BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2376
         (726 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T03803|T03803 tumor-related protein, clone NF34 - common tob...    59   1e-07   Nicotiana tabacum [American tobacco]
gb:AY395691_1604819 Solanum brevidens miraculin-like protein (Mi...    51   2e-05   
pir|T07871|T07871 miraculin homolog, root-knot nematode-induced ...    50   4e-05   Solanum lycopersicum
gb:TOBTID91_1725566 Nicotiana glauca X Nicotiana langsdorffii mR...    47   3e-04   
gb:AB023651_1515635 Solanum melongena gene for miraculin homolog...    47   5e-04   
gb:AB023648_1515632 Youngia japonica gene for miraculin homologu...    46   6e-04   
sp|P58514|SPI1_SOLTU|SPI1_SOLTU Serine protease inhibitor 1 (PSPI-21) (PSPI...    45   0.001   Solanum tuberosum [potatoes]
gb:AF208020_1776993 Nicotiana glutinosa putative proteinase inhi...    45   0.001   
gb:POTPIC_1701135 Solanum tuberosum mRNA for proteinase inhibito...    45   0.001   
gb:AF356605_1790751 Herrania albiflora clone 5-10 trypsin inhibi...    45   0.002   
sp|P58515|SPI2_SOLTU|SPI2_SOLTU Serine protease inhibitor 2 (PSPI-21) (PSPI...    45   0.002   Solanum tuberosum [potatoes]
gb:AF495585_1805545 Solanum tuberosum clone P7D8 putative Kunitz...    44   0.003   
gb:AY693423_1623439 Solanum tuberosum Kunitz-type proteinase inh...    44   0.003   
gb:AY693424_1623440 Solanum tuberosum Kunitz-type proteinase inh...    44   0.004   
sp|Q41433|SPI6_SOLTU|SPI6_SOLTU Probable serine protease inhibitor 6 precur...    43   0.005   Solanum tuberosum [potatoes]
gb:AF492359_1804895 Solanum tuberosum putative kunitz-type prote...    43   0.007   
pir|S25314|S25314 aspartic proteinase inhibitor precursor - pota...    43   0.007   Solanum tuberosum [potatoes]
pir|F96759|F96759 probable tumor-related protein T9L24.46 [impor...    43   0.007   Arabidopsis thaliana [mouse-ear cress]
sp|P30941|SPI7_SOLTU|SPI7_SOLTU Serine protease inhibitor 7 precursor (PIG)...    43   0.007   Solanum tuberosum [potatoes]
gb:AF492769_1804981 Solanum tuberosum putative kunitz-type prote...    42   0.009   
gb:AY692479_1622603 Solanum tuberosum Kunitz-type proteinase inh...    42   0.009   
gb:AF495584_1805544 Solanum tuberosum clone P4D11 putative Kunit...    42   0.011   
gb:AF495582_1805542 Solanum tuberosum clone P2F10 putative Kunit...    41   0.019   
gb:AF208022_1776994 Nicotiana glutinosa biotic cell death-associ...    41   0.019   
gb:AY378089_1603815 Populus balsamifera subsp. trichocarpa x Pop...    41   0.019   
gb:AY166690_1586215 Solanum tuberosum serine protease inhibitor ...    41   0.019   
gb:AF536175_1809623 Solanum tuberosum Kunitz-type proteinase inh...    40   0.056   
gb:AF495581_1805541 Solanum tuberosum clone P1G7 putative Kunitz...    40   0.056   
gb:BC046701_2549691 Xenopus laevis membrane bound C2 domain cont...    39   0.073   
sp|Q41484|SPI5_SOLTU|SPI5_SOLTU Serine protease inhibitor 5 precursor (gCDI...    39   0.073   Solanum tuberosum [potatoes]
gb:AF356619_1790765 Theobroma cacao clone 34-4 trypsin inhibitor...    39   0.095   
pir|S74136|S74136 latex proteinase inhibitor - papaya                  39   0.095   Carica papaya [mamon]
sp|P32765|ASP_THECC|ASP_THECC 21 kDa seed protein precursor.>pir|S16252|S1...    39   0.095   Theobroma cacao [chocolate]
gb:AB023650_1515634 Taraxacum officinale gene for miraculin homo...    38   0.16    
gb:AB023649_1515633 Youngia japonica gene for miraculin homologu...    38   0.16    
pir|G86313|G86313 hypothetical protein F2H15.9 - Arabidopsis tha...    38   0.21    Arabidopsis thaliana [mouse-ear cress]
sp|P80691|LSPI_CARPA|LSPI_CARPA Latex serine proteinase inhibitor.                37   0.36    Carica papaya [mamon]
gb:AY341934_1600811 Bauhinia bauhinioides kunitz-type inihibitor...    37   0.47    
sp|P83052|BBKI_BAUBA|BBKI_BAUBA Kunitz-type serine protease inhibitor BbKI.       37   0.47    Bauhinia bauhinioides
gb:AF349442_1790189 Populus tremuloides Kunitz trypsin inhibitor...    36   0.62    
gb:AY081323_1568669 Arabidopsis thaliana putative trypsin inhibi...    36   0.80    
pir|G96758|G96758 protein trypsin inhibitor T18K17.7 [imported] ...    36   0.80    Arabidopsis thaliana [mouse-ear cress]
pir|S57810|S57810 hypothetical protein precursor (clone TPP11) -...    35   1.4     Solanum lycopersicum
gb:AF356620_1790766 Theobroma bicolor clone 5-2 trypsin inhibito...    35   1.8     
gb:BT000366_1634644 Arabidopsis thaliana putative trypsin inhibi...    35   1.8     
gb:AF495583_1805543 Solanum tuberosum clone P2G2 putative Kunitz...    34   2.3     
gb:AK129164_2069395 Mus musculus mRNA for mKIAA0564 protein.           33   4.0     
gb:AF356626_1790772 Theobroma bicolor clone 5-3 trypsin inhibito...    33   4.0     
sp|P22648|FAS2_SCHAM|FAS2_SCHAM Fasciclin II precursor (FAS II).>pir|A40114...    33   5.2     Schistocerca americana


>pir|T03803|T03803 tumor-related protein, clone NF34 - common
           tobacco>gb:NTU66263_1691875 Nicotiana tabacum
           tumor-related protein mRNA, complete cds.
          Length = 210

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 54/173 (31%), Positives = 81/173 (46%), Gaps = 8/173 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHD-VVQCSIFSKSSILGWP 283
           V+DI GK+L+ G+ Y  L  V     GL L    N++  C  D VVQ     K+   G P
Sbjct: 31  VVDIAGKKLRTGIDYYILPVVRGRGGGLTLDSTGNES--CPLDAVVQEQQEIKN---GLP 85

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPTA 457
           + F TP N   G V++E     ++F   +A  +C+Q   W L D D    + ++T     
Sbjct: 86  LTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIGGNE 140

Query: 458 GVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
           G  G       F+++K    YK+ YC T+      +C  VG+  Q+G  RL +
Sbjct: 141 GNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLAL 193



>gb:AY395691_1604819 Solanum brevidens miraculin-like protein (Mir)
           mRNA, partial cds.
          Length = 209

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 50/172 (29%), Positives = 77/172 (44%), Gaps = 7/172 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V+DI+GK L+ G+ Y  L  V     GL +  I +  K C  D V      +    G P+
Sbjct: 35  VVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGD--KICPLDAVVQE--HQEIDQGLPL 90

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPTAG 460
            F TP N   G V++E     + F   +A  +C+Q   W L D D    + ++T     G
Sbjct: 91  TF-TPVNPKKG-VIRESTDLNIIF---SANSICVQTTQWKLDDFDETTGQYFITLGGNQG 145

Query: 461 VGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
             G       F+++K    YK+ YC T+      +C  +G+  Q+G  RL +
Sbjct: 146 NPGRETISNWFKIEKFDRDYKLLYCPTVCDFCKVICKEIGIFIQDGVRRLAL 197



>pir|T07871|T07871 miraculin homolog, root-knot nematode-induced -
           tomato>gb:LEU70076_1684750 Lycopersicon esculentum LeMir
           gene, complete cds.
          Length = 205

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 8/173 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSI-LGWP 283
           V+DI+GK L+ G+ Y  L  V     GL +  I +  K C  D V   +   + I  G P
Sbjct: 31  VVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGD--KMCPLDAV---VQEHNEIDQGLP 85

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPTA 457
           + F TP +   G V++E     + F   +A  +C+Q   W L D D    + ++T     
Sbjct: 86  LTF-TPVDPKKG-VIRESTDLNIIF---SANSICVQTTQWKLDDFDETTGQYFITLGGDQ 140

Query: 458 GVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
           G  G       F+++K    YK+ YC T+      +C  +G+  Q+G  RL +
Sbjct: 141 GNPGVETISNWFKIEKYDRDYKLLYCPTVCDFCKVICRDIGIFIQDGVRRLAL 193



>gb:TOBTID91_1725566 Nicotiana glauca X Nicotiana langsdorffii mRNA
           for tumor-related protein, partial cds, clone:tid91.
          Length = 125

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 7/116 (6%)
 Frame = +2

Query: 275 GWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTD 448
           G P+ F TP N   G V++E     ++F   +A  +C+Q   W L D D    + ++T  
Sbjct: 3   GLPLTF-TPVNPKKG-VIRESTDLNIKF---SAASICVQTTLWKLDDFDETTGKYFITIG 57

Query: 449 PTAGVGGA-----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
              G  G       F+++K    YK+ YC T+      +C  VG+  Q+G  RL +
Sbjct: 58  GNEGNPGRETISNWFKIEKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIRRLAL 113



>gb:AB023651_1515635 Solanum melongena gene for miraculin homologue,
           partial cds.
          Length = 160

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 7/167 (4%)
 Frame = +2

Query: 122 GKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTP 301
           GK L+ G+ Y  L  V     GL +  I N+T  C  D V      +    G P+ F TP
Sbjct: 1   GKILRTGIDYYILPVVRGRGGGLTMDSIGNKT--CPLDAVVQE--QEEVKQGLPLTF-TP 55

Query: 302 ANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPTAGVGGA- 472
            N   G V++E     + F   +A  +C+Q   W L + D    + ++T     G  G  
Sbjct: 56  FNPKKG-VIRESTDLNIIF---SANSICVQTTQWKLDNFDETTGKYFITLGGNQGNPGRE 111

Query: 473 ----LFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
                F+++K    YK+ YC T+      +C  +G+  Q+G  RL +
Sbjct: 112 TISNWFKIEKFERDYKLVYCPTVCDFCKVICKDIGIFIQDGVRRLAL 158



>gb:AB023648_1515632 Youngia japonica gene for miraculin homologue
           and insertion of group I intron sequence, isolate:1.
          Length = 142

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 40/133 (30%), Positives = 60/133 (45%), Gaps = 4/133 (3%)
 Frame = +2

Query: 185 GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV 364
           GL L   +N T  C  DVVQ  +   +   G P+ F TP +   G V++E     + F  
Sbjct: 19  GLTLASTRNDT--CPLDVVQADLEVDN---GLPLTF-TPVDPKKG-VIRESTDLNIIFSA 71

Query: 365 SAAGLLCIQEIFWGLADVD----VFRKYVTTDPTAGVGGALFQVQKEWSGYKIAYCVTIP 532
           S+   +CIQ   W L + D    V    V  +P        F+++K    YKI +C T+ 
Sbjct: 72  SS---ICIQSNVWNLEEYDGQLIVSAHGVAGNPGRETISNWFKIEKYEDDYKIVFCPTVC 128

Query: 533 VPRVPVCYPVGLI 571
               PVC  +G++
Sbjct: 129 DFCRPVCGDIGVL 141



>sp|P58514|SPI1_SOLTU Serine protease inhibitor 1 (PSPI-21)
           (PSPI-21-6.3).
          Length = 187

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 46/187 (24%), Positives = 74/187 (39%), Gaps = 9/187 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + +  S     G P
Sbjct: 8   VLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYN--SDVGPSGTP 65

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S + L C+    W + D D     +  +     
Sbjct: 66  VRF-IGSSSHFGQGIFENELLNIQFAISTSKL-CVSYTIWKVGDYDASLGTMLLE----T 119

Query: 464 GGALFQVQKEWS--------GYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKP 619
           GG + Q    W         GY + YC          C  VG++ QNG  RL +     P
Sbjct: 120 GGTIGQADSSWFKIVKSSQLGYNLLYCPVTSSSDDQFCLKVGVVHQNGKRRLAL-VKDNP 178

Query: 620 LQFTFSK 640
           L  +F +
Sbjct: 179 LDISFKQ 185



>gb:AF208020_1776993 Nicotiana glutinosa putative proteinase
           inhibitor mRNA, complete cds.
          Length = 241

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 51/198 (25%), Positives = 82/198 (41%), Gaps = 16/198 (8%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSS--ILGW 280
           V+DI G+ LQ+G  Y+ +S ++    G   +     T+ C +DVVQ     K +  +   
Sbjct: 53  VLDINGEPLQIGEKYHIVSAIWGAGGGGVYLTYVRNTR-CPNDVVQHGRTPKKACPLNSL 111

Query: 281 PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF---RKYVTTDP 451
           P+    P      NVV+E  +  + F V  +  LC+ E  W + D D+     ++V T  
Sbjct: 112 PLAPGPP----PFNVVRETNNINIMFSVPTS-RLCVNETVWKVGDPDLTARGTRFVVTGG 166

Query: 452 TAG-----VGGALFQVQKEWSG---YKIAYC---VTIPVPRVPVCYPVGLIQQNGYNRLG 598
           T G        + F+++K       YK+ YC      P     VC  VGL  +       
Sbjct: 167 TLGNPRPETINSWFKIEKVTKTAPFYKLRYCPDNFLCPECHPDVCLDVGLTHER-----R 221

Query: 599 IGFGVKPLQFTFSKYNAT 652
           +    +P    F K+  T
Sbjct: 222 LALTNQPFMVLFRKFQKT 239



>gb:POTPIC_1701135 Solanum tuberosum mRNA for proteinase inhibitor,
           complete cds, clone:pKEN14-28.
          Length = 221

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 44/180 (24%), Positives = 71/180 (39%), Gaps = 15/180 (8%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 36  VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 93

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 94  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 147

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC      R P       C  VG++ QNG  RL +
Sbjct: 148 GGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMRCPFSSDDQFCLKVGVVHQNGKRRLAL 207



>gb:AF356605_1790751 Herrania albiflora clone 5-10 trypsin inhibitor
           gene, partial cds.>gb:AF356606_1790752 Herrania sp.
           'Columbia' clone 6-1 trypsin inhibitor gene, partial
           cds.
          Length = 154

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 48/164 (29%), Positives = 74/164 (45%), Gaps = 11/164 (6%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVF-IFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSIL--G 277
           V+D +G ELQ G+ Y  +S ++     GL L    +Q+  C   VVQ     + S L  G
Sbjct: 1   VLDTDGDELQTGVEYYVVSAIWGAGGGGLALGRASDQS--CPEIVVQ-----RRSDLDDG 53

Query: 278 WPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDP 451
            P+IF+     +  +VV+      + F V     LC     W L D D    + +VTTD 
Sbjct: 54  TPVIFSNAD--SEDDVVRVSTDLNIEF-VPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDG 110

Query: 452 TAGVGGA-----LFQVQKEWS-GYKIAYCVTIPVPRVPVCYPVG 565
             G  GA      F+++   + GYK  +C ++     P+C  +G
Sbjct: 111 VKGEPGARTLTSWFKIESAGALGYKFRFCPSVCDSCAPLCSDIG 154



>sp|P58515|SPI2_SOLTU Serine protease inhibitor 2 (PSPI-21)
           (PSPI-21-5.2).
          Length = 186

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 45/187 (24%), Positives = 73/187 (39%), Gaps = 9/187 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 8   VLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 65

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S + L C+    W + D D     +  +     
Sbjct: 66  VRF-IGSSSHFGQGIFENELLNIQFAISTSKL-CVSYTIWKVGDYDASLGTMLLE----T 119

Query: 464 GGALFQVQKEWS--------GYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKP 619
           GG + Q    W         GY + YC          C  VG++ QNG  RL +     P
Sbjct: 120 GGTIGQADSSWFKIVKSSQLGYNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLAL-VNENP 178

Query: 620 LQFTFSK 640
           L   F +
Sbjct: 179 LDVLFQE 185



>gb:AF495585_1805545 Solanum tuberosum clone P7D8 putative
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 221

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 49/205 (23%), Positives = 77/205 (37%), Gaps = 15/205 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC        P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMSCPFSSDDQFCLKVG 195

Query: 566 LIQQNGYNRLGIGFGVKPLQFTFSK 640
           ++ QNG  RL +     PL  +F +
Sbjct: 196 VVHQNGKRRLAL-VKDNPLDISFKQ 219



>gb:AY693423_1623439 Solanum tuberosum Kunitz-type proteinase
           inhibitor group B (PKPI-B2) mRNA, partial cds.
          Length = 194

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 48/193 (24%), Positives = 79/193 (40%), Gaps = 15/193 (7%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 9   VLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 66

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 67  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 120

Query: 464 GGALFQVQKEW--------SGYKIAYC-VTIPV-----PRVPVCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC VT P+          C  VG++ QNG  RL +
Sbjct: 121 GGTIGQADSSWFKIVKSSQLGYNLLYCPVTSPMICPFSSEDQFCSKVGVVHQNGKRRLAL 180

Query: 602 GFGVKPLQFTFSK 640
                PL  +F++
Sbjct: 181 -VKANPLDVSFNQ 192



>gb:AY693424_1623440 Solanum tuberosum Kunitz-type proteinase
           inhibitor group B (PKPI-B9) mRNA, partial cds.
          Length = 194

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 47/193 (24%), Positives = 75/193 (38%), Gaps = 15/193 (7%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + +  S     G P
Sbjct: 9   VLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYN--SDVGPSGTP 66

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 67  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 120

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC        P       C  VG++ QNG  RL +
Sbjct: 121 GGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLAL 180

Query: 602 GFGVKPLQFTFSK 640
                PL  +F +
Sbjct: 181 -VKDNPLDISFKQ 192



>sp|Q41433|SPI6_SOLTU Probable serine protease inhibitor 6 precursor
           (AM66).>pir|S66277|S66277 Kunitz-type proteinase
           inhibitor - potato>gb:STU30814_1723043 Solanum tuberosum
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 221

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 45/192 (23%), Positives = 73/192 (38%), Gaps = 15/192 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y+ +S  +    G + L    N    C++ + + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDPRLSYHIISTFWGALGGDVYLGKSPNSDAPCANGIFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC        P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVQSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVG 195

Query: 566 LIQQNGYNRLGI 601
           ++ QNG  RL +
Sbjct: 196 VVHQNGKRRLAL 207



>gb:AF492359_1804895 Solanum tuberosum putative kunitz-type
           proteinase inhibitor precursor P1H5 mRNA, complete cds.
          Length = 221

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 45/192 (23%), Positives = 73/192 (38%), Gaps = 15/192 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  +C+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFEDELLNIQFAISTS-KMCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC       +P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQFGYNLLYCPVTTTMTLPFSSDDQFCLKVG 195

Query: 566 LIQQNGYNRLGI 601
           ++ QNG  RL +
Sbjct: 196 VVHQNGKRRLAL 207



>pir|S25314|S25314 aspartic proteinase inhibitor precursor -
           potato>gb:STAPIHA_1722716 S.tuberosum gene for aspartic
           proteinase inhibitor homologue.
          Length = 217

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 43/180 (23%), Positives = 69/180 (38%), Gaps = 15/180 (8%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 36  VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 93

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F+       G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 94  VRFS-----HFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 143

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC        P       C  VG++ QNG  RL +
Sbjct: 144 GGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLAL 203



>pir|F96759|F96759 probable tumor-related protein T9L24.46
           [imported] - Arabidopsis thaliana>gb:AE005173_894880
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012396_1537661 Arabidopsis thaliana
           chromosome 1 BAC T9L24 genomic sequence, complete
           sequence.
          Length = 222

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 42/167 (25%), Positives = 71/167 (42%), Gaps = 4/167 (2%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLID--IKNQTKGCSHDVVQCSIFSKSSILGW 280
           V+DI G  +Q  + Y  +        GL   +  +  Q    + D+VQ S      + G 
Sbjct: 32  VLDIAGHPVQSNVQYYIIPAKIGTGGGLIPSNRNLSTQDLCLNLDIVQSS---SPFVSGL 88

Query: 281 PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLA-DVDVFRKYVTTDPTA 457
           P+ F+ P N    +V    +S ++     +   LC     W +   V + + +V+     
Sbjct: 89  PVTFS-PLNTKVKHVQ---LSASLNLEFDSTVWLCPDSKVWRIDHSVQLRKSFVSIGGQK 144

Query: 458 GVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGL-IQQNGYNRL 595
           G G + FQ+Q++   YK+ YC   P+  +  C  V L I  +G  RL
Sbjct: 145 GKGNSWFQIQEDGDAYKLMYC---PISSIVACINVSLEIDDHGVRRL 188



>sp|P30941|SPI7_SOLTU Serine protease inhibitor 7 precursor (PIG)
           (PIGEN1) (Allergen Sola t 4) (STPIB) (STPIA) (pKEN14-28)
           (pF4).>gb:POTPIB_1701134 Solanum tuberosum mRNA for
           proteinase inhibitor, complete cds, clone:pF4.
          Length = 221

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 15/180 (8%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 36  VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 93

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 94  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 147

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC        P       C  VG++ QNG  RL +
Sbjct: 148 GGTIGQADSSWFKIVKSSQFGYNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLAL 207



>gb:AF492769_1804981 Solanum tuberosum putative kunitz-type
           proteinase inhibitor S1C1 mRNA, complete cds.
          Length = 221

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 15/180 (8%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 36  VLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 93

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 94  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 147

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC        P       C  VG++ QNG  RL +
Sbjct: 148 GGTIGQADSSWFKIVKSSQFGYNLLYCPVTNTMSCPFSSDDQFCLKVGVVHQNGKRRLAL 207



>gb:AY692479_1622603 Solanum tuberosum Kunitz-type proteinase
           inhibitor (PKPI-B1) mRNA, partial cds.
          Length = 194

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 46/193 (23%), Positives = 76/193 (39%), Gaps = 15/193 (7%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + +  S     G P
Sbjct: 9   VLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYN--SDVGPSGTP 66

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + E     ++F +S +  LC+    W + D D     +  +     
Sbjct: 67  VRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLE----T 120

Query: 464 GGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC        P       C  VG++ QNG  RL +
Sbjct: 121 GGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMICPFSSDDQFCSKVGVVHQNGKRRLAL 180

Query: 602 GFGVKPLQFTFSK 640
                PL  +F++
Sbjct: 181 -VKDNPLDISFNQ 192



>gb:AF495584_1805544 Solanum tuberosum clone P4D11 putative
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 221

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 45/192 (23%), Positives = 72/192 (37%), Gaps = 15/192 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC        P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMICPFSSEDQFCSKVG 195

Query: 566 LIQQNGYNRLGI 601
           ++ QNG  RL +
Sbjct: 196 VVHQNGKRRLAL 207



>gb:AF495582_1805542 Solanum tuberosum clone P2F10 putative
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 213

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 45/191 (23%), Positives = 70/191 (36%), Gaps = 15/191 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC        P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMSCPFSSDDQFCLKVG 195

Query: 566 LIQQNGYNRLG 598
           ++ QNG    G
Sbjct: 196 VVHQNGKKTFG 206



>gb:AF208022_1776994 Nicotiana glutinosa biotic cell
           death-associated protein (CDM1) mRNA, complete cds.
          Length = 229

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 43/180 (23%), Positives = 70/180 (38%), Gaps = 6/180 (3%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V+D   +E++ G  Y  L        G   +  K +   C  DV Q      S   G P+
Sbjct: 26  VLDTNKQEIRPGYTYYILPATTGANGGGLTL-AKGENGSCPLDVFQAQ---NSQSRGLPL 81

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG 466
            F    N +AG V+ E     ++F       +C +   W + D  V    +      G  
Sbjct: 82  KF-LMVNSSAGLVIDENEDINIKFAAPRYVSICNKSTVWKIEDGFVTTGGIKGGSENGTA 140

Query: 467 GALFQVQKEWSGYKIAYC-----VTIPVPRVPVCYPVGLI-QQNGYNRLGIGFGVKPLQF 628
            +LF +QK    Y + YC      +   PR+ +C  +G+    NG  RL +   +  ++F
Sbjct: 141 TSLFTIQKYEDAYALQYCPRAAGCSFICPRL-LCGYIGIAPAANGSRRLAVNRPIFKIEF 199



>gb:AY378089_1603815 Populus balsamifera subsp. trichocarpa x
           Populus deltoides Kunitz trypsin inhibitor 4 (PtdTI4)
           mRNA, complete cds.
          Length = 212

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 46/187 (24%), Positives = 81/187 (43%), Gaps = 9/187 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V+DI+G+EL+ G  Y  +  +F    G    D+    K C  DV+Q   +S   + G P+
Sbjct: 30  VLDIQGEELKAGTEY-IIGSIFFGAGG---GDVSATNKTCPDDVIQ---YSSDLLQGLPV 82

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGL--ADVDVFRKYVTTDPTAG 460
            F +PA+ +  +V++      ++F +  A   C     W +  +     + +VTT    G
Sbjct: 83  TF-SPAS-SDDDVIRVSTDLNIKFSIKKA---CDHSSVWKIQKSSNSEVQWFVTTGGEEG 137

Query: 461 VGGA-----LFQVQKEW-SGYKIAYCVTIPVPRVPVCYPVGLIQQN-GYNRLGIGFGVKP 619
             G       F+++K    GYK+  C         +C  +G+ ++N G   L +   + P
Sbjct: 138 NPGIDTLTNWFKIEKAGILGYKLVSCPEGICHCGVLCRDIGIYRENDGRRILSLSDKLSP 197

Query: 620 LQFTFSK 640
               F K
Sbjct: 198 FLVLFKK 204



>gb:AY166690_1586215 Solanum tuberosum serine protease inhibitor
           mRNA, complete cds.
          Length = 221

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 44/192 (22%), Positives = 72/192 (37%), Gaps = 15/192 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  +C+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFEDELLNIQFAISTS-KMCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC       +P       C   G
Sbjct: 140 LGTMLLE----TGGTIGQADSSWLKIVKSSQFGYNLLYCPVTTTMTLPFSSDDQFCLKAG 195

Query: 566 LIQQNGYNRLGI 601
           ++ QNG  RL +
Sbjct: 196 VVHQNGKRRLAL 207



>gb:AF536175_1809623 Solanum tuberosum Kunitz-type proteinase
           inhibitor precursor (PKPI-B10) gene, partial cds.
          Length = 192

 Score = 39.7 bits (91), Expect = 0.056
 Identities = 46/178 (25%), Positives = 71/178 (39%), Gaps = 13/178 (7%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQCSIFSKSSILGWP 283
           V+D+ GKEL   L Y  +S  +    G + L    N    C++ V + +  S     G P
Sbjct: 9   VLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYN--SDVGPSGTP 66

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F   ++   G  + EG    ++F +S     C+    W + D D     +  +     
Sbjct: 67  VRF-IGSSSHFGPHIFEGELLNIQFDISTV-KSCVSYTIWKVGDYDASLGTMLLE----T 120

Query: 464 GGALFQVQKEW--------SGYKIAYC-VTIPVPRV---PVCYPVGLIQQNGYNRLGI 601
           GG + Q    W         GY + YC  T+  P       C  VG+I QNG  RL +
Sbjct: 121 GGTIGQEDSSWFKIVKSSQLGYNLLYCPATMICPFCSDDEFCLKVGVIHQNGKRRLAL 178



>gb:AF495581_1805541 Solanum tuberosum clone P1G7 putative
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 229

 Score = 39.7 bits (91), Expect = 0.056
 Identities = 44/189 (23%), Positives = 70/189 (37%), Gaps = 15/189 (7%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVP------VCYPVG 565
              +  +     GG + Q    W         GY + YC        P       C  VG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYCPVTSTMICPFSSDDQFCSKVG 195

Query: 566 LIQQNGYNR 592
           ++ QNG  R
Sbjct: 196 VVHQNGKRR 204



>gb:BC046701_2549691 Xenopus laevis membrane bound C2 domain
           containing protein, mRNA (cDNA clone MGC:53187
           IMAGE:5543078), complete cds.
          Length = 876

 Score = 39.3 bits (90), Expect = 0.073
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 6/103 (5%)
 Frame = -1

Query: 477 NKAPPTPAV--GSVVTYFRKTST-SANPQKISWIHNSPAAETGNRTVYEMPSLTT---LP 316
           +K PPTP +     +    K+ST SA+P++ + +H S ++ +G+   Y  P L T    P
Sbjct: 650 HKPPPTPKLETNKKLENGNKSSTPSASPKRPTELHKSSSSLSGSSFTYSPPHLPTKEPTP 709

Query: 315 AVTLAGVLKMMGQPRMEDLENMLH*TTSWEQPLV*FLMSIRHS 187
           ++     L +  Q   E L  + + TT  + PL    ++IRHS
Sbjct: 710 SIASDISLPVATQELRERLRQLQNGTTLGQSPLGQIQLTIRHS 752



>sp|Q41484|SPI5_SOLTU Serine protease inhibitor 5 precursor
           (gCDI-B1).>pir|T07414|T07414 proteinase inhibitor PIE -
           potato>gb:POTPIE_1701137 Solanum tuberosum mRNA for
           proteinase inhibitor, complete cds, clone:gCDT-B1.
          Length = 213

 Score = 39.3 bits (90), Expect = 0.073
 Identities = 46/186 (24%), Positives = 71/186 (38%), Gaps = 9/186 (4%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S       G + L    N    C++ V + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCANGVFRF 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + EG    ++F +S    LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGPHIFEGELLNIQFDISTV-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVPVCYPVGLIQQNG 583
              +  +     GG + Q    W         GY + YC      +   C  VG++ QNG
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYCPFSSDDQ--FCLKVGVVHQNG 193

Query: 584 YNRLGI 601
             RL +
Sbjct: 194 KRRLAL 199



>gb:AF356619_1790765 Theobroma cacao clone 34-4 trypsin inhibitor
           gene, partial cds.
          Length = 154

 Score = 38.9 bits (89), Expect = 0.095
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 10/163 (6%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVF-IFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSI-LGW 280
           V+D +G ELQ G+ Y  LS +      GL L     Q+  C   VVQ     +S +  G 
Sbjct: 1   VLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQS--CPEIVVQ----RRSDLDNGT 54

Query: 281 PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPT 454
           P+IF+     +  +VV+      + F V     LC     W L + D    + +VTTD  
Sbjct: 55  PVIFSNAD--SKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGV 111

Query: 455 AGVGG-----ALFQVQKEW-SGYKIAYCVTIPVPRVPVCYPVG 565
            G  G     + F+++K    GYK  +C ++      +C  +G
Sbjct: 112 KGEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIG 154



>pir|S74136|S74136 latex proteinase inhibitor - papaya
          Length = 184

 Score = 38.9 bits (89), Expect = 0.095
 Identities = 41/162 (25%), Positives = 70/162 (43%), Gaps = 8/162 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           ++DI+GK +  G+ Y  +S ++    G   +      K C   VVQ    +     G PI
Sbjct: 6   IVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDN-----GEPI 60

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADV-DVFRKYVTTDPTAGV 463
           IF+   NV   N+V+E +   V+F ++   + C +   W +     V    VT     G 
Sbjct: 61  IFSAIKNV-KDNIVRESVDLNVKFNIT---INCNETTAWKVDRFPGVIGWTVTLGGEKGY 116

Query: 464 GG-----ALFQVQKEW--SGYKIAYCVTIPVPRVPVCYPVGL 568
            G     ++F+++K      YK  +C + P  R+  C  V +
Sbjct: 117 HGFESTHSMFKIKKAGLPFSYKFHFCPSYPRTRLIPCNNVDI 158



>sp|P32765|ASP_THECC 21 kDa seed protein
           precursor.>pir|S16252|S16252 trypsin inhibitor homolog -
           soybean>gb:TC21KD_1724850 T.cacao mRNA for 21 kDa seed
           protein, homolog. to soybean trypsin inhibitor.
          Length = 221

 Score = 38.9 bits (89), Expect = 0.095
 Identities = 46/163 (28%), Positives = 71/163 (43%), Gaps = 10/163 (6%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVF-IFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSI-LGW 280
           V+D +G ELQ G+ Y  LS +      GL L     Q+  C   VVQ     +S +  G 
Sbjct: 31  VLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQS--CPEIVVQ----RRSDLDNGT 84

Query: 281 PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPT 454
           P+IF+     +  +VV+      + F V     LC     W L + D    + +VTTD  
Sbjct: 85  PVIFSNAD--SKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGV 141

Query: 455 AGVGG-----ALFQVQKEW-SGYKIAYCVTIPVPRVPVCYPVG 565
            G  G     + F+++K    GYK  +C ++      +C  +G
Sbjct: 142 KGEPGPNTLCSWFKIEKAGVLGYKFRFCPSVCDSCTTLCSDIG 184



>gb:AB023650_1515634 Taraxacum officinale gene for miraculin
           homologue, partial cds.
          Length = 136

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 36/129 (27%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = +2

Query: 212 QTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQ 391
           +T+ C  DVVQ +   +    G P+ F TP +   G V++E     + F  S+   +CIQ
Sbjct: 14  RTELCPLDVVQAN---QELDNGLPLTF-TPVDPKKG-VIRESTDLNIIFSASS---ICIQ 65

Query: 392 EIFWGLADVD----VFRKYVTTDPTAGVGGALFQVQKEWSGYKIAYCVTIPVPRVPVCYP 559
              W + + D    V    V  +P        F+++K    YKI +C  +     P+C  
Sbjct: 66  SNVWMIEEYDGSLIVSAHGVQGNPGQETLSNWFKIEKFDDDYKIVFCPAVCDVCRPLCGD 125

Query: 560 VGL-IQQNG 583
           +G+ I +NG
Sbjct: 126 IGVEIDENG 134



>gb:AB023649_1515633 Youngia japonica gene for miraculin homologue,
           partial cds, isolate:2.
          Length = 136

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 36/132 (27%), Positives = 58/132 (43%), Gaps = 4/132 (3%)
 Frame = +2

Query: 185 GLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPV 364
           G+ L+  +N+   C  DVVQ     +    G P+ F TP +   G V++E     + F  
Sbjct: 7   GVRLVPTRNEL--CPPDVVQAD---QELDNGLPLTF-TPVDPKKG-VIRESTDLNIIF-- 57

Query: 365 SAAGLLCIQEIFWGLADVD----VFRKYVTTDPTAGVGGALFQVQKEWSGYKIAYCVTIP 532
             A  +CIQ   W L + D    V    V  +P        F+++K    YK+ +C T+ 
Sbjct: 58  -RAYSICIQSNVWMLEEYDGSLIVSGHGVAGNPGQETISNWFKIEKYEDDYKLVFCPTVC 116

Query: 533 VPRVPVCYPVGL 568
               P+C  +G+
Sbjct: 117 DTCRPICGDIGV 128



>pir|G86313|G86313 hypothetical protein F2H15.9 - Arabidopsis
           thaliana>gb:AE005172_890751 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY081529_1568789 Arabidopsis thaliana
           unknown protein (At1g17860) mRNA, complete
           cds.>gb:AY097369_1576364 Arabidopsis thaliana
           At1g17860/F2H15_8 mRNA, complete cds.>gb:F2H15_1678153
           Sequence of BAC F2H15 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332416_1787228
           Arabidopsis thaliana clone C00079 (e) putative lemir
           (miraculin) protein (At1g17860) mRNA, complete
           cds.>gb:AF370535_1792320 Arabidopsis thaliana Unknown
           protein (F2H15.9) mRNA, complete
           cds.>gb:AF410274_1797088 Arabidopsis thaliana
           At1g17860/F2H15_8 mRNA, complete cds.
          Length = 196

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 44/172 (25%), Positives = 70/172 (40%), Gaps = 7/172 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V DI GK L  G+ Y  L  +     GL + ++K +T  C   V+Q   F  S   G P+
Sbjct: 29  VKDINGKSLLTGVNYYILPVIRGRGGGLTMSNLKTET--CPTSVIQDQ-FEVSQ--GLPV 83

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRK--YVTTDPTAG 460
            F+          +       ++F  ++          W LA+ D   K  +++T    G
Sbjct: 84  KFSP---YDKSRTIPVSTDVNIKFSPTS---------IWELANFDETTKQWFISTCGVEG 131

Query: 461 VGGAL-----FQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGI 601
             G       F++ K    YKI +C T+      +C  VG+  Q+G  RL +
Sbjct: 132 NPGQKTVDNWFKIDKFEKDYKIRFCPTVCNFCKVICRDVGVFVQDGKRRLAL 183



>sp|P80691|LSPI_CARPA Latex serine proteinase inhibitor.
          Length = 184

 Score = 37.0 bits (84), Expect = 0.36
 Identities = 41/162 (25%), Positives = 69/162 (42%), Gaps = 8/162 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           ++DI+GK +  G+ Y  +S ++    G   +      K C   VVQ    +     G PI
Sbjct: 6   IVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDN-----GEPI 60

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADV-DVFRKYVTTDPTAGV 463
           IF+   NV   N+V E +   V+F ++   + C +   W +     V    VT     G 
Sbjct: 61  IFSAIKNV-KDNIVFESVDLNVKFNIT---INCNETTAWKVDRFPGVIGWTVTLGGEKGY 116

Query: 464 GG-----ALFQVQKEW--SGYKIAYCVTIPVPRVPVCYPVGL 568
            G     ++F+++K      YK  +C + P  R+  C  V +
Sbjct: 117 HGFESTHSMFKIKKAGLPFSYKFHFCPSYPRTRLIPCNNVDI 158



>gb:AY341934_1600811 Bauhinia bauhinioides kunitz-type inihibitor
           precursor, mRNA, complete cds.
          Length = 193

 Score = 36.6 bits (83), Expect = 0.47
 Identities = 43/178 (24%), Positives = 68/178 (38%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V+D  G+ +  G     L  V     GL L  I N+ +       +  +       G P+
Sbjct: 22  VVDTNGQPVSNGADAYYLVPVSHGHAGLALAKIGNEAEP------RAVVLDPHHRPGLPV 75

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG 466
            F +P  +   N++KE     ++F  S++         W +   D     V    T  + 
Sbjct: 76  RFESPLRI---NIIKESYFLNIKFGPSSS-----DSGVWDVIQQDPIGLAVKVTDTKSLL 127

Query: 467 GALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQFTFSK 640
           G  F+V+KE  GYKI Y       R      +GL+ +N    L +  G +P  F   K
Sbjct: 128 GP-FKVEKEGEGYKIVYY----PERGQTGLDIGLVHRNDKYYLAVKDG-EPCVFKIRK 179



>sp|P83052|BBKI_BAUBA Kunitz-type serine protease inhibitor BbKI.
          Length = 164

 Score = 36.6 bits (83), Expect = 0.47
 Identities = 43/178 (24%), Positives = 68/178 (38%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSILGWPI 286
           V+D  G+ +  G     L  V     GL L  I N+ +       +  +       G P+
Sbjct: 3   VVDTNGQPVSNGADAYYLVPVSHGHAGLALAKIGNEAEP------RAVVLDPHHRPGLPV 56

Query: 287 IFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGVG 466
            F +P  +   N++KE     ++F  S++         W +   D     V    T  + 
Sbjct: 57  RFESPLRI---NIIKESYFLNIKFGPSSS-----DSGVWDVIQQDPIGLAVKVTDTKSLL 108

Query: 467 GALFQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYNRLGIGFGVKPLQFTFSK 640
           G  F+V+KE  GYKI Y       R      +GL+ +N    L +  G +P  F   K
Sbjct: 109 GP-FKVEKEGEGYKIVYY----PERGQTGLDIGLVHRNDKYYLAVKDG-EPCVFKIRK 160



>gb:AF349442_1790189 Populus tremuloides Kunitz trypsin inhibitor
           TI2 gene, complete cds.
          Length = 213

 Score = 36.2 bits (82), Expect = 0.62
 Identities = 40/158 (25%), Positives = 66/158 (41%), Gaps = 5/158 (3%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCS-HDVVQCSIFSKSSILGWP 283
           V+D  G+E+Q G PY  L +   ++PG    +  N   G + + +    +       G P
Sbjct: 33  VLDFYGREVQAGTPY--LIQDLSYEPG----NTSNFVVGATINPICNSDVVLSYENDGLP 86

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F +P   +   V++EG   TV F  +   +  +  + W +        Y+ T  T GV
Sbjct: 87  VTF-SPVTESTDGVIREGTLITVSFDAATCKMADVTPM-WKIGFNSTGTGYIVT--TGGV 142

Query: 464 GGA-LFQVQK---EWSGYKIAYCVTIPVPRVPVCYPVG 565
                F + K   E S Y+++YC          C PVG
Sbjct: 143 DQLNQFMITKDKNESSFYQLSYCPKSDPFCECSCVPVG 180



>gb:AY081323_1568669 Arabidopsis thaliana putative trypsin inhibitor
           (At1g73260) mRNA, complete cds.>gb:BT002548_1636151
           Arabidopsis thaliana putative trypsin inhibitor
           (At1g73260) mRNA, complete cds.
          Length = 215

 Score = 35.8 bits (81), Expect = 0.80
 Identities = 43/152 (28%), Positives = 62/152 (40%), Gaps = 9/152 (5%)
 Frame = +2

Query: 224 CSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFW 403
           C +D+VQ S      I   P+ F+      A   V E  +  +   V A   +CIQ  +W
Sbjct: 66  CPYDIVQESSEVDEGI---PVKFSNWRLKVA--FVPESQNLNIETDVGAT--ICIQSTYW 118

Query: 404 GLADVDVFRK--YVTTDP-TAGVG----GALFQVQKEW-SGYKIAYCVTIPVPRVPVCYP 559
            + + D  RK  +V   P   G G     + F+++K     YK  +C        P C  
Sbjct: 119 RVGEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSD 178

Query: 560 VGL-IQQNGYNRLGIGFGVKPLQFTFSKYNAT 652
           VG+ I + G  RL +    KP    F K N T
Sbjct: 179 VGIFIDELGVRRLAL--SDKPFLVMFKKANVT 208



>pir|G96758|G96758 protein trypsin inhibitor T18K17.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_894873 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010556_1536962 Arabidopsis thaliana
           chromosome 1 BAC T18K17 genomic sequence, complete
           sequence.
          Length = 208

 Score = 35.8 bits (81), Expect = 0.80
 Identities = 43/152 (28%), Positives = 62/152 (40%), Gaps = 9/152 (5%)
 Frame = +2

Query: 224 CSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFW 403
           C +D+VQ S      I   P+ F+      A   V E  +  +   V A   +CIQ  +W
Sbjct: 59  CPYDIVQESSEVDEGI---PVKFSNWRLKVA--FVPESQNLNIETDVGAT--ICIQSTYW 111

Query: 404 GLADVDVFRK--YVTTDP-TAGVG----GALFQVQKEW-SGYKIAYCVTIPVPRVPVCYP 559
            + + D  RK  +V   P   G G     + F+++K     YK  +C        P C  
Sbjct: 112 RVGEFDHERKQYFVVAGPKPEGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSD 171

Query: 560 VGL-IQQNGYNRLGIGFGVKPLQFTFSKYNAT 652
           VG+ I + G  RL +    KP    F K N T
Sbjct: 172 VGIFIDELGVRRLAL--SDKPFLVMFKKANVT 201



>pir|S57810|S57810 hypothetical protein precursor (clone TPP11) -
           tomato>gb:SLU20592_1715371 Solanum lycopersicum unknown
           trypsin inhibitor-like protein precursor, mRNA, complete
           cds.
          Length = 225

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 43/186 (23%), Positives = 68/186 (36%), Gaps = 8/186 (4%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQT-KGCSHDVVQCSIFSKSSILGWP 283
           V+D +G  ++ G  Y  L  +     GL L  + ++  K C  D+VQ     +    G P
Sbjct: 44  VVDSDGNPVKAGAKYFVLPSLRGSGGGLVLSRVVDKNVKVCPQDIVQ---EPQELNTGRP 100

Query: 284 IIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVFRKYVTTDPTAGV 463
           + F        G ++K      V F   +    C     W +   D   KYV    T G 
Sbjct: 101 VEFFPAYPNKTGEIIKVNNPINVNFFSLSKTSRCANFTVWKM---DKKYKYVVGRGTLGA 157

Query: 464 GGAL---FQVQKEWSGYKIAYCVTIPVPRVPVCYPVGLIQQNGYN----RLGIGFGVKPL 622
              +   F++     GY+  YC ++ VP    C+ + +  +   N    RL       P 
Sbjct: 158 LNRIRNWFRIVPYGKGYRFVYCPSLCVPCKIRCFDLFISYEERENVQVRRLAASDNELPF 217

Query: 623 QFTFSK 640
              F K
Sbjct: 218 SVYFKK 223



>gb:AF356620_1790766 Theobroma bicolor clone 5-2 trypsin inhibitor
           gene, partial cds.
          Length = 154

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 10/163 (6%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVF-IFQPGLCLIDIKNQTKGCSHDVVQ-CSIFSKSSILGW 280
           V+D +G ELQ G+ Y  +S ++     GL L     Q+  C   VVQ  S F +    G 
Sbjct: 1   VLDTDGDELQTGVQYYVVSSIWGAGGGGLALGRATGQS--CPEIVVQRQSDFDR----GT 54

Query: 281 PIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDPT 454
           P+IF+     +   VV+      + F V     LC     W L + D    + +VTTD  
Sbjct: 55  PVIFSNAD--SEDGVVRVSTDINIEF-VPIGDRLCTTSTVWKLDNYDNSAGQWWVTTDGD 111

Query: 455 AGVGG-----ALFQVQKEW-SGYKIAYCVTIPVPRVPVCYPVG 565
            G  G     + F++++     YK  +C +       +C  +G
Sbjct: 112 KGEPGPNNLTSWFKIKESGVMSYKFRFCPSFCDSCTTLCSDIG 154



>gb:BT000366_1634644 Arabidopsis thaliana putative trypsin inhibitor
           (At1g73260) mRNA, complete cds.
          Length = 215

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 42/152 (27%), Positives = 62/152 (40%), Gaps = 9/152 (5%)
 Frame = +2

Query: 224 CSHDVVQCSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFW 403
           C +D+VQ S      I   P+ F+      A   V E  +  +   V A   +CIQ  +W
Sbjct: 66  CPYDIVQESSEVDEGI---PVKFSNWRLKVA--FVPESQNLNIETDVGAT--ICIQSTYW 118

Query: 404 GLADVDVFRK--YVTTDP-TAGVG----GALFQVQKEW-SGYKIAYCVTIPVPRVPVCYP 559
            + + D  R+  +V   P   G G     + F+++K     YK  +C        P C  
Sbjct: 119 RVGEFDHERRQYFVVAGPKPEGFGQDSLKSFFKIEKSGEDAYKFVFCPRTCDSGNPKCSD 178

Query: 560 VGL-IQQNGYNRLGIGFGVKPLQFTFSKYNAT 652
           VG+ I + G  RL +    KP    F K N T
Sbjct: 179 VGIFIDELGVRRLAL--SDKPFLVMFKKANVT 208



>gb:AF495583_1805543 Solanum tuberosum clone P2G2 putative
           Kunitz-type proteinase inhibitor mRNA, complete cds.
          Length = 186

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 39/170 (22%), Positives = 64/170 (37%), Gaps = 9/170 (5%)
 Frame = +2

Query: 71  QLPXXXXXXXXXVIDIEGKELQLGLPYNALSKVFIFQPG-LCLIDIKNQTKGCSHDVVQC 247
           Q P         V+D+ GKEL   L Y  +S  +    G + L    N    C++ + + 
Sbjct: 24  QNPINLPSDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRY 83

Query: 248 SIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDVF 427
           +  S     G P+ F   ++   G  + E     ++F +S +  LC+    W + D D  
Sbjct: 84  N--SDVGPSGTPVRF-IGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDAS 139

Query: 428 RKYVTTDPTAGVGGALFQVQKEW--------SGYKIAYCVTIPVPRVPVC 553
              +  +     GG + Q    W         GY + YC   PV    +C
Sbjct: 140 LGTMLLE----TGGTIGQADSSWFKIVKSSQLGYNLLYC---PVTSTMIC 182



>gb:AK129164_2069395 Mus musculus mRNA for mKIAA0564 protein.
          Length = 1246

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 17/69 (24%), Positives = 32/69 (46%)
 Frame = +2

Query: 245 CSIFSKSSILGWPIIFNTPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVDV 424
           C  FS  +   W + +    N      V EG+++T+  P++   +  + E  W L + + 
Sbjct: 571 CKEFSHKN---WVVFYKQTGNSLTVLDVLEGLAHTISLPINLRTVFLVAEDKWLLVENET 627

Query: 425 FRKYVTTDP 451
            +KY+ T P
Sbjct: 628 NQKYLLTKP 636



>gb:AF356626_1790772 Theobroma bicolor clone 5-3 trypsin inhibitor
           gene, partial cds.
          Length = 154

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 11/164 (6%)
 Frame = +2

Query: 107 VIDIEGKELQLGLPYNALSKVFIFQPGLCLIDIKNQTKGCSHDVVQCSIFSKSSI-LGWP 283
           V+D +G+EL+ G+ Y  +S ++    G  L   +++ + C   VVQ     +S +  G P
Sbjct: 1   VLDTDGEELRTGVEYYVVSALW-GAGGGGLAPGRSRNQSCPDIVVQ----RRSDLDYGIP 55

Query: 284 IIFN--TPANVTAGNVVKEGISYTVRFPVSAAGLLCIQEIFWGLADVD--VFRKYVTTDP 451
           +IF+   P ++         I +T   P+  +  LC+    W L D D    + +V    
Sbjct: 56  VIFSPVKPNDIFIRVSTDLNIEFT---PLRDS--LCLTTAVWKLDDYDQSTGKWWVIAGG 110

Query: 452 TAGVGGA-----LFQVQKEW-SGYKIAYCVTIPVPRVPVCYPVG 565
            AG  G       F+++K    GYK  YC ++      +C  +G
Sbjct: 111 VAGDAGPHTLPNWFKIEKNGVLGYKFIYCPSVCDSCTTLCSDIG 154



>sp|P22648|FAS2_SCHAM Fasciclin II precursor (FAS
           II).>pir|A40114|A40114 fasciclin II precursor - American
           bird grasshopper
          Length = 898

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%)
 Frame = -1

Query: 483 TWNKAPPTPAVGSVVTYFRKTSTSANPQKI-SWIHNSPAAETGNRTVYEMPSLTTL 319
           TW+ AP         T+  +   SANP  I +W+ +    ETG+R V E   LT L
Sbjct: 136 TWDDAPEEQYPTVNETFKIRCRVSANPPAIVNWMRDGHIVETGDRYVVEQDGLTIL 191


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 750,352,998
Number of Sequences: 1806583
Number of extensions: 16038632
Number of successful extensions: 44755
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 43316
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44723
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43598571840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)