VPLIDVTQ G+FKVLGKG LPS QP+VVKAKL+SK+AEKK
Sbjct: 1   IEKLWSLVPEDVKAKATADSVPLIDVTQFGYFKVLGKGELPS-QPIVVKAKLISKLAEKK 59

Query: 436 IKEAGGAVLLTA 471
           IKEAGGAV+LTA
Sbjct: 60  IKEAGGAVMLTA 71



>gb:AY650297_1958244 Macaca fascicularis ribosomal protein L27A
           mRNA, partial cds.
          Length = 92

 Score =  112 bits (280), Expect = 5e-24
 Identities = 53/93 (56%), Positives = 71/93 (76%), Gaps = 3/93 (3%)
 Frame = +1

Query: 172 KYHPGYFGKVGMRYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDD---VPLIDVTQL 342
           KYHPGYFGKVGMR++H  RN+ +CP VN+DKLW++V  + +  A+K+     P+IDV + 
Sbjct: 1   KYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRS 60

Query: 343 GFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIK 441
           G++KVLGKG LP  QPV+VKAK  S+ AE+KIK
Sbjct: 61  GYYKVLGKGKLP-KQPVIVKAKFFSRRAEEKIK 92



>gb:AF051764_1764278 Picea mariana putative 60S ribosomal protein
           L27a (Sb72) gene, Sb72-515 allele, partial cds.
          Length = 67

 Score =  108 bits (269), Expect = 9e-23
 Identities = 54/68 (79%), Positives = 62/68 (91%)
 Frame = +1

Query: 268 WSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEA 447
           WS+VP +VKAKA+ D VPLIDVTQ G+FKVLGKG LPS QP+VVKAKL+SK+AEKKIKEA
Sbjct: 1   WSLVPEDVKAKATADSVPLIDVTQFGYFKVLGKGELPS-QPIVVKAKLISKLAEKKIKEA 59

Query: 448 GGAVLLTA 471
           GGAV+LTA
Sbjct: 60  GGAVMLTA 67



>gb:AC087079_1205451 Caenorhabditis elegans cosmid Y37E3, complete
           sequence.
          Length = 88

 Score =  104 bits (260), Expect = 1e-21
 Identities = 51/89 (57%), Positives = 68/89 (76%)
 Frame = +1

Query: 205 MRYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
           MR FH  +N+ YCP VNV++LWS+VP EV+ KA+    P+ID T+LG+FKVLGKG+LP  
Sbjct: 1   MRVFHLNKNQHYCPTVNVERLWSLVPQEVRDKATGGKSPVIDCTKLGYFKVLGKGLLPET 60

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
            P++VKA+  S  AE+KIK+AGGA +L A
Sbjct: 61  -PLIVKARFFSHEAEQKIKKAGGACVLVA 88



>sp|Q29333|RL2A_PIG 60S ribosomal protein L27a (Fragment).
          Length = 53

 Score =  100 bits (248), Expect = 3e-20
 Identities = 43/52 (82%), Positives = 45/52 (86%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFG 195
           +R +  RK RGHVS GHGRIGKHRKHPGGRGNAGGMHHHRI FDKYH GYFG
Sbjct: 2   SRLRXTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINFDKYHXGYFG 53



>gb:AY829784_1180183 Lonomia obliqua ribosomal protein 26 mRNA,
           complete cds.
          Length = 86

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 42/85 (49%), Positives = 63/85 (74%), Gaps = 3/85 (3%)
 Frame = +1

Query: 226 RNKFYCPIVNVDKLWSMVPPEVKAK---ASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVV 396
           RNK +CP++N+DKLW++V  + + K   A+ + VP+I++ + G++K+LGKG LP  QPV+
Sbjct: 3   RNKDFCPVLNLDKLWTLVSEQSRLKYASATDNKVPVINIVKAGYYKLLGKGKLPK-QPVI 61

Query: 397 VKAKLVSKIAEKKIKEAGGAVLLTA 471
           VKAK  SK AE+KIK  GG  +L+A
Sbjct: 62  VKAKFFSKTAERKIKAVGGVCVLSA 86



>sp|P14032|RL15_METVA 50S ribosomal protein L15P.>pir|S05626|R6MX15
           ribosomal protein L15 - Methanococcus
           vannielii>gb:MVRPOP_151788 Methanococcus vanelli DNA for
           transcriptional unit for ribosomal proteins.
          Length = 143

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 55/142 (38%), Positives = 77/142 (54%), Gaps = 2/142 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M  + KK  K+RG  + G+G   KHR   H GGRGNAG   H  +   K++P YFGK G 
Sbjct: 1   MIRKSKKITKQRGSRTCGYGEAKKHRGAGHRGGRGNAGHQKHKWLSVCKFNPEYFGKYGF 60

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
                L  K     +NV +L   V     A   KD   +++ T++GF K+LGKG +  + 
Sbjct: 61  NRNPCLIKKL--ETINVGELEEYVLKYKDAFKLKDGKVVVNATEIGFEKILGKGRI--ST 116

Query: 388 PVVVKAKLVSKIAEKKIKEAGG 453
            +VVKA   S+ A++KI+ AGG
Sbjct: 117 AMVVKAVEFSEGAKEKIEAAGG 138



>sp|O26133|RL15_METTH 50S ribosomal protein L15P.>pir|C69131|C69131
           ribosomal protein L15 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000796_27730
           Methanobacterium thermoautotrophicum from bases 10151 to
           26221 (section 2 of 148) of the complete
           genome.>gb:AE000666_924812 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 146

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 56/144 (38%), Positives = 76/144 (52%), Gaps = 4/144 (2%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M  + +K  + RG  + G G   K R   H GGRG AGG  HH     KY P +FGK G 
Sbjct: 1   MIRKRRKITRMRGSRTVGGGCSKKRRGAGHRGGRGQAGGHKHHWTWIVKYDPKHFGKYGF 60

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPP--EVKAKASKDDVPLIDVTQLGFFKVLGKGVLPS 381
           +   KL  +     VN+  L  M+P   E    + +D + ++DV  LGF KVLG G +  
Sbjct: 61  KRPQKLIKRL--ETVNLAYLDEMIPELLERGVASEEDGMVVLDVRDLGFEKVLGSGRI-- 116

Query: 382 NQPVVVKAKLVSKIAEKKIKEAGG 453
            +PV +KA   S+ A +KI+EAGG
Sbjct: 117 TRPVHLKAYEFSRSATEKIEEAGG 140



>gb:BX957222_844674 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 143

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 54/147 (36%), Positives = 79/147 (53%), Gaps = 7/147 (4%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M  + KK  KKRG  + G+G   KHR   H GGRGNAG   H  +   K++P YFGK G 
Sbjct: 1   MIRKSKKITKKRGSRTCGYGEAKKHRGAGHRGGRGNAGHQKHKWLSVCKFNPDYFGKYGF 60

Query: 208 RYFHKLRNKFYCPI-----VNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGV 372
                  N+  C I     +N+ +L   +     A   ++   +++ T++GF KVLGKG 
Sbjct: 61  -------NRNPCLIKQLETINIGELEEYILKYKDAFQVEEGKVVVNATEIGFEKVLGKGR 113

Query: 373 LPSNQPVVVKAKLVSKIAEKKIKEAGG 453
           +  +  +VVKA   S+ A++KI+ AGG
Sbjct: 114 I--STAMVVKAVEFSEGAKEKIEAAGG 138



>sp|P54047|RL15_METJA 50S ribosomal protein L15P.>pir|E64359|E64359
           ribosomal protein L15 - Methanococcus
           jannaschii>gb:U67497_206572 Methanocaldococcus
           jannaschii DSM 2661 section 39 of 150 of the complete
           genome.>gb:L77117_1099330 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 143

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 55/145 (37%), Positives = 76/145 (52%), Gaps = 2/145 (1%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           M  + KK +K RG  + G G   K R   + GGRG AGG  H      KY P YFGK G 
Sbjct: 1   MIRKKKKVKKIRGSRTCGGGSHKKRRGAGNKGGRGMAGGHKHKWTWIIKYCPDYFGKYGF 60

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQ 387
           +    L  +     +NV +L  +V         +DD  ++DV +LG+ KVLGKG +    
Sbjct: 61  KRHPSLVKRL--ETINVGELEEIVLKNPDKFEKEDDKFVVDVIELGYEKVLGKGKV--TI 116

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVL 462
           P++VKA  VS+ A +KI+  GG V+
Sbjct: 117 PMIVKAVEVSEKAREKIEAVGGEVV 141



>gb:AF222926_1252595 Penaeus monodon ribosomal protein L27a mRNA,
           partial cds.
          Length = 49

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 35/46 (76%), Positives = 35/46 (76%)
 Frame = +1

Query: 25  PATMTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRI 162
           P T     KK RK RGHVS GHGRIGKHRKHPGGRG AGGMH HRI
Sbjct: 2   PKTWLPPRKKTRKLRGHVSHGHGRIGKHRKHPGGRGYAGGMHDHRI 47



>gb:AB001584_1508482 Solanum melongena mRNA for ribosomal protein
           L27a, partial cds.
          Length = 58

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 36/47 (76%), Positives = 41/47 (87%)
 Frame = +1

Query: 331 VTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           VTQ G+ KVLGKGVLP N+ VVVKAKLVSK AE+KIK+ GGAV+LTA
Sbjct: 12  VTQYGYLKVLGKGVLPENKAVVVKAKLVSKNAERKIKDGGGAVVLTA 58



>sp|Q9YF98|RL15_AERPE 50S ribosomal protein L15P.>pir|F72725|F72725
           probable ribosomal protein L15 APE0343 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_651042 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 158

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 55/147 (37%), Positives = 82/147 (55%), Gaps = 5/147 (3%)
 Frame = +1

Query: 43  RFKKNRKKRGHV-SAGHGRIGKHRKH--PGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY 213
           R KK+RK RG   +   GRIG+HRK    GG G AG   H      KY P ++GK G   
Sbjct: 5   RRKKSRKLRGRTRTMSWGRIGQHRKSGSKGGYGAAGLGKHEWTWTIKYAPTWYGKKGFNP 64

Query: 214 FHKLRNKFYCPIVNVDKLWSMVPP-EVKAKASKDDVPLI-DVTQLGFFKVLGKGVLPSNQ 387
             ++R       +NV +L  +    E + KA K+D  ++ ++ +LG  K+LG+G +   +
Sbjct: 65  -PRIRAGLEVTTINVGQLDEIAALLEAQGKAEKEDGKIVVNLEKLGIHKLLGEGRVA--R 121

Query: 388 PVVVKAKLVSKIAEKKIKEAGGAVLLT 468
           P+ V   L S++A KKI+EAGG V++T
Sbjct: 122 PLKVITPLASELAIKKIEEAGGEVIVT 148



>gb:BA000023_690981 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 144

 Score = 63.2 bits (152), Expect = 3e-09
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 2/142 (1%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILF-DKYHPGYFGKVGMRYFHKL 225
           KK+RK RG+ + G G  G+HR          GMH  +  +  KY  G++GK G   F   
Sbjct: 7   KKSRKYRGYRTHGWGTKGQHRDRGAQGSRQIGMHKEKWSWLVKYGEGWYGKHG---FVNP 63

Query: 226 RNKFYCPIVNVDKLWSMVPP-EVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
            +K Y  ++ + KL  ++   E+K K  ++   ++D+T+  + K++G   L    P+V+K
Sbjct: 64  TSKVY-NVITMRKLQELIEKGEIKIK-DENGKKVVDLTEYRYDKLIGSSGLKI--PLVIK 119

Query: 403 AKLVSKIAEKKIKEAGGAVLLT 468
             + SK A +K+KE GG ++LT
Sbjct: 120 VNMASKKAIEKVKELGGQIILT 141



>gb:AY240876_1592264 Saccharomyces paradoxus 60S ribosomal protein
           (RPL28) and putative HD superfamily phosphohydrolase
           genes, partial cds.
          Length = 66

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 32/57 (56%), Positives = 42/57 (73%)
 Frame = +1

Query: 301 ASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLTA 471
           ASK+  P+ID    G+ K+LGKG +P N PV+VKA+ VSK+AE+KI+ AGG V L A
Sbjct: 11  ASKETAPVIDTLAAGYGKILGKGRIP-NVPVIVKARFVSKLAEEKIRAAGGVVELIA 66



>sp|O05643|RL15_SULAC 50S ribosomal protein
           L15P.>gb:SSSPCOPER_191038 S.acidocaldarius DNA for spc
           operon.
          Length = 144

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 43/143 (30%), Positives = 75/143 (52%), Gaps = 2/143 (1%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFD-KYHPGYFGKVGMRY-FHK 222
           KK+RK RG+ + G G  G+HR      G   GMH  +  +  K+  G++GK G R    K
Sbjct: 7   KKSRKYRGYRTHGWGTKGQHRDRGAQGGRQIGMHKEKWSWTVKFGEGWYGKHGFRNPTSK 66

Query: 223 LRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
           L N      + + KL   +  +      ++   ++D+ + G+ K+LG G L    P+V+K
Sbjct: 67  LVN-----AIGLRKLQEYIDNDKIKIEEENGKKVVDLAKYGYDKLLGGGNL--RLPLVIK 119

Query: 403 AKLVSKIAEKKIKEAGGAVLLTA 471
               ++ A++++KE GG ++LT+
Sbjct: 120 VAKATEKAKERVKEIGGEIILTS 142



>gb:AE009930_257538 Pyrobaculum aerophilum strain IM2 section 185 of
           201 of the complete genome.>gb:AE009441_900164
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 156

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 51/153 (33%), Positives = 81/153 (52%), Gaps = 11/153 (7%)
 Frame = +1

Query: 34  MTTRFKKNRK-KRGHVSAGHGRIGKHRKH--PGGRGNAGGMHHHRILFDKYHPG-----Y 189
           M  RFK+  K +RG  + G GR+G+HRK    GG+G  G   H   L  KY        +
Sbjct: 1   MVRRFKRGTKYRRGSRTHGWGRVGQHRKSGGSGGKGMVGFHKHKWSLVMKYGESGTGWPF 60

Query: 190 FGKVGMRYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKA---SKDDVPLIDVTQLGFFKVL 360
           +GK G +    +  ++    +NV  L  +V  E+KA+     +    +I++ +LGF K+L
Sbjct: 61  YGKHGFKQPPPISIEW--RPINVGTLAELV-KELKAEGKVREEGGKYVINLLELGFNKLL 117

Query: 361 GKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAV 459
           G G +  + PV+V   + S+ A +KI++AGG V
Sbjct: 118 GGGTI--DLPVIVYTPIASRTAVEKIEKAGGEV 148



>sp|Q9UX85|RL15_SULSO 50S ribosomal protein L15P.>pir|F90217|F90217
           lSU ribosomal protein L15AB (rpl15AB) [imported] -
           Sulfolobus solfataricus>gb:SSU18930_191234 Sulfolobus
           solfataricus 281 kb genomic DNA fragment, strain
           P2.>gb:AE006696_221595 Sulfolobus solfataricus P2
           section 55 of 272 of the complete
           genome.>gb:AE006641_1107443 Sulfolobus solfataricus P2,
           complete genome.
          Length = 144

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 2/144 (1%)
 Frame = +1

Query: 43  RFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHR-ILFDKYHPGYFGKVGMRY-F 216
           R KK+RK RG  + G G  G+HR      G   GMH  +     KY  G++GK G R   
Sbjct: 5   REKKSRKMRGSRTMGWGIRGQHRDRGSQGGRQIGMHKEKWSWLVKYGKGWYGKHGFRNPT 64

Query: 217 HKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVV 396
            KL +      +++ KL  ++          D   ++D+ +LG+ K+LG G +  + PV 
Sbjct: 65  TKLTS-----AISLRKLNELLESGYIKIKEMDGKKIVDLNELGYNKLLGGGSI--SIPVT 117

Query: 397 VKAKLVSKIAEKKIKEAGGAVLLT 468
           +K    +  A +K+KE GG V+L+
Sbjct: 118 IKVGKATNKAIQKVKEMGGEVILS 141



>gb:AP006878_576671 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 148

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 57/153 (37%), Positives = 74/153 (48%), Gaps = 9/153 (5%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFD---KYHPGYFGK 198
           M  R KK RK RG  + G G   KHR     GGRG AG        +    KY P   GK
Sbjct: 1   MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRKDQKWTWTIKYAPDRLGK 60

Query: 199 VGMRYFHKLRNKFYCPIV----NVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGK 366
            G   FH+ +   Y P V    ++D+ + +   +      +D   + D T LG  K+LG 
Sbjct: 61  RG---FHRPKAVQYIPKVINLNDIDENFELFK-DAGIIYEEDGKLVFDATALGVDKILGT 116

Query: 367 GVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           G L   + +VVKA  V+  AE+KIK AGG VLL
Sbjct: 117 GKL--TRALVVKAYYVTPKAEEKIKAAGGEVLL 147



>gb:AE010278_261369 Pyrococcus furiosus DSM 3638, section 153 of 173
           of the complete genome.>gb:AE009950_902150 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 147

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 56/157 (35%), Positives = 77/157 (49%), Gaps = 13/157 (8%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFD---KYHPGYFGK 198
           M  R KK RK RG  + G G   KHR     GGRG AG    ++  +    KY P + GK
Sbjct: 1   MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGK 60

Query: 199 VGMRYFHKLRNKFYCPIVNV-------DKLWSM-VPPEVKAKASKDDVPLIDVTQLGFFK 354
            G     +++ +    +VN+       D+L  M +  E   K       ++DVTQ    K
Sbjct: 61  RGFSRPPEVQREVR--VVNLKFIDEHLDELMQMGIAYEEGGKI------IVDVTQFAD-K 111

Query: 355 VLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           VLG G L   +P+V+KA+  S  AE+KIK AGG  +L
Sbjct: 112 VLGTGKL--TRPLVIKARAFSPKAEEKIKAAGGEAVL 146



>pir|F71184|F71184 probable ribosomal protein L15 - Pyrococcus
           horikoshii>gb:BA000001_650431 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 150

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 54/157 (34%), Positives = 72/157 (45%), Gaps = 11/157 (7%)
 Frame = +1

Query: 28  ATMTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFD---KYHPGYF 192
           A M  R KK RK RG  + G G   KHR     GGRG AG    ++  +    KY P + 
Sbjct: 2   ARMIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHL 61

Query: 193 GKVGMRYFHKLRNKFYCPIVNV------DKLWSMVPPEVKAKASKDDVPLIDVTQLGFFK 354
           GK G     +++       +        D L   +  E + K       ++D TQ    K
Sbjct: 62  GKRGFSRPPEVQRDVRIVTLKFIDEHLEDLLQMGIAYEEEGKI------VVDTTQFAD-K 114

Query: 355 VLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           VLG G L   +P+ +KAK  S  AE+KIK AGG V+L
Sbjct: 115 VLGTGRL--TRPLTIKAKAFSAKAEEKIKAAGGEVIL 149



>sp|Q9V1V7|RL15_PYRAB 50S ribosomal protein L15P.>pir|B75145|B75145
           lsu ribosomal protein l15p (rpl15p) PAB2138 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX02_849080 Pyrococcus
           abyssi complete genome; segment 2/6.
          Length = 147

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 52/155 (33%), Positives = 75/155 (48%), Gaps = 11/155 (7%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFD---KYHPGYFGK 198
           M  R KK RK RG  + G G   KHR     GGRG AG    ++  +    KY P + GK
Sbjct: 1   MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGK 60

Query: 199 VGMRYFHKLRNKFYCPIV-----NVDKLWSM-VPPEVKAKASKDDVPLIDVTQLGFFKVL 360
            G     +++ +     +     N+D+L    +  E + K       ++D TQ    KVL
Sbjct: 61  RGFSRPPEVQREVRTVTLKSIDENLDELLQKGIAYEEEGKI------IVDTTQFAD-KVL 113

Query: 361 GKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           G G +   +P+V+KA+  S  AE+KIK AGG  +L
Sbjct: 114 GTGKI--TKPLVIKARAFSSKAEEKIKAAGGEAVL 146



>sp|O59441|RL15_PYRHO 50S ribosomal protein L15P.
          Length = 147

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 53/155 (34%), Positives = 71/155 (45%), Gaps = 11/155 (7%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHHRILFD---KYHPGYFGK 198
           M  R KK RK RG  + G G   KHR     GGRG AG    ++  +    KY P + GK
Sbjct: 1   MIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGK 60

Query: 199 VGMRYFHKLRNKFYCPIVNV------DKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVL 360
            G     +++       +        D L   +  E + K       ++D TQ    KVL
Sbjct: 61  RGFSRPPEVQRDVRIVTLKFIDEHLEDLLQMGIAYEEEGKI------VVDTTQFAD-KVL 113

Query: 361 GKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLL 465
           G G L   +P+ +KAK  S  AE+KIK AGG V+L
Sbjct: 114 GTGRL--TRPLTIKAKAFSAKAEEKIKAAGGEVIL 146



>gb:AE013454_292476 Methanosarcina mazei strain Goe1, section 236 of
           379 of the complete genome.>gb:AE008384_966585
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 140

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 47/141 (33%), Positives = 69/141 (48%), Gaps = 6/141 (4%)
 Frame = +1

Query: 58  RKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHH--RILFDKYHPGYFGKVGMRYFHKL 225
           +K RG  + G G     R   + GGRG AGG  HH  R +   Y    +GK G +   ++
Sbjct: 4   KKFRGSRTCGGGTHKNRRGAGNRGGRGKAGGCKHHFVRAMMRGYS---YGKHGFKRPVEV 60

Query: 226 RNKFYCPIVNVDKLWSMVPPEVKAKAS--KDDVPLIDVTQLGFFKVLGKGVLPSNQPVVV 399
                  IVNV +L  + P  V+   +  KD    I++  LG  KVLG G +  N  +VV
Sbjct: 61  SKDI--SIVNVGELDELAPYLVEEGLAEVKDGAYHINLENLGIEKVLGSGRVTKN--LVV 116

Query: 400 KAKLVSKIAEKKIKEAGGAVL 462
            ++  S  A +KI+ AGG+ +
Sbjct: 117 TSEEFSASAREKIENAGGSCI 137



>gb:AE010775_266455 Methanosarcina acetivorans str. C2A, section 120
           of 534 of the complete genome.>gb:AE010299_907014
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 140

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 46/140 (32%), Positives = 70/140 (50%), Gaps = 5/140 (3%)
 Frame = +1

Query: 58  RKKRGHVSAGHGRIGKHRK--HPGGRGNAGGMHHH--RILFDKYHPGYFGKVGMRYFHKL 225
           +K RG  + G G     R   + GGRG AGG  HH  R +   Y    +GK G +   ++
Sbjct: 4   KKFRGSRTCGGGTHKNRRGAGNRGGRGKAGGCKHHFVRAMMRGYS---YGKHGFKRPDEV 60

Query: 226 -RNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
            R+     +  +D+L S +  E  A+  KD    I++  LG  KVLG G +  N  +VV 
Sbjct: 61  SRDVSIVNVGELDELASYLVEEGLAEV-KDGAYHINLENLGIEKVLGSGRVTKN--LVVT 117

Query: 403 AKLVSKIAEKKIKEAGGAVL 462
           ++  S  A +KI+ AGG+ +
Sbjct: 118 SEEFSASAREKIENAGGSCI 137



>gb:AY534910_626220 Uncultured marine group II euryarchaeote
           DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
           sequence.
          Length = 139

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 47/141 (33%), Positives = 65/141 (46%), Gaps = 3/141 (2%)
 Frame = +1

Query: 52  KNRKKRGHVSAGHGR---IGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHK 222
           +  K RG  S  HGR    G+     GGRGNAG   H  +   KY PG++G  G      
Sbjct: 4   RTNKFRGR-SRYHGRGKKAGRGAGLRGGRGNAGINKHRVMTRIKYMPGHWGMHGFNRHPS 62

Query: 223 LRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVK 402
           LR       VN+    S+   EV      DD   I++   G+ K+LG G +     + V 
Sbjct: 63  LRK------VNI----SINVSEVCRLTEDDD---INLGAFGYDKLLGSGRMDKALNITVS 109

Query: 403 AKLVSKIAEKKIKEAGGAVLL 465
           A   S  A +K++ AGG+V+L
Sbjct: 110 A--ASARAIEKVEAAGGSVIL 128



>sp|P47831|RL28_CANAL 60S ribosomal protein L28 (L27A) (L29)
           (Fragment).>gb:CAU37011_1645516 Candida albicans
           ribosomal protein L29 (RPL29) mRNA, partial cds.
          Length = 62

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/50 (52%), Positives = 34/50 (68%)
 Frame = +1

Query: 286 EVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKK 435
           E  +K+S    P+ID    G+ KVLGKG LP   PV+VKA+ VSK+AE+K
Sbjct: 5   EYLSKSSASAAPVIDTLAHGYGKVLGKGRLP-EVPVIVKARFVSKLAEEK 53



>gb:AE010303_261659 Methanopyrus kandleri AV19 section 2 of 157 of
           the complete genome.>gb:AE009439_902440 Methanopyrus
           kandleri AV19, complete genome.
          Length = 154

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 52/154 (33%), Positives = 73/154 (47%), Gaps = 14/154 (9%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK-----HPGGRGNAGGMHHHRILFDKYHPGYFGK 198
           M  R KK   K+   S  HG  G H+      + GGRG AG   H      KY P +FGK
Sbjct: 1   MVVRRKKKSPKKYRGSRTHGG-GSHKNRRGAGNRGGRGMAGSHKHKWFHVIKYMPDHFGK 59

Query: 199 VGMRYFHKLRNKFYCPIVNVDKLWSMVPPEVK-AKASKD-DVPLIDVTQL-------GFF 351
            G     K+  +     +NV +L ++    ++   A KD D  +IDVT          F 
Sbjct: 60  RGFNRPPKVVRE--PNTINVGELDALADKLLEDGIAEKDGDKIVIDVTDERLKPYGGPFD 117

Query: 352 KVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGG 453
           KVLG G +   +P+VV A   ++ A +K++EAGG
Sbjct: 118 KVLGGGHV--KRPLVVVAPEFTERAVEKLEEAGG 149



>gb:TACID5_197003 Thermoplasma acidophilum complete genome; segment
           5/5.
          Length = 144

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 5/143 (3%)
 Frame = +1

Query: 43  RFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHK 222
           R +  + + GH   G  + G+ +   GG GNAG   H  I   KY P +FG  G    H 
Sbjct: 3   RERTKKLRGGHYGRGF-KAGRGKGKKGGSGNAGMGKHKWIWMVKYDPLHFGGKGFTSHHI 61

Query: 223 LRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVV- 399
            + +    + +V+ ++  +  +   +    ++ ++D+   G+ K+LG G       +++ 
Sbjct: 62  SQVEVPINLGDVEYMYESLKRDGFVREENGEI-IVDLRAAGYDKLLGNGNFTVKSTIIID 120

Query: 400 --KAKLVSKIAE--KKIKEAGGA 456
               K +SK++    KI+  G +
Sbjct: 121 KATEKAISKLSAIGSKIENDGSS 143



>gb:BA000011_664793 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 145

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 33/141 (23%), Positives = 61/141 (43%), Gaps = 5/141 (3%)
 Frame = +1

Query: 43  RFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHK 222
           R +  + + GH   G  + G+ +   GGRGNAG   H  I   KY P +FG  G    H 
Sbjct: 3   RERTKKLRGGHYGRGM-KAGRGKGKKGGRGNAGMGKHKWIWMVKYDPLHFGGKGFTSHHL 61

Query: 223 LRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVV- 399
                   +  ++ ++  +  +   +    +  ++D+   G+ K+LG G       +++ 
Sbjct: 62  STPDVPINLGELENIFENLKADGFVREENGET-VVDLKAAGYDKLLGSGNFSVKSRIIID 120

Query: 400 --KAKLVSKIAE--KKIKEAG 450
               K +SK++    KI+  G
Sbjct: 121 KATEKAISKLSAIGSKIENVG 141



>sp|Q9X1J0|RL15_THEMA 50S ribosomal protein L15.>pir|A72248|A72248
           ribosomal protein L15 - Thermotoga maritima (strain
           MSB8)>gb:AE001798_39376 Thermotoga maritima MSB8 section
           110 of 136 of the complete genome.>gb:AE000512_1113849
           Thermotoga maritima MSB8, complete genome.
          Length = 147

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/142 (31%), Positives = 66/142 (46%), Gaps = 8/142 (5%)
 Frame = +1

Query: 52  KNRKKRGH-VSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLR 228
           K RK+ G    +GHG+    R H G +    G  H  I F+        ++  R F  + 
Sbjct: 14  KKRKRVGRGPGSGHGKTSG-RGHKGQKARGSGKVH--IWFEGGQTPLQRRLPKRGFKNIN 70

Query: 229 NKFYCPIVNVDKLWSMVPPEVKAKASKDDVP-------LIDVTQLGFFKVLGKGVLPSNQ 387
            K Y  +VNV  L      E + +A+++  P       +I   + G  K+LG G L   +
Sbjct: 71  KKVYA-VVNVKVL------EERFEANEEVTPEKLIERKIIKDLKDGV-KILGDGEL--TK 120

Query: 388 PVVVKAKLVSKIAEKKIKEAGG 453
           P+VVKA   SK A +KI+ AGG
Sbjct: 121 PLVVKAHAFSKSAVEKIESAGG 142



>sp|O67561|RL15_AQUAE 50S ribosomal protein L15.>pir|H70441|H70441
           ribosomal protein L15 - Aquifex
           aeolicus>gb:AE000749_26915 Aquifex aeolicus VF5 section
           81 of 109 of the complete genome.>gb:AE000657_977446
           Aquifex aeolicus VF5 complete genome.
          Length = 149

 Score = 39.3 bits (90), Expect = 0.054
 Identities = 47/149 (31%), Positives = 66/149 (44%), Gaps = 14/149 (9%)
 Frame = +1

Query: 49  KKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFG--------KVG 204
           +K R  RG + +GHG+    R H G +  +G         D+  P YF         ++ 
Sbjct: 16  EKKRVGRG-IGSGHGKTAG-RGHKGQKSRSG---------DRKMPPYFEGGQTPLYMRIP 64

Query: 205 MRYFHKLRNKFYCPIVNV---DKLWS---MVPPEVKAKASKDDVPLIDVTQLGFFKVLGK 366
            R F     K Y P VNV   DKL+     + PEV A     D       +    K+LG 
Sbjct: 65  KRGFKNPTRKEYTP-VNVGVIDKLFEDGMEITPEVLASKGLCD-------EKDRVKILGD 116

Query: 367 GVLPSNQPVVVKAKLVSKIAEKKIKEAGG 453
           G L   +  V+KA   SK A++KI++AGG
Sbjct: 117 GEL--TKKFVIKAHAFSKSAKEKIEKAGG 143



>pir|S22349|R6HS15 ribosomal protein L15 [validated] - Haloarcula
           marismortui>gb:HMHMAL15_137304 H.marismortui HmaL15 and
           HmasecY genes for ribosomal protein L15 and the protein
           equivalent to secY.>gb:AY596297_632972 Haloarcula
           marismortui ATCC 43049 chromosome I, complete sequence.
          Length = 165

 Score = 38.9 bits (89), Expect = 0.070
 Identities = 46/155 (29%), Positives = 71/155 (45%), Gaps = 10/155 (6%)
 Frame = +1

Query: 34  MTTRFKKNRKKRGHVSAGHGRIGKHRK---HPGGRGNAGGMHHHRILFDKYHPGYFGKVG 204
           MT++ K+ R  R H    H    K+R+   H GGRG+AG   H    F  + P   GK G
Sbjct: 1   MTSKKKRQRGSRTHGGGSH----KNRRGAGHRGGRGDAGRDKHE---FHNHEP--LGKSG 51

Query: 205 MRYFHKLRNKFYCPIV-----NVDKLWSMVPPEVKAKASKDDVPLI--DVTQLGFFKVLG 363
            +   K++ +     V     NV  L +    EV+    + DV  +  +     + KVLG
Sbjct: 52  FKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLG 111

Query: 364 KGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLT 468
            G +     + + A   S+ A +K++ AGG+V LT
Sbjct: 112 AGQV--RHELTLIADDFSEGAREKVEGAGGSVELT 144



>pir|S22604|S22604 ribosomal protein L27a - African clawed frog
           (fragment)
          Length = 33

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 20/32 (62%), Positives = 23/32 (71%)
 Frame = +1

Query: 361 GKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGA 456
           GKG LP  QPV+VKAK   + AE+KIK  GGA
Sbjct: 1   GKGKLPK-QPVIVKAKFFIRKAEEKIKSVGGA 31



>pir|H97897|H97897 50S ribosomal protein L15 [imported] -
           Streptococcus pneumoniae (strain R6)>pir|H95026|H95026
           ribosomal protein L15 [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007336_225470
           Streptococcus pneumoniae TIGR4 section 19 of 194 of the
           complete genome.>gb:AE008402_236529 Streptococcus
           pneumoniae R6 section 18 of 184 of the complete
           genome.>gb:AE007317_942687 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1103238 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 146

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 45/145 (31%), Positives = 69/145 (47%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +R  +NR  RG  S+G+G+    R   G +  +GG    R+ F+      F ++  R F 
Sbjct: 12  SRKVRNRVGRG-TSSGNGKTSG-RGQKGQKARSGG--GVRLGFEGGQTPLFRRLPKRGFT 67

Query: 220 KLRNKFYCPIVNVDKL-----WSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
            +  K Y  IVN+D+L      + V P V  +A      ++   + G  K+LG G L   
Sbjct: 68  NINAKEYA-IVNLDQLNVFEDGAEVTPVVLIEAG-----IVKAEKSGI-KILGNGEL--T 118

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAV 459
           + + VKA   SK AE+ I   GG+V
Sbjct: 119 KKLTVKAAKFSKSAEEAITAKGGSV 143



>sp|P12737|RL15_HALMA 50S ribosomal protein L15P (Hmal15) (Hl9).
          Length = 164

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 45/154 (29%), Positives = 70/154 (45%), Gaps = 10/154 (6%)
 Frame = +1

Query: 37  TTRFKKNRKKRGHVSAGHGRIGKHRK---HPGGRGNAGGMHHHRILFDKYHPGYFGKVGM 207
           T++ K+ R  R H    H    K+R+   H GGRG+AG   H    F  + P   GK G 
Sbjct: 1   TSKKKRQRGSRTHGGGSH----KNRRGAGHRGGRGDAGRDKHE---FHNHEP--LGKSGF 51

Query: 208 RYFHKLRNKFYCPIV-----NVDKLWSMVPPEVKAKASKDDVPLI--DVTQLGFFKVLGK 366
           +   K++ +     V     NV  L +    EV+    + DV  +  +     + KVLG 
Sbjct: 52  KRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGA 111

Query: 367 GVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLT 468
           G +     + + A   S+ A +K++ AGG+V LT
Sbjct: 112 GQV--RHELTLIADDFSEGAREKVEGAGGSVELT 143



>pir|T51469|T51469 glycine/proline-rich protein - Arabidopsis
           thaliana>gb:ATK10A8_1553516 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K10A8 (ESSA
           project).>gb:BT012163_1641370 Arabidopsis thaliana
           At5g17650 gene, complete cds.
          Length = 173

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 22/56 (39%), Positives = 27/56 (48%)
 Frame = +1

Query: 73  HVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLRNKFY 240
           H+S  HG  G H  H  G G  G   H +    K+  G FGK GM  F K + KF+
Sbjct: 119 HMSHHHGHYGHHHGHGYGYGYHG---HGKFKHGKFKHGKFGKHGM--FGKHKGKFF 169



>gb:AP008231_581258 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 106

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = -1

Query: 120 RVLPVLPDAPVPGAHVASLLPVLLEPCRHGCRRLLQ 13
           RV+ +L DA +PG H+  +     + CRH C R+++
Sbjct: 51  RVVKLLQDAGLPGEHITEMFDDCRDGCRHACLRIIE 86



>gb:AE017199_403143 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 138

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 38/142 (26%), Positives = 66/142 (46%), Gaps = 6/142 (4%)
 Frame = +1

Query: 43  RFKKNRKKRG--HVSAGHGRIGKHRKHPGGRGNAG--GMHHHRILFDKYHPGY-FGKVGM 207
           R KK  K +G  H   G+    ++    GGRG AG   M  H+     Y P   F     
Sbjct: 5   RRKKYHKYKGERHARRGYNDRNRNAGIRGGRGKAGYGKMKDHKKSI--YIPAKGFNNPTT 62

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKD-DVPLIDVTQLGFFKVLGKGVLPSN 384
           +    +  +    + N+D L+       K   +K+ D  +ID+ +LG+ K++G+   P  
Sbjct: 63  KEIKAINIRTI--VENLDNLYK------KGLVTKEGDKYIIDLEKLGYNKLIGRLTKP-- 112

Query: 385 QPVVVKAKLVSKIAEKKIKEAG 450
            P+VVKAK +++  ++ ++  G
Sbjct: 113 YPIVVKAKYIAETTKENLQSLG 134



>gb:AE016947_364355 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990843 Enterococcus
           faecalis V583, complete genome.
          Length = 146

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 43/145 (29%), Positives = 67/145 (46%), Gaps = 5/145 (3%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           +R  +NR  RG  S+G+G+    R   G +  +GG    R+ F+      F ++  R F 
Sbjct: 12  SRQVRNRVGRG-TSSGNGKTAG-RGQKGQKARSGG--GVRLGFEGGQTPLFRRLPKRGFT 67

Query: 220 KLRNKFYCPIVNVDKL-----WSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKGVLPSN 384
            +  K Y  +VN+D L      + V P V  +A       I   +    KVL  G L   
Sbjct: 68  NINRKDYA-VVNLDTLNRFEDGTEVTPVVLKEAG------IVKNEKAGIKVLADGEL--T 118

Query: 385 QPVVVKAKLVSKIAEKKIKEAGGAV 459
           + + VKA   SK A++ I+ AGG++
Sbjct: 119 KKLTVKAAKFSKSAQEAIEAAGGSI 143



>gb:BC026876_2095612 Mus musculus DNA segment, Chr 5, Wayne State
           University 46, expressed, mRNA (cDNA clone MGC:30590
           IMAGE:3662118), complete cds.
          Length = 665

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +1

Query: 4   AAALQ*SPATMTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRIL 165
           AA++  +P+T ++   + R++    S    R G       GRG+ GG HHH  L
Sbjct: 324 AASVTSAPSTSSSSRHRKRRRTSSKSEAGARGGSQGSKEKGRGSGGGRHHHHPL 377



>gb:AE017261_419679 Picrophilus torridus DSM 9790, complete genome.
          Length = 136

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 34/110 (30%), Positives = 50/110 (45%)
 Frame = +1

Query: 40  TRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           TR KK R   GH   G  + G+ +   GG G AG   H  +   KY   +FG  G     
Sbjct: 4   TRTKKLRG--GHYGRGM-KAGRGKGKKGGNGMAGLGKHRWVWLLKYDRDHFGVHGF---- 56

Query: 220 KLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVPLIDVTQLGFFKVLGKG 369
           K  +K Y   + +++L ++     +     DDV  ID+   G+ K+LG G
Sbjct: 57  KSHSKKYENPITLEELANIYDKLKENGFVHDDV--IDLEGAGYTKLLGTG 104



>gb:AE017180_401128 Geobacter sulfurreducens PCA, complete genome.
          Length = 148

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 47/149 (31%), Positives = 66/149 (44%), Gaps = 13/149 (8%)
 Frame = +1

Query: 52  KNRKKRGH-VSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFG-------KVGM 207
           K+RK+ G    +GHG+    + H G +  +GG            PG+ G       ++  
Sbjct: 14  KDRKRIGRGPGSGHGKTAT-KGHKGQKARSGG---------SVKPGFEGGQMPMQRRLPK 63

Query: 208 RYFHKLRNKFYCPIVNVDKLWSMVPPEVKAKASKDDVP-LIDVTQLGF----FKVLGKGV 372
           R F  L  K Y  +VNV +L      EV    S  DV  L++   +G      KVL  G 
Sbjct: 64  RGFTPLTRKEYA-LVNVGQL------EVFEAGSCIDVEALLNAGLIGGVKDGLKVLADGD 116

Query: 373 LPSNQPVVVKAKLVSKIAEKKIKEAGGAV 459
           L   +P+ VKA   S  A++KI  AGG V
Sbjct: 117 L--TKPLTVKAHKFSAKAKEKIAAAGGTV 143



>gb:HSTITINN2_2021100 H.sapiens mRNA for titin protein (clone
            hsk1-hsk19).
          Length = 7962

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -1

Query: 210  PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVP 85
            P P  PE+P+  + EE   V  P   PAA   +P +P  PVP
Sbjct: 5977 PAPKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP 6018



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -1

Query: 210  PHPDFPEIPRVILVEE-DPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPV 55
            P P  PEIP+  + EE  PV      VP   +V P LP  PVP   VA  +PV
Sbjct: 6060 PPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKV-PALPKKPVPEEKVAVPVPV 6111



>gb:HSA277892_2002255 Homo sapiens partial TTN gene for titin.
          Length = 34350

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -1

Query: 210   PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVP 85
             P P  PE+P+  + EE   V  P   PAA   +P +P  PVP
Sbjct: 10239 PAPKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP 10280



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -1

Query: 210   PHPDFPEIPRVILVEE-DPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPV 55
             P P  PEIP+  + EE  PV      VP   +V P LP  PVP   VA  +PV
Sbjct: 10322 PPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKV-PALPKKPVPEEKVAVPVPV 10373



>gb:AF525413_1905988 Homo sapiens cardiac titin N2BA isoform (TTN)
           mRNA, partial cds.
          Length = 962

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -1

Query: 210 PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVP 85
           P P  PE+P+  + EE   V  P   PAA   +P +P  PVP
Sbjct: 434 PAPKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP 475



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -1

Query: 210 PHPDFPEIPRVILVEE-DPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPV 55
           P P  PEIP+  + EE  PV      VP   +V P LP  PVP   VA  +PV
Sbjct: 517 PPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKV-PALPKKPVPEEKVAVPVPV 568



>gb:SAG766844_169800 Streptococcus agalactiae NEM316 complete
           genome, segment 2.
          Length = 461

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 1/51 (1%)
 Frame = +1

Query: 322 LIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIA-EKKIKEAGGAVLLTA 471
           +  +T+LGF  + G G+L SN        +V+ I  EKK+KE  G   +TA
Sbjct: 312 ITQLTKLGFDSIFGPGMLCSNIAQATAGTVVTLITKEKKLKEIAGPAAITA 362



>pir|I38346|I38346 elastic titin - human (fragment)
          Length = 7962

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -1

Query: 210  PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVP 85
            P P  PE+P+  + EE   V  P   PAA   +P +P  PVP
Sbjct: 5977 PAPKVPEVPKKPVPEEKKPVPVPKKEPAAPPKVPEVPKKPVP 6018



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 23/53 (43%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
 Frame = -1

Query: 210  PHPDFPEIPRVILVEE-DPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPV 55
            P P  PEIP+  + EE  PV      VP   +V P LP  PVP   VA  +PV
Sbjct: 6060 PPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKV-PALPKKPVPEEKVAVPVPV 6111



>gb:AF000196_1230471 Caenorhabditis elegans cosmid B0041, complete
           sequence.
          Length = 624

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = +1

Query: 85  GHGRIGKHRKHPGG---RGNAGGMHHHRILFDKYHPG 186
           G GR G H  + GG   RG  GGMH+ RI  + +H G
Sbjct: 8   GPGRGGPHHMNGGGGGRRGGGGGMHNQRIQQNPHHGG 44



>gb:AF000196_1230470 Caenorhabditis elegans cosmid B0041, complete
           sequence.
          Length = 706

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = +1

Query: 85  GHGRIGKHRKHPGG---RGNAGGMHHHRILFDKYHPG 186
           G GR G H  + GG   RG  GGMH+ RI  + +H G
Sbjct: 8   GPGRGGPHHMNGGGGGRRGGGGGMHNQRIQQNPHHGG 44



>pir|T34034|T34034 hypothetical protein B0041.2 - Caenorhabditis
           elegans
          Length = 704

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = +1

Query: 85  GHGRIGKHRKHPGG---RGNAGGMHHHRILFDKYHPG 186
           G GR G H  + GG   RG  GGMH+ RI  + +H G
Sbjct: 8   GPGRGGPHHMNGGGGGRRGGGGGMHNQRIQQNPHHGG 44



>gb:AY434474_2084940 Rattus norvegicus cardiac titin N2BA isoform
           (Ttn) mRNA, partial cds.
          Length = 633

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 210 PHPDFPEIPRVILVEEDPVVVHPSGVPAASRV 115
           P P  PE+P+  +VEE PV+     +P A +V
Sbjct: 360 PPPKVPEVPKKPVVEEKPVIEEKPAIPVAEKV 391



>gb:AY429600_2084934 Rattus norvegicus cardiac titin fetal N2BA PEVK
           isoform (Ttn) mRNA, partial cds, alternatively spliced.
          Length = 1059

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 210 PHPDFPEIPRVILVEEDPVVVHPSGVPAASRV 115
           P P  PE+P+  +VEE PV+     +P A +V
Sbjct: 794 PPPKVPEVPKKPVVEEKPVIEEKPAIPVAEKV 825



>gb:AP005396_1851089 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0635G10.
          Length = 193

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +3

Query: 216 PQAPQQ-VLLPHRQRRQALVNGAAGSEGQGLQGRRSL 323
           P+ PQQ  L P RQ R+A+ +G  GSE  G   R+ L
Sbjct: 40  PRLPQQHALQPQRQARRAICSGGGGSEDSGGGSRKKL 76



>gb:AY136513_1425655 Canis familiaris N2BA cardiac titin (TTN) mRNA,
            partial cds.
          Length = 3950

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = -1

Query: 210  PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVP 85
            P    PE+P+  + EE   V  P   PAAS  +P +P  PVP
Sbjct: 3369 PPAKVPEVPKKPVPEEKKPVPVPKKEPAASPKVPEVPKKPVP 3410



>pir|T33997|T33997 hypothetical protein W03G1.5 - Caenorhabditis
           elegans>gb:AF125964_1243207 Caenorhabditis elegans
           cosmid W03G1, complete sequence.
          Length = 471

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 16/34 (47%), Positives = 17/34 (50%)
 Frame = +1

Query: 58  RKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHR 159
           R + GH   GHG  G     PGGR   GG  HHR
Sbjct: 299 RGRHGH--GGHGGHGSRSGSPGGRHGHGGSGHHR 330



 Score = 32.3 bits (72), Expect = 6.6
 Identities = 19/48 (39%), Positives = 21/48 (43%)
 Frame = +1

Query: 67  RGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMR 210
           RG    GHGR G     PGGR   GG H        + PG  G+ G R
Sbjct: 330 RGGRHGGHGRHGSRSGSPGGRHGHGGRHG-----PPHCPGRHGRHGSR 372



 Score = 32.0 bits (71), Expect = 8.6
 Identities = 14/29 (48%), Positives = 14/29 (48%)
 Frame = +1

Query: 73  HVSAGHGRIGKHRKHPGGRGNAGGMHHHR 159
           H   GHG  G     PGGR   GG  HHR
Sbjct: 253 HGHGGHGGHGSRSGSPGGRHGHGGSGHHR 281



>sp|O78486|RR20_GUITH Chloroplast 30S ribosomal protein
           S20.>gb:AF041468_1763546 Guillardia theta complete
           plastid genome.
          Length = 95

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 322 LIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKI 438
           L+ +TQ    K + KG++ SN     KAKL  ++ EKKI
Sbjct: 55  LVAITQSKIDKAVQKGIIHSNNGSAKKAKLTKRLKEKKI 93



>gb:AY872185_2150349 Synthetic construct hypothetical protein
           (FTT1398) gene, complete cds.
          Length = 354

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 23/72 (31%), Positives = 36/72 (50%)
 Frame = +1

Query: 298 KASKDDVPLIDVTQLGFFKVLGKGVLPSNQPVVVKAKLVSKIAEKKIKEAGGAVLLTA*G 477
           KA+ D V +I++        L +G  PS+  V+  AK+  +IAE +    G  VL     
Sbjct: 256 KANLDSVKMIEIK-------LSQGAKPSHGGVLPAAKITPEIAEIRGVSMGKDVLSPPAH 308

Query: 478 SSFTLRLTFCGF 513
           S+F+  + FC F
Sbjct: 309 SAFSTPIEFCYF 320



>gb:BC000556_1966828 Homo sapiens hypothetical protein FLJ20257,
           mRNA (cDNA clone MGC:3013 IMAGE:3162468), complete
           cds.>gb:BC018935_1976664 Homo sapiens hypothetical
           protein FLJ20257, mRNA (cDNA clone MGC:14290
           IMAGE:4136145), complete cds.
          Length = 689

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +1

Query: 4   AAALQ*SPATMTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHH 156
           AA++  +P + ++R +K R+      AG  R G       GRG+ GG HHH
Sbjct: 348 AASVISAPPSSSSRHRKRRRTSSKSEAG-ARGGGQGSKEKGRGSWGGRHHH 397



>gb:AP004304_1839902 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0483E06.>gb:AP006267_1861571 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0004F07.
          Length = 182

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -1

Query: 144 PSGVPAASRVLPVLPDAPVPGAHVASLLPVLLEPCRHGCRRLLQSG 7
           P   PAA R+LP LP  P  G      +P     CRH  RR+ +SG
Sbjct: 53  PPPRPAARRLLPPLPPEPAKGR-----VPPPPATCRHPSRRIRRSG 93



>gb:AC115598_1205798 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 1264

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 18/50 (36%), Positives = 21/50 (42%)
 Frame = +1

Query: 70  GHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFH 219
           GH    H   G H  H G  G+ GG HHH       H G+ G  G  + H
Sbjct: 178 GHHGGYHHHHGGHGGHGGHGGHHGGYHHH-------HGGHGGYHGNPHHH 220



>pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo
           sapiens ALR mRNA, complete cds.
          Length = 4957

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = -1

Query: 195 PEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPVLLEPCRHGCRRLL 16
           PE P    + E P+   P         +P +   P PG+ V    P+L+EP    C  LL
Sbjct: 389 PESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVGPASPILMEPLPPQCSPLL 448

Query: 15  Q 13
           Q
Sbjct: 449 Q 449



>sp|O14686|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
           protein 2 (ALL1-related protein).>pir|T03454|T03454 ALR
           protein - human>gb:AF010403_1876229 Homo sapiens ALR
           mRNA, complete cds.
          Length = 5262

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 19/61 (31%), Positives = 26/61 (42%)
 Frame = -1

Query: 195 PEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPVLLEPCRHGCRRLL 16
           PE P    + E P+   P         +P +   P PG+ V    P+L+EP    C  LL
Sbjct: 694 PESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPVGPASPILMEPLPPQCSPLL 753

Query: 15  Q 13
           Q
Sbjct: 754 Q 754



>gb:AP003840_1834052 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1634_B10.
          Length = 152

 Score = 28.5 bits (62), Expect(2) = 7.0
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -1

Query: 210 PHPDFPEIPRVILVEEDPVVVHPSGVPAASRVLPVLPDAP-VPG 82
           PHP  PE+P +   E  P  V P  +P    V+P LP  P VPG
Sbjct: 75  PHPAVPELPPLPKPELPPHPVVPEMLP--HPVVPELPHYPAVPG 116



 Score = 22.7 bits (47), Expect(2) = 7.0
 Identities = 9/16 (56%), Positives = 9/16 (56%)
 Frame = -3

Query: 229 CGACGSTASRLSRNTP 182
           CGA GSTA  L    P
Sbjct: 21  CGAMGSTARHLEEKAP 36



>gb:BA000030_703735 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 381

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = -1

Query: 180 VILVEEDPVVVHPSGVPAASRVLPVLPDAPVPGAHVASLLPVLLEP 43
           ++    DP  +HP  VP  +  LP+LP A +    +  LLP  + P
Sbjct: 334 IVSAAYDPAALHPGVVPLTAPALPLLPAAAI----LLGLLPAFVSP 375


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 540,145,108
Number of Sequences: 1806583
Number of extensions: 10666891
Number of successful extensions: 37150
Number of sequences better than 10.0: 143
Number of HSP's better than 10.0 without gapping: 34838
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36733
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 32290244624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)