BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2367
         (902 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P93338|GAPN_NICPL|GAPN_NICPL NADP-dependent glyceraldehyde-3-phosphate d...   440   e-122   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|P81406|GAPN_PEA|GAPN_PEA NADP-dependent glyceraldehyde-3-phosphate deh...   439   e-122   Pisum sativum [garden pea]
pir|S43832|S43832 glyceraldehyde-3-phosphate dehydrogenase (NADP...   436   e-121   Pisum sativum [garden pea]
gb:AP004702_1843651 Oryza sativa (japonica cultivar-group) genom...   433   e-120   
gb:AY224439_1590641 Oryza sativa (japonica cultivar-group) isola...   433   e-120   
sp|Q43272|GAPN_MAIZE|GAPN_MAIZE NADP-dependent glyceraldehyde-3-phosphate d...   431   e-120   Zea mays [maize]
gb:AF196292_1775953 Apium graveolens nonreversible glyceraldehyd...   427   e-118   
gb:AF357884_1790810 Oryza sativa glyceraldehyde-3-phosphate dehy...   425   e-118   
pir|F84634|F84634 hypothetical protein At2g24270 [imported] - Ar...   422   e-117   Arabidopsis thaliana [mouse-ear cress]
gb:AY504666_1609789 Physcomitrella patens non-phosphorylating GA...   393   e-108   
gb:AF521191_1807892 Triticum aestivum from leaf nonphosphorylati...   358   1e-97   
gb:AF521190_1807891 Triticum aestivum from endosperm nonphosphor...   358   1e-97   
gb:AE017267_422170 Bacillus cereus ATCC 10987, section 4 of 18 o...   265   9e-70   
gb:AE017000_375811 Bacillus cereus ATCC 14579 section 3 of 18 of...   263   3e-69   
gb:AE017355_462077 Bacillus thuringiensis serovar konkukian str....   263   4e-69   
gb:CP000001_851374 Bacillus cereus ZK, complete genome.               262   6e-69   
gb:CP000023_875143 Streptococcus thermophilus LMG 18311, complet...   261   2e-68   
gb:AE017026_381093 Bacillus anthracis str. Ames section 3 of 18 ...   260   2e-68   
gb:AE017278_425721 Bacillus cereus ATCC 10987, section 15 of 18 ...   260   3e-68   
pir|D98000|D98000 glyceraldehyde-3-phosphate dehydrogenase (NADP...   259   6e-68   Streptococcus pneumoniae R6
pir|E95129|E95129 hypothetical protein SP1119 [imported] - Strep...   259   6e-68   Streptococcus pneumoniae
pir|E83929|E83929 NADP-dependent glyceraldehyde-3-phosphate dehy...   256   3e-67   Bacillus halodurans
pir|A57151|A57151 glyceraldehyde-3-phosphate dehydrogenase (NADP...   256   3e-67   Streptococcus mutans
gb:AE006575_220323 Streptococcus pyogenes M1 GAS, section 104 of...   255   9e-67   
gb:AE014157_304522 Streptococcus pyogenes MGAS315, section 22 of...   254   1e-66   
gb:AE010058_258864 Streptococcus pyogenes strain MGAS8232, secti...   254   1e-66   
sp|Q59931|GAPN_STRMU|GAPN_STRMU NADP-dependent glyceraldehyde-3-phosphate d...   254   1e-66   Streptococcus mutans serotype C
gb:CP000003_861018 Streptococcus pyogenes MGAS10394, complete ge...   251   1e-65   
gb:BA000016_675478 Clostridium perfringens str. 13 DNA, complete...   249   7e-65   
gb:AF439646_511047 Streptococcus agalactiae non-phosphorylating ...   243   3e-63   
pir|H97348|H97348 NADP-dependent glyceraldehyde-3-phosphate dehy...   243   3e-63   Clostridium acetobutylicum
gb:AE014229_306144 Streptococcus agalactiae 2603V/R section 39 o...   242   6e-63   
gb:BX842643_822521 Mycoplasma mycoides subsp. mycoides SC genomi...   239   4e-62   
gb:SAG766847_170368 Streptococcus agalactiae NEM316 complete gen...   239   4e-62   
gb:BA000026_693820 Mycoplasma penetrans HF-2 DNA, complete genome.    210   3e-53   
gb:AE017263_420812 Mesoplasma florum L1 complete genome.              209   6e-53   
gb:CFU252211_1646340 Scenedesmus vacuolatus partial mRNA for NAD...   202   5e-51   
pir|F82900|F82900 NADP-dependent glyceraldehyde-3-phosphate dehy...   200   3e-50   Ureaplasma urealyticum
gb:AE016967_369404 Mycoplasma gallisepticum strain R section 1 o...   192   1e-47   
gb:AE010193_260322 Pyrococcus furiosus DSM 3638, section 68 of 1...   165   1e-39   
gb:AP006878_575857 Thermococcus kodakaraensis strain KOD1 DNA, c...   160   4e-38   
gb:AY632421_638097 Streptomyces viridochromogenes PTT biosynthet...   149   6e-35   
sp|Q58806|YE11_METJA|YE11_METJA Hypothetical aldehyde-dehydrogenase like pr...   147   4e-34   Methanocaldococcus jannaschii
gb:AE010400_262740 Methanopyrus kandleri AV19 section 99 of 157 ...   146   5e-34   
gb:BX957223_844740 Methanococcus maripaludis S2 complete genome;...   146   6e-34   
pir|B64476|B64476 NADP-dependent glyceraldehyde-3-phosphate dehy...   144   2e-33   Methanocaldococcus jannaschii
gb:STMBCPD_192727 Streptomyces hygroscopicus genes for P-methyla...   142   1e-32   
gb:BA000012_671638 Mesorhizobium loti MAFF303099 DNA, complete g...   141   2e-32   
pir|H69230|H69230 NADP-dependent glyceraldehyde-3-phosphate dehy...   141   2e-32   Methanothermobacter thermautotrophicus str. Delta H
gb:AE014291_307822 Brucella suis 1330 chromosome I, complete seq...   139   1e-31   
pir|AB3447|AB3447 salicylaldehyde dehydrogenase (EC 1.-.-.-) [im...   138   1e-31   Brucella melitensis
gb:BA000023_690604 Sulfolobus tokodaii str. 7 DNA, complete genome.   138   2e-31   
pir|F90347|F90347 hypothetical protein gapN-2 [imported] - Sulfo...   138   2e-31   Saccharolobus solfataricus
pir|B83867|B83867 NADP-dependent glyceraldehyde-3-phosphate dehy...   137   2e-31   Bacillus halodurans
gb:PSEORF1_160797 Pseudomonas aeruginosa pah genes for 12 ORFs (...   137   3e-31   
sp|Q52460|NAHF_PSESP|NAHF_PSESP Salicylaldehyde dehydrogenase (EC 1.2.1.65)...   137   3e-31   Pseudomonas sp.
gb:AE009879_256850 Pyrobaculum aerophilum strain IM2 section 134...   137   4e-31   
gb:Y14173_210988 Pseudomonas putida plasmid NPL-41 nahC gene and...   137   4e-31   
pir|C84250|C84250 glyceraldehyde-3-phosphate dehydrogenase [impo...   136   6e-31   Halobacterium salinarum
pir|D90323|D90323 hypothetical protein gapN-1 [imported] - Sulfo...   135   1e-30   Saccharolobus solfataricus
gb:CP000011_868173 Burkholderia mallei ATCC 23344 chromosome 2, ...   135   1e-30   
gb:BX571966_793585 Burkholderia pseudomallei strain K96243, chro...   135   1e-30   
gb:AF039533_472124 Pseudomonas stutzeri naphthalene degradation ...   134   2e-30   
gb:AF036940_471633 Ralstonia sp. U2 plasmid pWWU2 putative chemo...   133   4e-30   
gb:BA000028_697626 Oceanobacillus iheyensis HTE831 DNA, complete...   133   5e-30   
gb:AB004059_668 Pseudomonas putida DNA for reductase, ferredoxin...   132   9e-30   
gb:BA000028_695248 Oceanobacillus iheyensis HTE831 DNA, complete...   132   1e-29   
pir|H98159|H98159 hypothetical protein AGR_L_1010GM [imported] -...   131   2e-29   Agrobacterium fabrum str. C58
gb:AY641982_638347 Edwardsiella ictaluri clone pBK71AB hypotheti...   131   2e-29   
gb:AY123973_590641 Rhodococcus sp. Phi2 cyclohexanone oxidation ...   130   3e-29   
pir|T44939|T44939 glyceraldehyde-3-phosphate dehydrogenase (NADP...   130   3e-29   Thermoproteus tenax
gb:AY034888_1559674 Tortula ruralis aldehyde dehydrogenase Aldh2...   130   3e-29   
gb:BX571966_793852 Burkholderia pseudomallei strain K96243, chro...   130   3e-29   
gb:BA000040_730948 Bradyrhizobium japonicum USDA 110 DNA, comple...   130   3e-29   
gb:BA000028_697227 Oceanobacillus iheyensis HTE831 DNA, complete...   130   3e-29   
gb:BA000028_697094 Oceanobacillus iheyensis HTE831 DNA, complete...   130   5e-29   
gb:AE010987_268175 Methanosarcina acetivorans str. C2A, section ...   130   5e-29   
gb:AB126619_15527 Geobacillus kaustophilus genomic DNA, clone:GK...   129   6e-29   
pir|E90504|E90504 hypothetical protein gapN-3 [imported] - Sulfo...   129   6e-29   Saccharolobus solfataricus
gb:BX321863_774328 Nitrosomonas europaea ATCC 19718, complete ge...   129   8e-29   
gb:AE017180_399407 Geobacter sulfurreducens PCA, complete genome.     128   1e-28   
gb:PPU536324_159840 Pseudomonas putida ech gene, vdh gene, fcs g...   128   1e-28   
pir|AD2277|AD2277 aldehyde dehydrogenase [imported] - Nostoc sp....   128   1e-28   Nostoc sp. PCC 7120
gb:AP006840_567911 Symbiobacterium thermophilum DNA, complete ge...   128   2e-28   
pir|H72562|H72562 probable aldehyde dehydrogenase APE1786 - Aero...   127   2e-28   Aeropyrum pernix
gb:BX571966_794028 Burkholderia pseudomallei strain K96243, chro...   127   4e-28   
gb:AP006627_562351 Bacillus clausii KSM-K16 DNA, complete genome.     126   5e-28   
gb:AL646077_548596 Ralstonia solanacearum GMI1000 megaplasmid, c...   126   5e-28   
gb:CR555306_108459 Azoarcus sp. EbN1 complete genome.                 126   5e-28   
gb:PFL536325_157975 Pseudomonas fluorescens ferR gene, ech gene,...   126   7e-28   
sp|O93344|DHAS_CHICK|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   126   7e-28   Gallus gallus [bantam]
gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class ...   125   9e-28   
gb:AB016717_2460745 Xenopus laevis mRNA for aldehyde dehydrogena...   125   9e-28   
gb:AE016786_332775 Pseudomonas putida KT2440 section 13 of 21 of...   125   9e-28   
pir|B83901|B83901 aldehyde dehydrogenase BH2010 [imported] - Bac...   125   9e-28   Bacillus halodurans
gb:AY208917_597503 Pseudomonas sp. ND6 plasmid pND6-1, complete ...   125   1e-27   
gb:AY048763_586752 Pseudomonas fluorescens salicylaldehyde dehyd...   125   1e-27   
gb:CP000031_84156 Silicibacter pomeroyi DSS-3, complete genome.       125   1e-27   
sp|Q63639|DHA2_RAT|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Reti...   125   1e-27   Rattus norvegicus [brown rat]
gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA ...   124   2e-27   
gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1...   124   2e-27   
sp|Q62148|DHA2_MOUSE|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   124   2e-27   Mus musculus [mouse]
pir|T31289|T31289 succinate-semialdehyde dehydrogenase [NAD(P)] ...   124   2e-27   Novosphingobium aromaticivorans
gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family...   124   3e-27   
gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete cds...   124   3e-27   
gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.       124   3e-27   
gb:AJ621277_527467 Thermoproteus tenax aldh gene for aldehyde de...   124   3e-27   
pir|C84401|C84401 aldehyde dehydrogenase (retinol) [imported] - ...   124   3e-27   Halobacterium salinarum
sp|O94788|DHA2_HUMAN|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   124   3e-27   Homo sapiens [man]
gb:HSM806186_2018223 Homo sapiens mRNA; cDNA DKFZp686G1675 (from...   123   4e-27   
gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family...   123   4e-27   
gb:AY486161_621381 Rhodococcus sp. TK6 succinic semialdehyde deh...   123   4e-27   
gb:AE013224_290378 Methanosarcina mazei strain Goe1, section 6 o...   123   4e-27   
gb:SCO939121_178452 Streptomyces coelicolor A3(2) complete genom...   123   4e-27   
gb:ACCPCAOP_18625 Acinetobacter sp. ADP1 dca-pca-qui-pob-hca sup...   123   4e-27   
sp|P47895|DHA6_HUMAN|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC 1.2.1.5).>pir|...   123   4e-27   Homo sapiens [man]
gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class ...   123   6e-27   
gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogena...   123   6e-27   
pir|A87547|A87547 vanillin dehydrogenase [imported] - Caulobacte...   123   6e-27   Caulobacter vibrioides
gb:CP000009_862522 Gluconobacter oxydans 621H, complete genome.       122   7e-27   
gb:BA000040_734677 Bradyrhizobium japonicum USDA 110 DNA, comple...   122   7e-27   
gb:PFPHCOAHL_158013 Pseudomonas fluorescens genes encoding p-hyd...   122   7e-27   
pir|G75592|G75592 succinate-semialdehyde dehydrogenase - Deinoco...   122   7e-27   Deinococcus radiodurans
gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.         122   9e-27   
gb:BA000043_736776 Geobacillus kaustophilus HTA426 DNA, complete...   122   1e-26   
gb:BA000023_693170 Sulfolobus tokodaii str. 7 DNA, complete genome.   122   1e-26   
gb:AF061751_474796 Burkholderia sp. strain RP007 PAH-catabolic g...   122   1e-26   
gb:AE016866_352348 Pseudomonas syringae pv. tomato str. DC3000 s...   122   1e-26   
gb:SCO939124_179349 Streptomyces coelicolor A3(2) complete genom...   122   1e-26   
gb:PSVDHORF2_161948 Pseudomonas sp. vdh gene and ORF2.>gb:A92116...   122   1e-26   
sp|O32507|GABD_DEIRA|GABD_DEIRA Succinate-semialdehyde dehydrogenase [NADP+...   122   1e-26   Deinococcus radiodurans
gb:AE017180_399121 Geobacter sulfurreducens PCA, complete genome.     121   2e-26   
gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1...   121   2e-26   
gb:BA000030_700465 Streptomyces avermitilis MA-4680 genomic DNA,...   121   2e-26   
gb:AE013477_292671 Methanosarcina mazei strain Goe1, section 259...   121   2e-26   
sp|Q8MI17|DHA1_RABIT|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   121   2e-26   Oryctolagus cuniculus [domestic rabbit]
gb:AY123972_590629 Arthrobacter sp. BP2 cyclohexanone oxidation ...   120   3e-26   
pir|C95964|C95964 probable aldehyde dehydrogenase protein (EC 1....   120   3e-26   Sinorhizobium meliloti
gb:BX571965_790622 Burkholderia pseudomallei strain K96243, chro...   120   4e-26   
gb:AY596298_634885 Haloarcula marismortui ATCC 43049 chromosome ...   120   4e-26   
sp|Q53197|Y4UC_RHISN|Y4UC_RHISN Hypothetical aldehyde-dehydrogenase like pr...   120   4e-26   Rhizobium sp.
gb:BA000030_702903 Streptomyces avermitilis MA-4680 genomic DNA,...   120   5e-26   
gb:AP006627_563436 Bacillus clausii KSM-K16 DNA, complete genome.     120   5e-26   
gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6...   119   6e-26   
pir|E75574|E75574 aldehyde dehydrogenase - Deinococcus radiodura...   119   6e-26   Deinococcus radiodurans
pir|A70318|A70318 aldehyde dehydrogenase - Aquifex aeolicus>gb:A...   119   6e-26   Aquifex aeolicus
gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA (...   119   8e-26   
gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial a...   119   8e-26   
gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precurs...   119   8e-26   
gb:AF162770_2477781 Taeniopygia guttata class I aldehyde dehydro...   119   8e-26   
gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3 m...   119   8e-26   
sp|Q29490|DHAE_MACPR|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   119   8e-26   Macroscelides proboscideus
gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH...   119   1e-25   
gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-li...   119   1e-25   
gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1...   119   1e-25   
gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogen...   119   1e-25   
gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, comple...   119   1e-25   
gb:AE017005_377162 Bacillus cereus ATCC 14579 section 8 of 18 of...   119   1e-25   
gb:CR628337_115381 Legionella pneumophila str. Lens complete gen...   119   1e-25   
sp|Q28399|DHAE_ELEED|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   119   1e-25   Elephantulus edwardii [Cape long-eared elephant shrew]
gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6 m...   118   1e-25   
gb:AY052630_586928 Rhodococcus ruber strain SC1 cyclododecanone ...   118   1e-25   
gb:AE010805_266707 Methanosarcina acetivorans str. C2A, section ...   118   1e-25   
pir|F83355|F83355 probable glyceraldehyde-3-phosphate dehydrogen...   118   1e-25   Pseudomonas aeruginosa
pir|T31293|T31293 aldehyde dehydrogenase homolog - Sphingomonas ...   118   1e-25   Novosphingobium aromaticivorans
gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone MGC:...   118   2e-25   
sp|Q29491|DHAN_MACPR|DHAN_MACPR Aldehyde dehydrogenase, cytosolic 2 (EC 1.2...   117   2e-25   Macroscelides proboscideus
gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde de...   117   3e-25   
gb:HUMALDH1Z_2029126 Human aldehyde dehydrogenase I (ALDH-1) mRN...   117   3e-25   
gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1...   117   3e-25   
gb:BA000028_697250 Oceanobacillus iheyensis HTE831 DNA, complete...   117   3e-25   
gb:AE017354_460602 Legionella pneumophila subsp. pneumophila str...   117   3e-25   
gb:AE017271_423374 Bacillus cereus ATCC 10987, section 8 of 18 o...   117   3e-25   
gb:PSP296087_161304 Pseudonocardia sp. K1 ORF y, thmS gene, thma...   117   3e-25   
pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1, c...   117   3e-25   
sp|P00352|DHA1_HUMAN|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   117   3e-25   Homo sapiens [man]
gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyd...   117   4e-25   
gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (fro...   117   4e-25   
gb:AE017333_446654 Bacillus licheniformis DSM 13, complete genom...   117   4e-25   
gb:CR628336_112321 Legionella pneumophila str. Paris complete ge...   117   4e-25   
gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3 m...   116   5e-25   
gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, compl...   116   5e-25   
gb:BA000031_707232 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   116   5e-25   
gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC c...   116   7e-25   
gb:BX572605_803373 Rhodopseudomonas palustris CGA009 complete ge...   116   7e-25   
gb:BA000035_714864 Corynebacterium efficiens YS-314 DNA, complet...   116   7e-25   
pir|T44987|T44987 aldehyde dehydrogenase (EC 1.2.1.-) [imported]...   116   7e-25   Haloferax volcanii
gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA, co...   115   9e-25   
pir|H95380|H95380 probable betaine-aldehyde dehydrogenase (EC 1....   115   9e-25   Sinorhizobium meliloti
pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3), cyt...   115   9e-25   
sp|P51977|DHA1_SHEEP|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   115   9e-25   Ovis aries [domestic sheep]
sp|P48644|DHA1_BOVIN|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   115   9e-25   Bos taurus [bovine]
gb:BA000043_736951 Geobacillus kaustophilus HTA426 DNA, complete...   115   1e-24   
gb:BA000037_722411 Vibrio vulnificus YJ016 DNA, chromosome I, co...   115   1e-24   
gb:AB052732_7655 Geobacillus stearothermophilus genes for unknow...   115   1e-24   
gb:BA000045_743923 Gloeobacter violaceus PCC 7421 DNA, complete ...   115   2e-24   
gb:AE017355_463376 Bacillus thuringiensis serovar konkukian str....   115   2e-24   
gb:AE017031_382402 Bacillus anthracis str. Ames section 8 of 18 ...   115   2e-24   
gb:AE016787_333060 Pseudomonas putida KT2440 section 14 of 21 of...   115   2e-24   
gb:AE016776_330104 Pseudomonas putida KT2440 section 3 of 21 of ...   115   2e-24   
gb:AE006189_216418 Pasteurella multocida subsp. multocida str. P...   115   2e-24   
gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA ...   114   2e-24   
gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (c...   114   2e-24   
gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1 ...   114   2e-24   
gb:BX927156_834202 Corynebacterium glutamicum ATCC 13032, IS fin...   114   2e-24   
gb:BA000036_720395 Corynebacterium glutamicum ATCC 13032 DNA, co...   114   2e-24   
gb:AE016786_332859 Pseudomonas putida KT2440 section 13 of 21 of...   114   2e-24   
gb:AB112586_13741 Streptomyces sp. WA46 genes for salicylate deg...   114   2e-24   
sp|Q8HYE4|DHA1_MACFA|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   114   2e-24   Macaca fascicularis [crab eating macaque]
gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1 f...   114   3e-24   
gb:AE017340_457746 Idiomarina loihiensis L2TR, complete genome.       114   3e-24   
gb:AE017333_446206 Bacillus licheniformis DSM 13, complete genom...   114   3e-24   
gb:CR543861_102568 Acinetobacter sp. ADP1 complete genome.            114   3e-24   
sp|P27463|DHA1_CHICK|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   114   3e-24   Gallus gallus [bantam]
gb:BX571965_791439 Burkholderia pseudomallei strain K96243, chro...   114   3e-24   
gb:BA000028_697256 Oceanobacillus iheyensis HTE831 DNA, complete...   114   3e-24   
gb:CR378680_98479 Photobacterium profundum SS9 chromosome 2; seg...   114   3e-24   
pir|T50272|T50272 probable aldehyde dehydrogenase [imported] - f...   114   3e-24   Schizosaccharomyces pombe
gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from...   113   4e-24   
gb:BA000035_716370 Corynebacterium efficiens YS-314 DNA, complet...   113   4e-24   
gb:AY596297_633304 Haloarcula marismortui ATCC 43049 chromosome ...   113   4e-24   
gb:AE017271_423540 Bacillus cereus ATCC 10987, section 8 of 18 o...   113   4e-24   
pir|C69814|C69814 benzaldehyde dehydrogenase homolog yfmT - Baci...   113   4e-24   Bacillus subtilis
pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB, ...   113   4e-24   Rattus norvegicus [brown rat]
sp|P08157|DHAL_EMENI|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   113   4e-24   Aspergillus nidulans
sp|P13601|DHAC_RAT|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1...   113   4e-24   Rattus norvegicus [brown rat]
gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde de...   113   6e-24   
gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family...   113   6e-24   
gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on...   113   6e-24   
gb:AX064887_1459357 Sequence 13 from Patent WO0100844.                113   6e-24   
gb:BX571856_782112 Staphylococcus aureus subsp. aureus strain MR...   113   6e-24   
gb:BA000036_717777 Corynebacterium glutamicum ATCC 13032 DNA, co...   113   6e-24   
gb:AP006627_565332 Bacillus clausii KSM-K16 DNA, complete genome.     113   6e-24   
gb:AE016794_334751 Pseudomonas putida KT2440 section 21 of 21 of...   113   6e-24   
gb:CP000046_92696 Staphylococcus aureus subsp. aureus COL, compl...   113   6e-24   
pir|E90068|E90068 glycine betaine aldehyde dehydrogenase gbsA [i...   113   6e-24   Staphylococcus aureus subsp. aureus Mu50
pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5 pr...   113   6e-24   Homo sapiens [man]
sp|P30837|DHA5_HUMAN|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial pre...   113   6e-24   Homo sapiens [man]
sp|P42236|DHA1_BACSU|DHA1_BACSU Probable aldehyde dehydrogenase ycbD (EC 1....   113   6e-24   Bacillus subtilis
gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c...   112   7e-24   
gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA, co...   112   7e-24   
gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1...   112   7e-24   
gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1...   112   7e-24   
gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase ...   112   7e-24   
gb:CP000009_863696 Gluconobacter oxydans 621H, complete genome.       112   7e-24   
gb:AP008226_578453 Thermus thermophilus HB8 genomic DNA, complet...   112   7e-24   
gb:AF339846_502835 Microscilla sp. PRE1 plasmid pSD15, complete ...   112   7e-24   
gb:AE017246_415135 Treponema denticola ATCC 35405, section 1 of ...   112   7e-24   
pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - ra...   112   7e-24   Rattus norvegicus [brown rat]
pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -...   112   7e-24   Rattus norvegicus [brown rat]
sp|O14293|YF19_SCHPO|YF19_SCHPO Hypothetical aldehyde-dehydrogenase like pr...   112   7e-24   Schizosaccharomyces pombe
sp|P51647|DHA1_RAT|DHA1_RAT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Alde...   112   7e-24   Rattus norvegicus [brown rat]
sp|P24549|DHA1_MOUSE|DHA1_MOUSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   112   7e-24   Mus musculus [mouse]
gb:AF260125_1781465 Aspergillus nidulans aldehyde dehydrogenase ...   112   1e-23   
gb:CP000001_852680 Bacillus cereus ZK, complete genome.               112   1e-23   
gb:AE017303_436274 Thermus thermophilus HB27 section 3 of 7 of t...   112   1e-23   
gb:AE017282_428492 Methylococcus capsulatus str. Bath, complete ...   112   1e-23   
gb:AE013309_291168 Methanosarcina mazei strain Goe1, section 91 ...   112   1e-23   
gb:AE010557_264351 Fusobacterium nucleatum subsp. nucleatum ATCC...   112   1e-23   
gb:AE006190_216424 Pasteurella multocida subsp. multocida str. P...   112   1e-23   
pir|JQ1004|JQ1004 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1 pr...   112   1e-23   Mus musculus [mouse]
sp|P28237|DHAB_BETVU|DHAB_BETVU Betaine-aldehyde dehydrogenase, chloroplast...   112   1e-23   Beta vulgaris [beet]
gb:AE016814_1745755 Ashbya gossypii (= Eremothecium gossypii) AT...   112   1e-23   
gb:BVBADHD_1643071 B.vulgaris mRNA for salt-inducible betaine al...   112   1e-23   
gb:BX936398_836283 Yersinia pseudotuberculosis IP32953 genome, c...   112   1e-23   
gb:BA000043_739605 Geobacillus kaustophilus HTA426 DNA, complete...   112   1e-23   
gb:BA000043_737988 Geobacillus kaustophilus HTA426 DNA, complete...   112   1e-23   
gb:AY437859_617604 Brachymonas petroleovorans cyclohexanone gene...   112   1e-23   
gb:AE011120_269363 Methanosarcina acetivorans str. C2A, section ...   112   1e-23   
pir|S00364|S00364 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2, m...   112   1e-23   Equus caballus [domestic horse]
sp|P47738|DHAM_MOUSE|DHAM_MOUSE Aldehyde dehydrogenase, mitochondrial precu...   112   1e-23   Mus musculus [mouse]
sp|P81178|DHAM_MESAU|DHAM_MESAU Aldehyde dehydrogenase, mitochondrial (EC 1...   112   1e-23   Mesocricetus auratus [Syrian golden hamster]
sp|P12762|DHAM_HORSE|DHAM_HORSE Aldehyde dehydrogenase, mitochondrial (EC 1...   112   1e-23   Equus caballus [domestic horse]
sp|P40108|DHAL_CLAHE|DHAL_CLAHE Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   112   1e-23   Cladosporium herbarum
gb:AY566469_2086589 Rattus norvegicus mitochondrial aldehyde deh...   111   2e-23   
gb:AY566468_2086588 Rattus norvegicus mitochondrial aldehyde deh...   111   2e-23   
gb:AY566467_2086587 Rattus norvegicus mitochondrial aldehyde deh...   111   2e-23   
gb:AY034137_2074207 Rattus norvegicus aldehyde dehydrogenase gen...   111   2e-23   
gb:AF529165_2067592 Rattus norvegicus mitochondrial aldehyde deh...   111   2e-23   
gb:CR382138_1671743 Debaryomyces hansenii chromosome F of strain...   111   2e-23   
gb:AY093682_1575361 Atriplex centralasiatica betaine aldehyde de...   111   2e-23   
gb:BX571871_788594 Photorhabdus luminescens subsp. laumondii TTO...   111   2e-23   
gb:BA000045_742830 Gloeobacter violaceus PCC 7421 DNA, complete ...   111   2e-23   
gb:BA000012_666891 Mesorhizobium loti MAFF303099 DNA, complete g...   111   2e-23   
gb:CR555306_108224 Azoarcus sp. EbN1 complete genome.                 111   2e-23   
sp|P11884|DHAM_RAT|DHAM_RAT Aldehyde dehydrogenase, mitochondrial precurs...   111   2e-23   
gb:BT007942_2150874 Synthetic construct Homo sapiens aldehyde de...   111   2e-23   
gb:HUMALDH2_2029127 Human aldehyde dehydrogenase 2 mRNA.>gb:HUMA...   111   2e-23   
gb:HUMALDH13_2029124 Human nucleus-encoded mitochondrial aldehyd...   111   2e-23   
gb:HSALDHIR_2010484 Human mRNA for mitochondrial aldehyde dehydr...   111   2e-23   
gb:HSALDHI1_2010483 Human RNA for mitochondrial aldehyde dehydro...   111   2e-23   
gb:AY621070_1957710 Homo sapiens mitochondrial aldehyde dehydrog...   111   2e-23   
gb:AF260123_1781463 Aspergillus nidulans aldehyde dehydrogenase ...   111   2e-23   
gb:BX640438_813295 Bordetella bronchiseptica strain RB50, comple...   111   2e-23   
gb:BX640424_808890 Bordetella parapertussis strain 12822, comple...   111   2e-23   
gb:BA000028_696634 Oceanobacillus iheyensis HTE831 DNA, complete...   111   2e-23   
gb:ANI507836_553452 Arthrobacter nicotinovorans pAO1 plasmid seq...   111   2e-23   
gb:AF346500_503286 Photorhabdus luminescens strain W14 toxin com...   111   2e-23   
pir|F98208|F98208 succinate-semialdehyde dehydrogenase PA0265 [i...   111   2e-23   
pir|T50359|T50359 probable aldehyde-dehydrogenase-like protein [...   111   2e-23   
sp|P05091|DHAM_HUMAN|DHAM_HUMAN Aldehyde dehydrogenase, mitochondrial precu...   111   2e-23   
gb:CR857362_1181605 Pongo pygmaeus mRNA; cDNA DKFZp469J1332 (fro...   110   3e-23   
gb:CP000011_868694 Burkholderia mallei ATCC 23344 chromosome 2, ...   110   3e-23   
gb:BX571966_793515 Burkholderia pseudomallei strain K96243, chro...   110   3e-23   
gb:CR543861_105369 Acinetobacter sp. ADP1 complete genome.            110   3e-23   
gb:CP000011_868215 Burkholderia mallei ATCC 23344 chromosome 2, ...   110   4e-23   
gb:BX571862_785843 Photorhabdus luminescens subsp. laumondii TTO...   110   4e-23   
gb:BA000012_669197 Mesorhizobium loti MAFF303099 DNA, complete g...   110   4e-23   
gb:AP006627_562748 Bacillus clausii KSM-K16 DNA, complete genome.     110   4e-23   
gb:CP000029_82761 Staphylococcus epidermidis RP62A, complete gen...   110   4e-23   
pir|E95316|E95316 succinate-semialdehyde dehydrogenase [NAD(P)] ...   110   4e-23   
sp|P42757|DHAB_ATRHO|DHAB_ATRHO Betaine-aldehyde dehydrogenase, chloroplast...   110   4e-23   
gb:CR456991_1993198 Homo sapiens full open reading frame cDNA cl...   110   5e-23   
gb:AF359282_1791009 Suaeda liaotungensis betaine aldehyde dehydr...   110   5e-23   
gb:AK012213_1156839 Mus musculus 11 days embryo whole body cDNA,...   110   5e-23   
gb:BX640444_815000 Bordetella bronchiseptica strain RB50, comple...   110   5e-23   
gb:BX640426_809540 Bordetella parapertussis strain 12822, comple...   110   5e-23   
gb:BA000012_669648 Mesorhizobium loti MAFF303099 DNA, complete g...   110   5e-23   
gb:AP006618_559173 Nocardia farcinica IFM 10152 DNA, complete ge...   110   5e-23   
gb:AF150928_483573 Acinetobacter sp. ADP1 BenP (benP) and AreR (...   110   5e-23   
gb:AE017235_413043 Mycobacterium avium subsp. paratuberculosis s...   110   5e-23   
gb:AE016866_352354 Pseudomonas syringae pv. tomato str. DC3000 s...   110   5e-23   
gb:CR543861_103391 Acinetobacter sp. ADP1 complete genome.            110   5e-23   
pir|T36346|T36346 probable aldehyde dehydrogenase - Streptomyces...   110   5e-23   
sp|O74187|DHAL_AGABI|DHAL_AGABI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   110   5e-23   
gb:AE017346_1757528 Cryptococcus neoformans var. neoformans JEC2...   109   6e-23   
gb:BX571966_794613 Burkholderia pseudomallei strain K96243, chro...   109   6e-23   
gb:BA000040_731228 Bradyrhizobium japonicum USDA 110 DNA, comple...   109   6e-23   
gb:BA000012_668319 Mesorhizobium loti MAFF303099 DNA, complete g...   109   6e-23   
gb:AE017325_443365 Listeria monocytogenes str. 4b F2365, section...   109   6e-23   
gb:AE014292_310693 Brucella suis 1330 chromosome II, complete se...   109   6e-23   
gb:AE010731_266081 Methanosarcina acetivorans str. C2A, section ...   109   6e-23   
pir|AI1188|AI1188 succinate semialdehyde dehydrogenase homolog l...   109   6e-23   
pir|E70961|E70961 hypothetical protein Rv0223c - Mycobacterium t...   109   6e-23   
pir|T43153|T43153 probable aldehyde dehydrogenase (NAD) (EC 1.2....   109   6e-23   
sp|P38694|YHJ9_YEAST|YHJ9_YEAST Hypothetical aldehyde-dehydrogenase like pr...   109   6e-23   
gb:AF275347_1782534 Cladosporium fulvum aldehyde dehydrogenase (...   109   8e-23   
gb:AY256971_1593228 Atriplex triangularis betaine aldehyde dehyd...   109   8e-23   
gb:AY083902_1569264 Atriplex prostrata betaine aldehyde dehydrog...   109   8e-23   
gb:AY502075_622394 Rhodococcus sp. DK17 plasmid pDK2, partial se...   109   8e-23   
gb:AY316747_608952 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...   109   8e-23   
gb:AE016783_331913 Pseudomonas putida KT2440 section 10 of 21 of...   109   8e-23   
gb:AE014292_310560 Brucella suis 1330 chromosome II, complete se...   109   8e-23   
gb:CP000029_82321 Staphylococcus epidermidis RP62A, complete gen...   109   8e-23   
sp|P42329|DHAL_BACST|DHAL_BACST Aldehyde dehydrogenase, thermostable (EC 1....   109   8e-23   
gb:BA000030_705021 Streptomyces avermitilis MA-4680 genomic DNA,...   108   1e-22   
gb:AE017229_411460 Mycobacterium avium subsp. paratuberculosis s...   108   1e-22   
gb:AE016999_375353 Bacillus cereus ATCC 14579 section 2 of 18 of...   108   1e-22   
gb:CR543861_102949 Acinetobacter sp. ADP1 complete genome.            108   1e-22   
gb:CR378677_97486 Photobacterium profundum SS9 chromosome 2; seg...   108   1e-22   
gb:AE004969_60421 Neisseria gonorrhoeae FA 1090, complete genome.     108   1e-22   
sp|P54222|DHAB_RHIME|DHAB_RHIME Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   108   1e-22   
gb:AF339837_2488543 Danio rerio retinaldehyde dehydrogenase type...   108   1e-22   
gb:AE017352_1759755 Cryptococcus neoformans var. neoformans JEC2...   108   1e-22   
gb:CR382123_1655936 Kluyveromyces lactis strain NRRL Y-1140 chro...   108   1e-22   
gb:AB181464_1529181 Fusarium solani genes for hypothetical prote...   108   1e-22   
gb:AE014134_1128355 Drosophila melanogaster chromosome 2L, compl...   108   1e-22   
gb:CP000011_867653 Burkholderia mallei ATCC 23344 chromosome 2, ...   108   1e-22   
gb:BX571966_795144 Burkholderia pseudomallei strain K96243, chro...   108   1e-22   
gb:BA000012_671509 Mesorhizobium loti MAFF303099 DNA, complete g...   108   1e-22   
gb:AY458649_620174 Uncultured bacterium 582 clone EBAC080-L028H0...   108   1e-22   
gb:AF249300_492601 Mycobacterium sp. PYR-1 aldehyde dehydrogenas...   108   1e-22   
gb:CP000031_85186 Silicibacter pomeroyi DSS-3, complete genome.       108   1e-22   
gb:AF315691_2487173 Danio rerio aldehyde dehydrogenase 1A2 mRNA,...   108   2e-22   
gb:AF288764_2485043 Danio rerio retinaldehyde dehydrogenase 2 (r...   108   2e-22   
gb:AP003617_1831493 Oryza sativa (japonica cultivar-group) genom...   108   2e-22   
gb:BA000043_738577 Geobacillus kaustophilus HTA426 DNA, complete...   108   2e-22   
gb:BA000043_738543 Geobacillus kaustophilus HTA426 DNA, complete...   108   2e-22   
gb:BA000033_712338 Staphylococcus aureus subsp. aureus MW2 DNA, ...   108   2e-22   
gb:AE017025_380602 Bacillus anthracis str. Ames section 2 of 18 ...   108   2e-22   
gb:AE016865_352094 Pseudomonas syringae pv. tomato str. DC3000 s...   108   2e-22   
gb:AE008827_244448 Salmonella typhimurium LT2, section 131 of 22...   108   2e-22   
gb:AE000516_20234 Mycobacterium tuberculosis CDC1551, complete g...   108   2e-22   
pir|H81848|H81848 probable aldehyde dehydrogenase NMA1565 [impor...   108   2e-22   
pir|D81093|D81093 aldehyde dehydrogenase family protein NMB1353 ...   108   2e-22   
pir|C95948|C95948 probable succinate-semialdehyde dehydrogenase ...   108   2e-22   
pir|T46684|T46684 p-hydroxybenzaldehyde dehydrogenase [imported]...   108   2e-22   
pir|H70962|H70962 probable gabD2 protein - Mycobacterium tubercu...   108   2e-22   
pir|AE0839|AE0839 succinate-semialdehyde dehydrogenase [NAD(P)] ...   108   2e-22   
gb:BX571856_781635 Staphylococcus aureus subsp. aureus strain MR...   107   2e-22   
gb:AF346500_503282 Photorhabdus luminescens strain W14 toxin com...   107   2e-22   
gb:AE016751_323816 Staphylococcus epidermidis ATCC 12228, sectio...   107   2e-22   
gb:CR378677_97708 Photobacterium profundum SS9 chromosome 2; seg...   107   2e-22   
gb:CP000026_77396 Salmonella enterica subsp. enterica serovar Pa...   107   2e-22   
pir|E82161|E82161 succinate-semialdehyde dehydrogenase VC1745 [i...   107   2e-22   
pir|B97460|B97460 betaine aldehyde dehydrogenase (badh) [importe...   107   2e-22   
pir|D69764|D69764 succinate-semialdehyde dehydrogenase homolog y...   107   2e-22   
pir|G90005|G90005 hypothetical protein SA1924 [imported] - Staph...   107   2e-22   
gb:AP003048_1824454 Oryza sativa (japonica cultivar-group) genom...   107   3e-22   
gb:CR380952_1650607 Candida glabrata strain CBS138 chromosome F ...   107   3e-22   
gb:AE017240_414367 Mycobacterium avium subsp. paratuberculosis s...   107   3e-22   
gb:AE016865_352087 Pseudomonas syringae pv. tomato str. DC3000 s...   107   3e-22   
gb:AY093684_1575363 Atriplex centralasiatica betaine aldehyde de...   107   4e-22   
gb:CP000001_850928 Bacillus cereus ZK, complete genome.               107   4e-22   
gb:BA000031_708090 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   107   4e-22   
gb:AY596297_633880 Haloarcula marismortui ATCC 43049 chromosome ...   107   4e-22   
gb:AE017265_421591 Bacillus cereus ATCC 10987, section 2 of 18 o...   107   4e-22   
pir|B87638|B87638 succinate-semialdehyde dehydrogenase [imported...   107   4e-22   
pir|AF2433|AF2433 aldehyde dehydrogenase [imported] - Nostoc sp....   107   4e-22   
pir|AI1546|AI1546 succinate semialdehyde dehydrogenase homolog l...   107   4e-22   
gb:CR380952_1650556 Candida glabrata strain CBS138 chromosome F ...   106   5e-22   
gb:AY156694_1585396 Spinacia oleracea betaine aldehyde dehydroge...   106   5e-22   
gb:BX572594_800077 Rhodopseudomonas palustris CGA009 complete ge...   106   5e-22   
gb:AY596296_631510 Haloarcula marismortui ATCC 43049 plasmid pNG...   106   5e-22   
gb:AP006627_566125 Bacillus clausii KSM-K16 DNA, complete genome.     106   5e-22   
gb:AP006627_563771 Bacillus clausii KSM-K16 DNA, complete genome.     106   5e-22   
gb:AE017234_412789 Mycobacterium avium subsp. paratuberculosis s...   106   5e-22   
gb:AE005674_73967 Shigella flexneri 2a str. 301, complete genome...   106   5e-22   
sp|P41751|DHAL_ASPNG|DHAL_ASPNG Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   106   5e-22   
sp|P17202|DHAB_SPIOL|DHAB_SPIOL Betaine-aldehyde dehydrogenase, chloroplast...   106   5e-22   
sp|Q9S795|DHAB_ARATH|DHAB_ARATH Betaine-aldehyde dehydrogenase, chloroplast...   106   5e-22   
gb:CR382139_1673028 Debaryomyces hansenii chromosome G of strain...   106   7e-22   
gb:BA000012_670400 Mesorhizobium loti MAFF303099 DNA, complete g...   106   7e-22   
gb:AP006618_559169 Nocardia farcinica IFM 10152 DNA, complete ge...   106   7e-22   
gb:AF323606_500550 Rhodococcus erythropolis picric acid degradat...   106   7e-22   
gb:AE016827_343180 Mannheimia succiniciproducens MBEL55E, comple...   106   7e-22   
gb:RMU39940_166496 Sinorhizobium meliloti bet operon, complete s...   106   7e-22   
gb:EC4HPADNA_124770 E.coli hpa[G,R,E,D,F,H,I,X,A,B,C] genes.          106   7e-22   
gb:AB000735_254 Nocardioides sp. genes for 2-carboxybenzaldehyde...   106   7e-22   
pir|AI3544|AI3544 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) [imp...   106   7e-22   
pir|AB2975|AB2975 succinate semialdehyde dehydrogenase attK2 [im...   106   7e-22   
sp|P38067|UGA2_YEAST|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP+...   106   7e-22   
sp|P32872|DHAY_YEAST|DHAY_YEAST Aldehyde dehydrogenase 2, mitochondrial pre...   106   7e-22   
sp|O04895|DHAB_AMAHP|DHAB_AMAHP Betaine-aldehyde dehydrogenase, chloroplast...   106   7e-22   
gb:AY804192_1628642 Chorispora bungeana betaine-aldehyde dehydro...   105   9e-22   
gb:U00051_1401533 Caenorhabditis elegans cosmid F42G9, complete ...   105   9e-22   
gb:AY598949_635143 Sphingomonas sp. tfd44 chlorocatechol catabol...   105   9e-22   
gb:AE017233_412363 Mycobacterium avium subsp. paratuberculosis s...   105   9e-22   
gb:AE012341_281570 Xanthomonas campestris pv. campestris str. AT...   105   9e-22   
gb:D90890_123964 E.coli genomic DNA, Kohara clone #443(59.8-60.2...   105   9e-22   
gb:CR628337_114646 Legionella pneumophila str. Lens complete gen...   105   9e-22   
gb:CR628336_111656 Legionella pneumophila str. Paris complete ge...   105   9e-22   
gb:CP000026_76552 Salmonella enterica subsp. enterica serovar Pa...   105   9e-22   
pir|T16352|T16352 hypothetical protein F42G9.5 - Caenorhabditis ...   105   9e-22   
pir|H83131|H83131 5-carboxy-2-hydroxymuconate semialdehyde dehyd...   105   9e-22   
pir|I61704|I61704 succinate-semialdehyde dehydrogenase (EC 1.2.1...   105   9e-22   
sp|P51650|SSDH_RAT|SSDH_RAT Succinate semialdehyde dehydrogenase (EC 1.2....   105   9e-22   
sp|P25526|GABD_ECOLI|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP+...   105   9e-22   
sp|P20000|DHAM_BOVIN|DHAM_BOVIN Aldehyde dehydrogenase, mitochondrial precu...   105   9e-22   
gb:AF170919_2057679 Mus musculus 4-trimethylaminobutyraldehyde d...   105   1e-21   
gb:PSA315852_1701971 Pisum sativum mRNA for aminoaldehyde dehydr...   105   1e-21   
gb:CR382123_1655809 Kluyveromyces lactis strain NRRL Y-1140 chro...   105   1e-21   
gb:AF106575_1241652 Caenorhabditis elegans cosmid K04F1, complet...   105   1e-21   
gb:HSM800910_1185982 Homo sapiens mRNA; cDNA DKFZp434N221 (from ...   105   1e-21   
gb:BX936398_838188 Yersinia pseudotuberculosis IP32953 genome, c...   105   1e-21   
gb:BX294152_771057 Pirellula sp. strain 1 complete genome; segme...   105   1e-21   
gb:AE016924_358888 Chromobacterium violaceum ATCC 12472 section ...   105   1e-21   
gb:AE008912_246110 Salmonella typhimurium LT2, section 216 of 22...   105   1e-21   
gb:CP000032_87908 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   105   1e-21   
pir|T51173|T51173 betaine-aldehyde dehydrogenase (EC 1.2.1.8) [i...   105   1e-21   
pir|D88956|D88956 protein K04F1.15 [imported] - Caenorhabditis e...   105   1e-21   
sp|Q25417|DHAM_LEITA|DHAM_LEITA Aldehyde dehydrogenase, mitochondrial precu...   105   1e-21   
gb:AE017344_1756115 Cryptococcus neoformans var. neoformans JEC2...   105   2e-21   
gb:CR382132_1665124 Yarrowia lipolytica chromosome F of strain C...   105   2e-21   
gb:AY651063_1620163 Musa acuminata betaine-aldehyde dehydrogenas...   105   2e-21   
gb:BA000043_738003 Geobacillus kaustophilus HTA426 DNA, complete...   105   2e-21   
gb:BA000040_729067 Bradyrhizobium japonicum USDA 110 DNA, comple...   105   2e-21   
gb:BA000037_722415 Vibrio vulnificus YJ016 DNA, chromosome I, co...   105   2e-21   
gb:BA000030_705046 Streptomyces avermitilis MA-4680 genomic DNA,...   105   2e-21   
gb:AL646086_549981 Ralstonia solanacearum GMI1000 megaplasmid, c...   105   2e-21   
gb:AE017354_459951 Legionella pneumophila subsp. pneumophila str...   105   2e-21   
gb:AE016963_368403 Coxiella burnetii strain RSA 493, section 4 o...   105   2e-21   
pir|D85913|D85913 succinate-semialdehyde dehydrogenase [imported...   105   2e-21   
sp|P15437|DHA1_HORSE|DHA1_HORSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   105   2e-21   
gb:AJ621749_1907025 Pongo pygmaeus mRNA for succinic semialdehyd...   104   2e-21   
gb:AY083903_1569265 Atriplex prostrata betaine aldehyde dehydrog...   104   2e-21   
gb:AK052703_1170153 Mus musculus 0 day neonate kidney cDNA, RIKE...   104   2e-21   
gb:BX640439_813390 Bordetella bronchiseptica strain RB50, comple...   104   2e-21   
gb:BX248361_763580 Corynebacterium diphtheriae gravis NCTC13129,...   104   2e-21   
gb:BA000030_702537 Streptomyces avermitilis MA-4680 genomic DNA,...   104   2e-21   
gb:AY255829_602861 Erwinia sp. Ejp 556 plasmid pEJ30, complete s...   104   2e-21   
gb:AE017355_463599 Bacillus thuringiensis serovar konkukian str....   104   2e-21   
gb:AE017032_382613 Bacillus anthracis str. Ames section 9 of 18 ...   104   2e-21   
gb:AE016765_327203 Escherichia coli CFT073 section 11 of 18 of t...   104   2e-21   
gb:CR543861_102996 Acinetobacter sp. ADP1 complete genome.            104   2e-21   
pir|T51172|T51172 betaine-aldehyde dehydrogenase (EC 1.2.1.8) [i...   104   2e-21   
gb:CR380949_1649590 Candida glabrata strain CBS138 chromosome C ...   104   3e-21   
gb:CP000001_852863 Bacillus cereus ZK, complete genome.               104   3e-21   
gb:BX950851_839037 Erwinia carotovora subsp. atroseptica SCRI104...   104   3e-21   
gb:BX640412_804805 Bordetella pertussis strain Tohama I, complet...   104   3e-21   
gb:BX571857_782354 Staphylococcus aureus strain MSSA476, complet...   104   3e-21   
gb:BX571856_779640 Staphylococcus aureus subsp. aureus strain MR...   104   3e-21   
gb:BA000028_694879 Oceanobacillus iheyensis HTE831 DNA, complete...   104   3e-21   
gb:AE017303_436233 Thermus thermophilus HB27 section 3 of 7 of t...   104   3e-21   
gb:AE016785_332573 Pseudomonas putida KT2440 section 12 of 21 of...   104   3e-21   
gb:PPU24215_159570 Pseudomonas putida p-cymene catabolism (cym) ...   104   3e-21   
gb:CP000046_90333 Staphylococcus aureus subsp. aureus COL, compl...   104   3e-21   
pir|T36847|T36847 probable aldehyde dehydrogenase - Streptomyces...   104   3e-21   
pir|C89778|C89778 hypothetical protein aldA [imported] - Staphyl...   104   3e-21   
gb:AJ621750_1907026 Pongo pygmaeus mRNA for succinic semialdehyd...   103   3e-21   
gb:CR382126_1658915 Kluyveromyces lactis strain NRRL Y-1140 chro...   103   3e-21   
gb:BX571862_785847 Photorhabdus luminescens subsp. laumondii TTO...   103   3e-21   
gb:AB073151_9752 Comamonas sp. NCIMB 9872 cyclopentanol metaboli...   103   3e-21   
pir|C95279|C95279 GabD3 succinate-semialdehyde dehdyrogenase [im...   103   3e-21   
pir|A95389|A95389 succinate-semialdehyde dehydrogenase [NAD(P)] ...   103   3e-21   
sp|P40047|DHA5_YEAST|DHA5_YEAST Aldehyde dehydrogenase, mitochondrial precu...   103   3e-21   
gb:AF348415_1790092 Zea mays cytosolic aldehyde dehydrogenase RF...   103   5e-21   
gb:AF348414_1790091 Zea mays cytosolic aldehyde dehydrogenase RF...   103   5e-21   
gb:AF348412_1790089 Zea mays cytosolic aldehyde dehydrogenase RF...   103   5e-21   
gb:AE014297_1141434 Drosophila melanogaster chromosome 3R, compl...   103   5e-21   


>sp|P93338|GAPN_NICPL NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase (EC 1.2.1.9) (Non-phosphorylating
           glyceraldehyde 3-phosphate dehydrogenase)
           (Glyceraldehyde-3-phosphate dehydrogenase [NADP+])
           (Triosephosphate dehydrogenase).>gb:NPU87848_1691136
           Nicotiana plumbaginifolia non-phosphorylating
           glyceraldehyde dehydrogenase (GapN) mRNA, complete cds.
          Length = 496

 Score =  440 bits (1131), Expect = e-122
 Identities = 220/250 (88%), Positives = 227/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG+AI KK+G   PLQMELGGKDACIVLEDAD+DLAA ++VKGGFSYSGQRCTAVKVVLV
Sbjct: 248 TGVAISKKAGM-IPLQMELGGKDACIVLEDADLDLAAGSIVKGGFSYSGQRCTAVKVVLV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVAD              VG PEDDCDITPVVSESSANFIEGLV DAK+K ATFCQ Y
Sbjct: 307 MESVADALVEKVNAKVAKLTVGPPEDDCDITPVVSESSANFIEGLVMDAKQKNATFCQQY 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLLLD+VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK
Sbjct: 367 KREGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI
Sbjct: 427 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 486

Query: 181 NLPTPSYTMG 152
           NLPTPSYTMG
Sbjct: 487 NLPTPSYTMG 496



>sp|P81406|GAPN_PEA NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase (EC 1.2.1.9) (Non-phosphorylating
           glyceraldehyde 3-phosphate dehydrogenase)
           (Glyceraldehyde-3-phosphate dehydrogenase [NADP+])
           (Triosephosphate dehydrogenase).>gb:PSRNAGAPN_1702381
           P.sativum (Rosakrone) mRNA for nonphosphorylating,
           NADP-specific, glyceraldehyde-3-phosphate
           dehydrogenase.>gb:U34988_1726333 Pisum sativum
           non-phosphorylating glyceraldehyde-3-phosphate
           dehydrogenase (gapN) gene, complete cds.
          Length = 496

 Score =  439 bits (1128), Expect = e-122
 Identities = 220/250 (88%), Positives = 227/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KKSG   PLQMELGGKDACIVLEDAD+DL AAN++KGGFSYSGQRCTAVKVVLV
Sbjct: 248 TGIAISKKSGM-IPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVAD              VG PEDD DITPVVSESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 307 MESVADALVEKVKVKVAKLSVGPPEDDSDITPVVSESSANFIEGLVNDAKEKGATFCQEY 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLLLD+VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK
Sbjct: 367 KREGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAI+ISDAME+GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI
Sbjct: 427 DINKAIMISDAMESGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 486

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 487 NLPSPSYTMG 496



>pir|S43832|S43832 glyceraldehyde-3-phosphate dehydrogenase (NADP)
           (EC 1.2.1.9) - garden pea
          Length = 496

 Score =  436 bits (1120), Expect = e-121
 Identities = 219/250 (87%), Positives = 226/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KKSG   PLQMELGGKDACIVLEDAD+DL AAN++KGGFSYSGQRCTAVKVVLV
Sbjct: 248 TGIAISKKSGM-IPLQMELGGKDACIVLEDADLDLVAANIIKGGFSYSGQRCTAVKVVLV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVAD              VG PEDD DITPVVSESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 307 MESVADALVEKVKVKVAKLSVGPPEDDSDITPVVSESSANFIEGLVNDAKEKGATFCQEY 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLLLD+VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK
Sbjct: 367 KREGNLIWPLLLDNVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAI+ISDAME+GTVQINSAPARGPDHF FQGIKDSGIGSQGITNSINMMTKVKTTVI
Sbjct: 427 DINKAIMISDAMESGTVQINSAPARGPDHFSFQGIKDSGIGSQGITNSINMMTKVKTTVI 486

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 487 NLPSPSYTMG 496



>gb:AP004702_1843651 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0524F03.>gb:AP004703_1843665 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0528B09.
          Length = 499

 Score =  433 bits (1114), Expect = e-120
 Identities = 215/250 (86%), Positives = 226/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KK+G   PLQMELGGKDAC+VLEDAD+DL AAN+VKGGFSYSGQRCTAVKVVL+
Sbjct: 251 TGIAISKKAGM-VPLQMELGGKDACVVLEDADLDLVAANIVKGGFSYSGQRCTAVKVVLI 309

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVAD              VG PE D DITPVV+ESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 310 MESVADIVVEKVKAKLAKLTVGPPEADSDITPVVTESSANFIEGLVMDAKEKGATFCQEY 369

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           +REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK
Sbjct: 370 RREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 429

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAI+ISDAMETGTVQINSAPARGPDHFPFQG+KDSGIGSQGITNSINMMTKVK+TVI
Sbjct: 430 DINKAIMISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVI 489

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 490 NLPSPSYTMG 499



>gb:AY224439_1590641 Oryza sativa (japonica cultivar-group) isolate
            22820 NADH-dependent glyceraldehyde-3-phosphate
            dehydrogenase mRNA, partial cds.
          Length = 508

 Score =  433 bits (1114), Expect = e-120
 Identities = 215/250 (86%), Positives = 226/250 (90%)
 Frame = -2

Query: 901  TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
            TGIAI KK+G   PLQMELGGKDAC+VLEDAD+DL AAN+VKGGFSYSGQRCTAVKVVL+
Sbjct: 260  TGIAISKKAGM-VPLQMELGGKDACVVLEDADLDLVAANIVKGGFSYSGQRCTAVKVVLI 318

Query: 721  MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            MESVAD              VG PE D DITPVV+ESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 319  MESVADIVVEKVKAKLAKLTVGPPEADSDITPVVTESSANFIEGLVMDAKEKGATFCQEY 378

Query: 541  KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
            +REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK
Sbjct: 379  RREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 438

Query: 361  DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
            DINKAI+ISDAMETGTVQINSAPARGPDHFPFQG+KDSGIGSQGITNSINMMTKVK+TVI
Sbjct: 439  DINKAIMISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVI 498

Query: 181  NLPTPSYTMG 152
            NLP+PSYTMG
Sbjct: 499  NLPSPSYTMG 508



>sp|Q43272|GAPN_MAIZE NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase (EC 1.2.1.9) (Non-phosphorylating
           glyceraldehyde 3-phosphate dehydrogenase)
           (Glyceraldehyde-3-phosphate dehydrogenase [NADP+])
           (Triosephosphate dehydrogenase).>pir|S43833|S43833
           glyceraldehyde-3-phosphate dehydrogenase (NADP) (EC
           1.2.1.9) - maize>gb:ZMRNAGAPN_1732014 Z.mais (KW5330)
           mRNA for nonphosphorylating glyceraldehyde-3-phosphate
           dehydrogenase.
          Length = 498

 Score =  431 bits (1109), Expect = e-120
 Identities = 213/250 (85%), Positives = 226/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KK+G   PLQMELGGKDACIVLEDAD+DL +AN+VKGGFSYSGQRCTAVKVVL+
Sbjct: 250 TGIAISKKAGM-VPLQMELGGKDACIVLEDADLDLVSANIVKGGFSYSGQRCTAVKVVLI 308

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MES+AD              VG PEDD DITPVV+ESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 309 MESIADAVVQKVNAKLAKLKVGPPEDDSDITPVVTESSANFIEGLVMDAKEKGATFCQEY 368

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           +REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGC+FT+
Sbjct: 369 RREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCIFTR 428

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAILISDAMETGTVQINSAPARGPDHF FQG+KDSGIGSQGITNSINMMTKVK+TVI
Sbjct: 429 DINKAILISDAMETGTVQINSAPARGPDHFSFQGLKDSGIGSQGITNSINMMTKVKSTVI 488

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 489 NLPSPSYTMG 498



>gb:AF196292_1775953 Apium graveolens nonreversible
           glyceraldehyde-3-phosphate dehydrogenase mRNA, complete
           cds.
          Length = 496

 Score =  427 bits (1097), Expect = e-118
 Identities = 208/250 (83%), Positives = 226/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KK+G   PLQMELGGKDACIVLEDAD+DL A+NV+KGGFSYSGQRCTA+KV+LV
Sbjct: 248 TGIAISKKAGM-VPLQMELGGKDACIVLEDADLDLVASNVIKGGFSYSGQRCTAIKVILV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           M+SVAD              VG PED+ DITPVVSESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 307 MQSVADTLVEKVNAKVAKLTVGPPEDNSDITPVVSESSANFIEGLVKDAKEKGATFCQEY 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLLLD+V+PDMRIAWEEPFGP+LPVIRINS EEGIHHCNASNFGLQGCVFT+
Sbjct: 367 KREGNLIWPLLLDNVKPDMRIAWEEPFGPILPVIRINSAEEGIHHCNASNFGLQGCVFTR 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA+LISDAME+GT+QINSAPARGPDHFPFQG+KDSGIGSQGITNSINMMTK+KTTVI
Sbjct: 427 DINKAMLISDAMESGTIQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKIKTTVI 486

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 487 NLPSPSYTMG 496



>gb:AF357884_1790810 Oryza sativa glyceraldehyde-3-phosphate
            dehydrogenase mRNA, complete cds.
          Length = 507

 Score =  425 bits (1092), Expect = e-118
 Identities = 214/258 (82%), Positives = 226/258 (87%), Gaps = 8/258 (3%)
 Frame = -2

Query: 901  TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
            TGIAI KK+G   PLQMELGGKDAC+VLEDAD+DL AAN+VKGGFSYSGQ+CTAVKVVL+
Sbjct: 251  TGIAISKKAGM-VPLQMELGGKDACVVLEDADLDLVAANIVKGGFSYSGQKCTAVKVVLI 309

Query: 721  MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFC--- 551
            MESVAD              VG PE D DITPVV+ESSANFIEGLV DAKEKGATFC   
Sbjct: 310  MESVADIVVEKVKAKLAKLTVGPPEADSDITPVVTESSANFIEGLVMDAKEKGATFCKEK 369

Query: 550  -----QPYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFG 386
                 Q Y+REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFG
Sbjct: 370  GATFCQEYRREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFG 429

Query: 385  LQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMM 206
            LQGCVFTKDINKAI+ISDAMETGTVQINSAPARGPDHFPFQG+KDSGIGSQGITNSINMM
Sbjct: 430  LQGCVFTKDINKAIMISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMM 489

Query: 205  TKVKTTVINLPTPSYTMG 152
            TKVK+TVINLP+PSYTMG
Sbjct: 490  TKVKSTVINLPSPSYTMG 507



>pir|F84634|F84634 hypothetical protein At2g24270 [imported] -
           Arabidopsis thaliana>gb:AC005967_1533282 Arabidopsis
           thaliana chromosome 2 clone F27D4 map CIC06C07, complete
           sequence.>gb:AY037205_1560099 Arabidopsis thaliana
           At2g24270/F27D4.18 mRNA, complete
           cds.>gb:AY136409_1581910 Arabidopsis thaliana putative
           NADP-dependent glyceraldehyde-3-phosphate dehydrogenase
           (At2g24270) mRNA, complete cds.>gb:BT004551_1637585
           Arabidopsis thaliana At2g24270/F27D4.18 gene, complete
           cds.
          Length = 496

 Score =  422 bits (1086), Expect = e-117
 Identities = 209/250 (83%), Positives = 226/250 (90%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGI+I KK+G   PLQMELGGKDACIVL+DAD+DL A+N++KGGFSYSGQRCTAVKVVLV
Sbjct: 248 TGISISKKAGM-IPLQMELGGKDACIVLDDADLDLVASNIIKGGFSYSGQRCTAVKVVLV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVAD              VG PE++ DIT VVSESSANFIEGLV DAKEKGATFCQ Y
Sbjct: 307 MESVADELVEKVKAKVAKLTVGPPEENSDITAVVSESSANFIEGLVMDAKEKGATFCQEY 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLLLD+VRPDMRIAWEEPFGPV+PV+RINSVEEGI+HCNASNFGLQGCVFTK
Sbjct: 367 KREGNLIWPLLLDNVRPDMRIAWEEPFGPVVPVLRINSVEEGINHCNASNFGLQGCVFTK 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAILISDAMETGTVQINSAPARGPDHFPFQG+KDSGIGSQG+TNSIN+MTKVKTTVI
Sbjct: 427 DINKAILISDAMETGTVQINSAPARGPDHFPFQGLKDSGIGSQGVTNSINLMTKVKTTVI 486

Query: 181 NLPTPSYTMG 152
           NLPTPSY+MG
Sbjct: 487 NLPTPSYSMG 496



>gb:AY504666_1609789 Physcomitrella patens non-phosphorylating GAPDH
           (ALDH11A5) mRNA, complete cds.
          Length = 496

 Score =  393 bits (1009), Expect = e-108
 Identities = 191/250 (76%), Positives = 217/250 (86%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI +K+G   PLQMELGGKD C+VLEDAD++LAA NV+KGG+SYSGQRCTAVKV+ V
Sbjct: 248 TGIAISRKAGM-VPLQMELGGKDCCLVLEDADLELAANNVIKGGYSYSGQRCTAVKVICV 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           MESVA+              VG PED+CDITPVVS+SSANFI+GLV DA+ KGA F Q +
Sbjct: 307 MESVAEELVSKIVQKMTKLTVGMPEDNCDITPVVSQSSANFIQGLVEDAQAKGAKFHQEW 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KREGNLIWPLL+D+V PDMRIAWEEPFGPV+PVIRI +VEEGIHHCNA+NF LQGCVFTK
Sbjct: 367 KREGNLIWPLLIDNVTPDMRIAWEEPFGPVIPVIRIKTVEEGIHHCNANNFALQGCVFTK 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAIL+SDAME+GT+QIN+APARGPDHFPFQG++DSGIGSQGITNSI MMTK K+TVI
Sbjct: 427 DINKAILVSDAMESGTIQINAAPARGPDHFPFQGLRDSGIGSQGITNSIQMMTKTKSTVI 486

Query: 181 NLPTPSYTMG 152
           NLPT SYTMG
Sbjct: 487 NLPTESYTMG 496



>gb:AF521191_1807892 Triticum aestivum from leaf nonphosphorylating
           glyceraldehyde-3-phosphate dehydrogenase mRNA, complete
           cds.
          Length = 496

 Score =  358 bits (918), Expect = 1e-97
 Identities = 184/250 (73%), Positives = 198/250 (79%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KK+G   PL M L GKDACIV E AD+DL  AN+VKGGFSYSGQRC AVKVVL+
Sbjct: 248 TGIAISKKAGM-VPLXMXLXGKDACIVXEXADLDLVXANIVKGGFSYSGQRCNAVKVVLI 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           ME  AD              VG PE   DIT VV+ESSANFI G       +   F    
Sbjct: 307 MEXXADXVVZKVNAKLAKLKVGPPEXXXDITXVVTESSANFIXGSGBXCXGERXNFLPXV 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           + +G LIWPLLLDHVRPD  IAW EPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT+
Sbjct: 367 QEKGXLIWPLLLDHVRPDXXIAWXEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTR 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAI+ISDAME+GTVQINSAPARGPDHFPFQG+KDSGIGSQGITNSINMMTKVK+TVI
Sbjct: 427 DINKAIMISDAMESGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVI 486

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 487 NLPSPSYTMG 496



>gb:AF521190_1807891 Triticum aestivum from endosperm
           nonphosphorylating glyceraldehyde-3-phosphate
           dehydrogenase mRNA, complete cds.
          Length = 496

 Score =  358 bits (918), Expect = 1e-97
 Identities = 184/250 (73%), Positives = 198/250 (79%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI KK+G   PL M L GKDACIV E AD+DL  AN+VKGGFSYSGQRC AVKVVL+
Sbjct: 248 TGIAISKKAGM-VPLXMXLXGKDACIVXEXADLDLVXANIVKGGFSYSGQRCXAVKVVLI 306

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           ME  AD              VG PE   DIT VV+ESSANFI G       +   F    
Sbjct: 307 MEXXADXVVZKVNAKLAKLKVGPPEXXXDITXVVTESSANFIXGSGBXCXGERXNFLPXV 366

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           + +G LIWPLLLDHVRPD  IAW EPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT+
Sbjct: 367 QEKGXLIWPLLLDHVRPDXXIAWXEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTR 426

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKAI+ISDAME+GTVQINSAPARGPDHFPFQG+KDSGIGSQGITNSINMMTKVK+TVI
Sbjct: 427 DINKAIMISDAMESGTVQINSAPARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVI 486

Query: 181 NLPTPSYTMG 152
           NLP+PSYTMG
Sbjct: 487 NLPSPSYTMG 496



>gb:AE017267_422170 Bacillus cereus ATCC 10987, section 4 of 18 of
           the complete genome.>gb:AE017194_1060589 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 479

 Score =  265 bits (677), Expect = 9e-70
 Identities = 136/242 (56%), Positives = 170/242 (70%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ A  PL +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 238 TGKHLAKKA-AMIPLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 296

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+F++GLV DA EKGAT     
Sbjct: 297 HENVADELVGLLQEQVAKLSVGSPEQDSTIVPLIDDKSADFVQGLVDDAVEKGATIVIGN 356

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  DM++AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 357 KRERNLIYPTLIDHVTEDMKVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 416

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 417 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVL 476

Query: 181 NL 176
           NL
Sbjct: 477 NL 478



>gb:AE017000_375811 Bacillus cereus ATCC 14579 section 3 of 18 of
           the complete genome.>gb:AE016877_1016061 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 479

 Score =  263 bits (672), Expect = 3e-69
 Identities = 134/242 (55%), Positives = 170/242 (70%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ +  PL +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 238 TGKHLAKKA-SMIPLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 296

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+F++GLV DA EKGAT     
Sbjct: 297 HENVADELVSLLKAQVAELSVGSPEQDSTIVPLIDDKSADFVQGLVDDAVEKGATIVIGN 356

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  +M++AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 357 KRERNLIYPTLIDHVTEEMKVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 416

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 417 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVL 476

Query: 181 NL 176
           NL
Sbjct: 477 NL 478



>gb:AE017355_462077 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 479

 Score =  263 bits (671), Expect = 4e-69
 Identities = 134/242 (55%), Positives = 170/242 (70%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ +  PL +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 238 TGKHLAKKA-SMIPLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 296

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+F++GLV DA EKGAT     
Sbjct: 297 HENVADELVSLVKEQVAKLSVGSPEQDSTIVPLIDDKSADFVQGLVDDAVEKGATIVIGN 356

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  +M++AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 357 KRERNLIYPTLIDHVTEEMKVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 416

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 417 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVL 476

Query: 181 NL 176
           NL
Sbjct: 477 NL 478



>gb:CP000001_851374 Bacillus cereus ZK, complete genome.
          Length = 479

 Score =  262 bits (670), Expect = 6e-69
 Identities = 134/242 (55%), Positives = 170/242 (70%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ +  PL +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 238 TGKHLAKKA-SMIPLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 296

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+F++GLV DA EKGAT     
Sbjct: 297 HENVADELVGLLKEQVAKLSVGSPEQDSTIVPLIDDKSADFVQGLVDDAVEKGATIVIGN 356

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  +M++AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 357 KRERNLIYPTLIDHVTEEMKVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 416

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 417 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVL 476

Query: 181 NL 176
           NL
Sbjct: 477 NL 478



>gb:CP000023_875143 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877055 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 477

 Score =  261 bits (666), Expect = 2e-68
 Identities = 128/232 (55%), Positives = 163/232 (70%)
 Frame = -2

Query: 871 AWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXX 692
           A  P+ +ELGGKDA IVLEDAD+DL A N+V G F YSGQRCTA+K VLVM+SVAD    
Sbjct: 243 AMRPVMLELGGKDAAIVLEDADLDLTAKNIVAGAFDYSGQRCTAIKRVLVMDSVADELVE 302

Query: 691 XXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPL 512
                     VG PE+   +TP++   +A+F++GL+ DA E+GAT     KREGNLI+P 
Sbjct: 303 KVTALVGNITVGMPEESASVTPLIDTKAADFVQGLIDDAVEQGATAKTELKREGNLIYPA 362

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           + DHV  DMR+AWEEPFGPVLP IR++SVEE I   N S FGLQG VFT+D  +A  I++
Sbjct: 363 VFDHVTTDMRLAWEEPFGPVLPFIRVSSVEEAIKISNESEFGLQGAVFTQDYPRAFAIAE 422

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            +E GTV IN+   RG D+FPF G+K SG G+QG+  SI  MT+VK+TV ++
Sbjct: 423 QLEVGTVHINNKTQRGTDNFPFLGVKGSGAGTQGVKYSIEAMTRVKSTVFDI 474



>gb:AE017026_381093 Bacillus anthracis str. Ames section 3 of 18 of
           the complete genome.>gb:AE017225_406211 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_450942 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1010798 Bacillus
           anthracis str. Ames complete genome.
          Length = 479

 Score =  260 bits (665), Expect = 2e-68
 Identities = 133/242 (54%), Positives = 169/242 (69%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ +  PL +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 238 TGKHLAKKA-SMIPLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 296

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+ ++GLV DA EKGAT     
Sbjct: 297 HENVADELVSLVKEQVAKLSVGSPEQDSTIVPLIDDKSADLVQGLVDDAVEKGATIVIGN 356

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  +M++AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 357 KRERNLIYPTLIDHVTEEMKVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 416

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 417 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVL 476

Query: 181 NL 176
           NL
Sbjct: 477 NL 478



>gb:AE017278_425721 Bacillus cereus ATCC 10987, section 15 of 18 of
           the complete genome.>gb:AE017194_1064140 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 477

 Score =  260 bits (664), Expect = 3e-68
 Identities = 134/241 (55%), Positives = 167/241 (69%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  + KK+ A   L +ELGGKD  IV EDAD+  AA ++V G FSYSGQRCTA+K VLV
Sbjct: 236 TGKHLAKKA-AMITLVLELGGKDPGIVREDADLQDAANHIVSGAFSYSGQRCTAIKRVLV 294

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            E+VAD              VG+PE D  I P++ + SA+F++GLV DA EKGAT     
Sbjct: 295 HENVADELVSLLQEQVAKLSVGSPEQDSTIVPLIDDKSADFVQGLVDDAVEKGATIVIGN 354

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KRE NLI+P L+DHV  DM +AWEEPFGP+LP+IR++S E+ I   N S FGLQ  VFTK
Sbjct: 355 KRERNLIYPTLIDHVTEDMTVAWEEPFGPILPIIRVSSDEQAIEIANKSEFGLQASVFTK 414

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA  I++ +ETG+VQIN    RGPDHFPF G+K SG+G+QGI  S+  MT+ K TV+
Sbjct: 415 DINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGAQGIRKSLESMTREKVTVV 474

Query: 181 N 179
           N
Sbjct: 475 N 475



>pir|D98000|D98000 glyceraldehyde-3-phosphate dehydrogenase (NADP)
           (EC 1.2.1.9) gapN [imported] - Streptococcus pneumoniae
           (strain R6)>gb:AE008475_237349 Streptococcus pneumoniae
           R6 section 91 of 184 of the complete
           genome.>gb:AE007317_943507 Streptococcus pneumoniae R6,
           complete genome.
          Length = 474

 Score =  259 bits (661), Expect = 6e-68
 Identities = 129/229 (56%), Positives = 159/229 (69%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGKDA +VLEDAD++ AA  +V G FSYSGQRCTA+K V+V+ESVAD       
Sbjct: 245 PIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSGQRCTAIKRVIVLESVADKLATLLQ 304

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                  VG P D+ DITPV+  +SA+FI GL+ DA+EK A    P KREGNL+WP+L D
Sbjct: 305 EEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTPIKREGNLLWPVLFD 364

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V  DM++AWEEPFGPVLP+IR+ SVEE I   N S FGLQ  VFT D  KA  I++ +E
Sbjct: 365 QVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIAEKLE 424

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            GTV IN+   RGPD+FPF G+K SG G QGI  SI  MT VK+ V ++
Sbjct: 425 VGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDV 473



>pir|E95129|E95129 hypothetical protein SP1119 [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007413_226291 Streptococcus pneumoniae TIGR4
           section 96 of 194 of the complete
           genome.>gb:AE005672_1104059 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 474

 Score =  259 bits (661), Expect = 6e-68
 Identities = 129/229 (56%), Positives = 159/229 (69%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGKDA +VLEDAD++ AA  +V G FSYSGQRCTA+K V+V+ESVAD       
Sbjct: 245 PIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSGQRCTAIKRVIVLESVADKLATLLQ 304

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                  VG P D+ DITPV+  +SA+FI GL+ DA+EK A    P KREGNL+WP+L D
Sbjct: 305 EEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTPIKREGNLLWPVLFD 364

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V  DM++AWEEPFGPVLP+IR+ SVEE I   N S FGLQ  VFT D  KA  I++ +E
Sbjct: 365 QVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIAEKLE 424

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            GTV IN+   RGPD+FPF G+K SG G QGI  SI  MT VK+ V ++
Sbjct: 425 VGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDV 473



>pir|E83929|E83929 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase gapN [imported] - Bacillus halodurans
           (strain C-125)>gb:BA000004_656183 Bacillus halodurans
           C-125 DNA, complete genome.
          Length = 481

 Score =  256 bits (655), Expect = 3e-67
 Identities = 131/242 (54%), Positives = 163/242 (67%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  I +K+    P+ +ELGGKD  IVL+DAD+ L A+ +V G FSYSGQRCTA+K V V
Sbjct: 241 TGERISEKA-KMIPVVLELGGKDPAIVLDDADLKLTASQIVSGAFSYSGQRCTAIKRVFV 299

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
            +SVAD              VG+PEDD DITPV+ E SA FI+GL+ DA E GAT     
Sbjct: 300 QDSVADQLVANIKELVEQLTVGSPEDDADITPVIDEKSAAFIQGLIDDALENGATLLSGN 359

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KR+GNL+ P LLD V P MR+AWEEPFGPVLP+IR+    E I   N S++GLQ  +FTK
Sbjct: 360 KRQGNLLSPTLLDDVTPAMRVAWEEPFGPVLPIIRVKDANEAISLSNQSDYGLQASIFTK 419

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           D ++AI I   +E GTV IN+   RGPDHFPF G+K SG+G QGI  S+  MT+ + TV+
Sbjct: 420 DTDRAINIGKHLEVGTVHINAKTERGPDHFPFLGVKKSGLGVQGIKPSLLSMTRERVTVL 479

Query: 181 NL 176
           NL
Sbjct: 480 NL 481



>pir|A57151|A57151 glyceraldehyde-3-phosphate dehydrogenase (NADP)
           (EC 1.2.1.9) - Streptococcus mutans>gb:STRGAPN_193347
           Streptococcus mutans non-phosphorylating NADP-dependent
           glyceraldehyde-3-phosphate dehydrogenase (gapN) gene,
           complete cds.
          Length = 475

 Score =  256 bits (655), Expect = 3e-67
 Identities = 127/235 (54%), Positives = 158/235 (67%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKD+ IVLEDAD++L A N++ G F YSGQRCTAVK VLVMESVAD 
Sbjct: 240 KMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADE 299

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        +G PEDD DITP++   SA+++EGL+ DA +KGAT     KREGNLI
Sbjct: 300 LVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGATALTEIKREGNLI 359

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P+L D V  DMR+AWEEPFGPVLP+IR+ SVEE I   N S +GLQ  +FT D  +A  
Sbjct: 360 CPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFG 419

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ +E GTV IN+   RG D+FPF G K SG G QG+  SI  MT VK+ V ++
Sbjct: 420 IAEQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDI 474



>gb:AE006575_220323 Streptococcus pyogenes M1 GAS, section 104 of
           167 of the complete genome.>gb:AE004092_1106169
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 475

 Score =  255 bits (651), Expect = 9e-67
 Identities = 130/241 (53%), Positives = 163/241 (67%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I K +G   P+ +ELGGKD+ IVLEDAD+ LAA N+V G F YSGQRCTAVK VLVM
Sbjct: 235 GEGIGKLAGM-RPIMLELGGKDSAIVLEDADLALAAKNIVAGAFGYSGQRCTAVKRVLVM 293

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYK 539
           + VAD              VG PEDD DITP++  S+A+F+EGL+ DA +KGAT    + 
Sbjct: 294 DKVADQLAAEIKTLVEKLSVGMPEDDADITPLIDTSAADFVEGLIKDATDKGATALTAFN 353

Query: 538 REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
           REGNLI P+L DHV  DMR+AWEEPFGPVLP+IR+ +VEE I   N S +GLQ  +FT +
Sbjct: 354 REGNLISPVLFDHVTTDMRLAWEEPFGPVLPIIRVTTVEEAIKISNESEYGLQASIFTTN 413

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
             KA  I++ +E GTV +N+   RG D+FPF G K SG G QG+  SI  MT VK+ V +
Sbjct: 414 FPKAFGIAEQLEVGTVHLNNKTQRGTDNFPFLGAKKSGAGVQGVKYSIEAMTTVKSVVFD 473

Query: 178 L 176
           +
Sbjct: 474 I 474



>gb:AE014157_304522 Streptococcus pyogenes MGAS315, section 22 of 37
           of the complete genome.>gb:AE014074_927701 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 467

 Score =  254 bits (650), Expect = 1e-66
 Identities = 130/241 (53%), Positives = 163/241 (67%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I K +G   P+ +ELGGKD+ IVLEDAD+ LAA N+V G F YSGQRCTAVK VLVM
Sbjct: 227 GEGIGKLAGM-RPIMLELGGKDSAIVLEDADLVLAAKNIVAGAFGYSGQRCTAVKRVLVM 285

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYK 539
           + VAD              VG PEDD DITP++  S+A+F+EGL+ DA +KGAT    + 
Sbjct: 286 DKVADQLAAEIKTLVEKLSVGMPEDDADITPLIDTSAADFVEGLIKDATDKGATALTAFN 345

Query: 538 REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
           REGNLI P+L DHV  DMR+AWEEPFGPVLP+IR+ +VEE I   N S +GLQ  +FT +
Sbjct: 346 REGNLISPVLFDHVTTDMRLAWEEPFGPVLPIIRVTTVEEAIKISNESEYGLQASIFTTN 405

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
             KA  I++ +E GTV +N+   RG D+FPF G K SG G QG+  SI  MT VK+ V +
Sbjct: 406 FPKAFGIAEQLEVGTVHLNNKTQRGTDNFPFLGAKKSGAGVQGVKYSIEAMTTVKSVVFD 465

Query: 178 L 176
           +
Sbjct: 466 I 466



>gb:AE010058_258864 Streptococcus pyogenes strain MGAS8232, section
           106 of 173 of the complete genome.>gb:AE009949_905246
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 475

 Score =  254 bits (650), Expect = 1e-66
 Identities = 129/241 (53%), Positives = 163/241 (67%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I K +G   P+ +ELGGKD+ IVLEDAD+ LAA N+V G F YSGQRCTAVK VLVM
Sbjct: 235 GEGIGKLAGM-RPIMLELGGKDSAIVLEDADLALAAKNIVAGAFGYSGQRCTAVKRVLVM 293

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYK 539
           + VAD              VG PEDD DITP++  S+A+F+EGL+ DA +KGAT    + 
Sbjct: 294 DKVADQLAAEIKTLVEKLSVGMPEDDADITPLIDTSAADFVEGLIKDATDKGATALTAFN 353

Query: 538 REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
           REGNLI P+L DHV  DMR+AWEEPFGPVLP+IR+ +VEE +   N S +GLQ  +FT +
Sbjct: 354 REGNLISPVLFDHVTTDMRLAWEEPFGPVLPIIRVTTVEEAVKISNESEYGLQASIFTTN 413

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
             KA  I++ +E GTV +N+   RG D+FPF G K SG G QG+  SI  MT VK+ V +
Sbjct: 414 FPKAFGIAEQLEVGTVHLNNKTQRGTDNFPFLGAKKSGAGVQGVKYSIEAMTTVKSVVFD 473

Query: 178 L 176
           +
Sbjct: 474 I 474



>sp|Q59931|GAPN_STRMU NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase (EC 1.2.1.9) (Non-phosphorylating
           glyceraldehyde 3-phosphate dehydrogenase)
           (Glyceraldehyde-3-phosphate dehydrogenase [NADP+])
           (Triosephosphate dehydrogenase).>gb:AE014911_313083
           Streptococcus mutans UA159 section 59 of 185 of the
           complete genome.>gb:AE014133_940084 Streptococcus mutans
           UA159 complete genome.
          Length = 475

 Score =  254 bits (650), Expect = 1e-66
 Identities = 126/235 (53%), Positives = 157/235 (66%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKD+ IVLEDAD++L A N++ G F YSGQRCTAVK VLVMESVAD 
Sbjct: 240 KMAGMRPIMLELGGKDSAIVLEDADLELTAKNIIAGAFGYSGQRCTAVKRVLVMESVADE 299

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        +G PEDD DITP++   SA+++EGL+ DA +KGA      KREGNLI
Sbjct: 300 LVEKIREKVLALTIGNPEDDADITPLIDTKSADYVEGLINDANDKGAAALTEIKREGNLI 359

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P+L D V  DMR+AWEEPFGPVLP+IR+ SVEE I   N S +GLQ  +FT D  +A  
Sbjct: 360 CPILFDKVTTDMRLAWEEPFGPVLPIIRVTSVEEAIEISNKSEYGLQASIFTNDFPRAFG 419

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ +E GTV IN+   RG D+FPF G K SG G QG+  SI  MT VK+ V ++
Sbjct: 420 IAEQLEVGTVHINNKTQRGTDNFPFLGAKKSGAGIQGVKYSIEAMTTVKSVVFDI 474



>gb:CP000003_861018 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 475

 Score =  251 bits (642), Expect = 1e-65
 Identities = 129/241 (53%), Positives = 162/241 (67%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I K +G   P+ +ELGGKD+ IVLEDAD+ LAA  +V G F YSGQRCTAVK VLVM
Sbjct: 235 GEGIGKLAGM-RPIMLELGGKDSAIVLEDADLALAAKIIVAGAFGYSGQRCTAVKRVLVM 293

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYK 539
           + VAD              VG PEDD DITP++  S+A+F+EGL+ DA +KGAT    + 
Sbjct: 294 DKVADQLAAEIKTLVEKLSVGMPEDDADITPLIDTSAADFVEGLIKDATDKGATALTAFN 353

Query: 538 REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
           REGNLI P+L DHV  DMR+AWEEPFGPVLP+IR+ +VEE I   N S +GLQ  +FT +
Sbjct: 354 REGNLISPVLFDHVTTDMRLAWEEPFGPVLPIIRVTTVEEAIKISNESEYGLQASIFTTN 413

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
             KA  I++ +E GTV +N+   RG D+FPF G K SG G QG+  SI  MT VK+ V +
Sbjct: 414 FPKAFGIAEQLEVGTVHLNNKTQRGTDNFPFLGAKKSGAGVQGVKYSIEAMTTVKSVVFD 473

Query: 178 L 176
           +
Sbjct: 474 I 474



>gb:BA000016_675478 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 482

 Score =  249 bits (635), Expect = 7e-65
 Identities = 127/231 (54%), Positives = 158/231 (68%), Gaps = 2/231 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           PL MELGGKDA IVLEDAD+DL   N++ GG+SYSGQRCTAVK +LVM SVAD       
Sbjct: 251 PLLMELGGKDAAIVLEDADLDLTVNNIIAGGYSYSGQRCTAVKRILVMNSVADKLVEKLK 310

Query: 682 XXXXXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLL 509
                  +G P   +D  I P++   +A+F+  L+ DAKEKGAT      REGNLI   L
Sbjct: 311 EKISKLKMGNPLEVEDVTIVPLIDNKAADFVMELIDDAKEKGATLVCGGHREGNLIEATL 370

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
            D+V  DMR+AWEEPFGPVLP+IRIN  +E I   NAS +GLQ  VFT+DIN+A  I++ 
Sbjct: 371 FDNVTTDMRLAWEEPFGPVLPIIRINDKDEAIKIANASKYGLQSSVFTRDINEAFYIANK 430

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           +E GTV +N+   RGPDHFPF G+K SG+G+QGI  SI  M++ K TVI +
Sbjct: 431 LEVGTVHVNNKTERGPDHFPFLGVKSSGMGTQGIRYSIEAMSRPKATVITI 481



>gb:AF439646_511047 Streptococcus agalactiae non-phosphorylating
           glyceraldehyde 3-phosphate dehydrogenase gene, complete
           cds.>gb:AX026609_1456985 Sequence 11 from Patent
           WO0037490.
          Length = 475

 Score =  243 bits (621), Expect = 3e-63
 Identities = 121/235 (51%), Positives = 157/235 (66%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKDA IVL DAD+D AA  +V G + YSGQRCTA+K VLV+E VAD 
Sbjct: 240 KLAGMRPIMLELGGKDAGIVLADADLDNAAKQIVAGAYDYSGQRCTAIKRVLVVEEVADE 299

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        VG P D+  +TPV+ ++SA+FIE LV DA++KGA     +KR+G L+
Sbjct: 300 LAEKISENVAKLSVGDPFDNATVTPVIDDNSADFIESLVVDARQKGAKELNEFKRDGRLL 359

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P L DHV  DM++AWEEPFGP+LP+IR+   EE +   N S+FGLQ  VFT+D  KA  
Sbjct: 360 TPGLFDHVTLDMKLAWEEPFGPILPIIRVKDAEEAVAIANKSDFGLQSSVFTRDFQKAFD 419

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ +E GTV IN+   RGPD+FPF G+K SG G QGI  SI  MT VK+ V+++
Sbjct: 420 IANKLEVGTVHINNKTGRGPDNFPFLGLKGSGAGVQGIRYSIEAMTNVKSIVLDM 474



>pir|H97348|H97348 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase [imported] - Clostridium
           acetobutylicum>gb:AE007861_230940 Clostridium
           acetobutylicum ATCC 824 section 349 of 356 of the
           complete genome.>gb:AE001437_1093895 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 482

 Score =  243 bits (621), Expect = 3e-63
 Identities = 120/235 (51%), Positives = 161/235 (68%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKDA IVLEDA+++  A ++V G + YSGQRCTAVK VLVM+ VAD 
Sbjct: 248 KIAGMIPMVLELGGKDAAIVLEDANLETTAKSIVSGAYGYSGQRCTAVKRVLVMDKVADE 307

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        VG P DD  ITP++   +A++++ L+ DA EKGAT     KR+ NL+
Sbjct: 308 LVELVTKKVKELKVGNPFDDVTITPLIDNKAADYVQTLIDDAIEKGATLIVGNKRKENLM 367

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
           +P L D+V  DMRIAWEEPFGPVLP+IR+ S++E I   N S +GLQ  VFT++++ A  
Sbjct: 368 YPTLFDNVTADMRIAWEEPFGPVLPIIRVKSMDEAIELANRSEYGLQSAVFTENMHDAFY 427

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ ++ GTVQ+N+ P RGPDHFPF G K SG+G+QGI  SI  MT+ K+ V+NL
Sbjct: 428 IANKLDVGTVQVNNKPERGPDHFPFLGTKSSGMGTQGIRYSIEAMTRHKSIVLNL 482



>gb:AE014229_306144 Streptococcus agalactiae 2603V/R section 39 of
           100 of the complete genome.>gb:AE009948_936257
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 475

 Score =  242 bits (618), Expect = 6e-63
 Identities = 120/235 (51%), Positives = 156/235 (66%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKDA +VL DAD+D AA  +V G + YSGQRCTA+K VLV+E VAD 
Sbjct: 240 KLAGMRPIMLELGGKDAGVVLADADLDNAAKQIVAGAYDYSGQRCTAIKRVLVVEEVADE 299

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        VG P D+  +TPV+ ++SA+FIE LV DA++KGA     +KR+G L+
Sbjct: 300 LAEKISENVAKLSVGDPFDNATVTPVIDDNSADFIESLVVDARQKGAKELNEFKRDGRLL 359

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P L DHV  DM++AWEEPFGP+LP+IR+   EE +   N S+FGLQ  VFT+D  KA  
Sbjct: 360 TPGLFDHVTLDMKLAWEEPFGPILPIIRVKDAEEAVAIANKSDFGLQSSVFTRDFQKAFD 419

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ +E GTV IN+   RGPD+FPF G+K SG G QGI  SI  MT VK+ V ++
Sbjct: 420 IANKLEVGTVHINNKTGRGPDNFPFLGLKGSGAGVQGIRYSIEAMTNVKSIVFDM 474



>gb:BX842643_822521 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 2/4.
          Length = 471

 Score =  239 bits (611), Expect = 4e-62
 Identities = 115/225 (51%), Positives = 156/225 (69%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGKD  IVL+D D++  A  ++ G FSYSGQRCTA+K V+  + +AD          
Sbjct: 246 LELGGKDPAIVLDDLDLEKYAKEIISGAFSYSGQRCTAIKRVITTDKIADQLVPLLKEKI 305

Query: 673 XXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHVR 494
               VG P+D+CDITP++ + +A+F+ GL+ DAK+KGA      K+E NLI+P L+DHV 
Sbjct: 306 NKLTVGLPKDNCDITPLIDQKTADFVYGLIDDAKKKGAKIIIGDKQEKNLIYPTLVDHVT 365

Query: 493 PDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETGT 314
            DMR+AWEEPFGPVLP+IR NSV++ I   N SNFGLQ  V+TK++++A+ I+  +E GT
Sbjct: 366 SDMRLAWEEPFGPVLPIIRTNSVDQMIELANKSNFGLQASVYTKNLDQALTIAQKLEVGT 425

Query: 313 VQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           V IN    RGPD FPF G+KDSG G QGI +++  +T+ K  VIN
Sbjct: 426 VNINGKSQRGPDVFPFLGVKDSGFGVQGIVDTLLFLTRYKGIVIN 470



>gb:SAG766847_170368 Streptococcus agalactiae NEM316 complete
           genome, segment 5.
          Length = 475

 Score =  239 bits (611), Expect = 4e-62
 Identities = 119/235 (50%), Positives = 156/235 (66%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K     P+ +ELGGKDA IVL DAD+D AA  +V G + YSGQRCTA+K VLV+E VA+ 
Sbjct: 240 KLAGMRPIMLELGGKDAGIVLADADLDNAAKQIVAGAYDYSGQRCTAIKRVLVVEEVANE 299

Query: 700 XXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        VG P D+  +TPV+ ++SA+FIE LV DA++KGA     +KR+G L+
Sbjct: 300 LAEKISENVAKLSVGDPFDNATVTPVIDDNSADFIESLVVDARQKGAKELNEFKRDGRLL 359

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P L DHV  DM++AWEEPFGP+LP+IR+   +E +   N S+FGLQ  VFT+D  KA  
Sbjct: 360 TPGLFDHVTLDMKLAWEEPFGPILPIIRVKDADEAVAIANKSDFGLQSSVFTRDFQKAFD 419

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I++ +E GTV IN+   RGPD+FPF G+K SG G QGI  SI  MT VK+ V ++
Sbjct: 420 IANKLEVGTVHINNKTGRGPDNFPFLGLKGSGAGVQGIRYSIEAMTNVKSIVFDM 474



>gb:BA000026_693820 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 478

 Score =  210 bits (534), Expect = 3e-53
 Identities = 111/229 (48%), Positives = 147/229 (64%), Gaps = 1/229 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           PL +ELGGKDA IV  +AD++LAA  ++KG F YSGQRCTA+K VLV + +AD       
Sbjct: 249 PLVLELGGKDAAIVTNNADVELAAKEIIKGAFGYSGQRCTAIKRVLVTKEIADDLLIHLI 308

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG-NLIWPLLL 506
                  VG P ++ DITP++   + +F   L+ DA   GA        EG NL+   +L
Sbjct: 309 KEAQKLKVGNPLNNPDITPLIDRKAVDFNIDLIDDAINHGANLVYGGNIEGYNLLRHTIL 368

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D+V    ++AWEEPFGPVLP+IR++++ E I   NAS +GLQG VFTKD+ +A  I+  +
Sbjct: 369 DNVSTKSKLAWEEPFGPVLPIIRVSTINEAIAIANASEYGLQGSVFTKDLEEARTIAKYL 428

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           +TGTV IN   +RGPD FPF GIK SG G QGI +S+  MT+VK  V N
Sbjct: 429 DTGTVNINRGSSRGPDIFPFIGIKKSGFGVQGIRDSLKAMTRVKGIVEN 477



>gb:AE017263_420812 Mesoplasma florum L1 complete genome.
          Length = 472

 Score =  209 bits (532), Expect = 6e-53
 Identities = 103/226 (45%), Positives = 148/226 (65%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELGGKDA I+L++ +++  A ++V G FSYSGQRCTA+K V+  +++AD        
Sbjct: 245 LVLELGGKDAAILLDEHNLENIAKDIVAGAFSYSGQRCTAIKRVITTDNIADKITPLIKA 304

Query: 679 XXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                 VG P ++  ITP++ + SA+F+  L+ DA +KGAT      R+ NL+ P LLD+
Sbjct: 305 EVAKLTVGLPNENPIITPMIDKKSADFVTDLINDAVKKGATLVYGGTRDKNLLQPTLLDN 364

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V  +M +AWEEPFGPVLP+IRIN +E+ I   N SNFGLQ  +++KD++ A  +++ +E 
Sbjct: 365 VTVEMNVAWEEPFGPVLPIIRINEIEDMISVANKSNFGLQTSIYSKDVDLAYKVAEQLEV 424

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           GTV IN    RGPD  PF G+KDSG G QGI  +I   T+ +  +I
Sbjct: 425 GTVNINRRTQRGPDVLPFLGVKDSGFGVQGIKETILSTTRYRGIII 470



>gb:CFU252211_1646340 Scenedesmus vacuolatus partial mRNA for
           NADP-dependent non-phosphorylating
           glyceraldehyde-3-phosphate dehydrogenase (gapN gene).
          Length = 233

 Score =  202 bits (515), Expect = 5e-51
 Identities = 102/149 (68%), Positives = 116/149 (77%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TGIAI +K+G   PLQMELGGKDACIV  DAD+DLAA +++KGGFSYSGQRCTAVKVVLV
Sbjct: 86  TGIAISRKAGM-VPLQMELGGKDACIVCSDADLDLAATHIIKGGFSYSGQRCTAVKVVLV 144

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           M+ +AD              VG PED+ DIT VVSE SANFI+GLV DAK KGATF   +
Sbjct: 145 MQDIADELVRKVHAGVQKLKVGRPEDNADITAVVSEGSANFIQGLVEDAKAKGATFLTDW 204

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGP 455
           KREGNL+WP+LLD+V  DMRIAWEEPFGP
Sbjct: 205 KREGNLLWPVLLDNVTADMRIAWEEPFGP 233



>pir|F82900|F82900 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase UU362 [imported] - Ureaplasma
           urealyticum>gb:AE002133_43234 Ureaplasma parvum serovar
           3 str. ATCC 700970 section 34 of 59 of the complete
           genome.>gb:AF222894_1114605 Ureaplasma parvum serovar 3
           str. ATCC 700970, complete genome.
          Length = 475

 Score =  200 bits (509), Expect = 3e-50
 Identities = 102/229 (44%), Positives = 144/229 (62%), Gaps = 2/229 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELGGKD  +VL+DAD +LAA  +VKG + +SGQRCTA+K V V     D        
Sbjct: 246 LVLELGGKDPALVLDDADFELAANEIVKGAYGFSGQRCTAIKRVFVSHKNHDLLVNLINK 305

Query: 679 XXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQP--YKREGNLIWPLLL 506
                 VG P+ +  ITP+++ +S  +   LV DA +KGA   Q   Y  + NL+ PL++
Sbjct: 306 KVDALTVGLPQQNPIITPLINSNSLKYNLSLVEDAIKKGAIVHQKIVYNEKNNLLHPLVI 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D+V  +MR+AWEEPFGP+LP+I  NS++E I   N S +GLQ C+FT +      ++  +
Sbjct: 366 DNVTKEMRVAWEEPFGPILPIITYNSIQEAIDLINQSQYGLQACIFTTNYASIEQLALQI 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           E+GT+ IN + +RGPD  PF G+KDSG G QGI ++I  MT +K  +IN
Sbjct: 426 ESGTININKSSSRGPDILPFFGVKDSGFGVQGIVDAILSMTTIKGIIIN 474



>gb:AE016967_369404 Mycoplasma gallisepticum strain R section 1 of 4
            of the complete genome.>gb:AE015450_1034053 Mycoplasma
            gallisepticum strain R complete genome.
          Length = 525

 Score =  192 bits (487), Expect = 1e-47
 Identities = 102/240 (42%), Positives = 143/240 (59%)
 Frame = -2

Query: 898  GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
            G+++ K+S A   + +ELGGKDA +VL D D       +VKG +SYSGQRCTA+K V V 
Sbjct: 286  GLSLLKQS-AVGNISLELGGKDAALVLSDYDKQKTIKEIVKGAYSYSGQRCTAIKRVFVK 344

Query: 718  ESVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYK 539
               AD              +G P ++  + PV+ + +ANFI+ L  DA  K A       
Sbjct: 345  NEDADEFVQLLKKEVEKLHLGNPFNNPSLVPVIDQHAANFIKELFDDAVTKKAIVLTGGD 404

Query: 538  REGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
             E N +  +LLDHV  DMR+AWEEPFGP+LP+IR+ +  E +   N S +GLQ  +FT D
Sbjct: 405  FEKNCVEAILLDHVTTDMRVAWEEPFGPILPIIRVKNEAEMVKLHNQSEYGLQASIFTSD 464

Query: 358  INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
              K   +++ +E GT+  N + +RGPD FPF G+KDSG+G QGI ++I  +T+ K  V N
Sbjct: 465  QTKFDELANQLEAGTINWNRSSSRGPDFFPFMGVKDSGVGVQGIRDTILSVTRYKGFVYN 524



>gb:AE010193_260322 Pyrococcus furiosus DSM 3638, section 68 of 173
           of the complete genome.>gb:AE009950_901103 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 506

 Score =  165 bits (417), Expect = 1e-39
 Identities = 90/239 (37%), Positives = 137/239 (57%), Gaps = 5/239 (2%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           ++G      +ELGGKD  IVL DA+I+ +   +VKG  +YSGQRC A++++LV E + + 
Sbjct: 258 RTGGIKAYHLELGGKDPAIVLNDANIEESVEKIVKGIVTYSGQRCDAIRLILVEEDIYEQ 317

Query: 700 XXXXXXXXXXXXXVGAPEDDCD--ITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN 527
                           P +D +  + P++ E SAN+IE +  DA EKGA     ++R GN
Sbjct: 318 FRESLVAQLSKIEPKNPLEDENAIMGPLIDEDSANYIEEIYKDAIEKGARPLLEFRRRGN 377

Query: 526 LIWPLLLD---HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDI 356
            +WP++L+    + P +R   E+ FGP+  +I++   +E I   N+S FGL   VFT   
Sbjct: 378 YVWPIVLEVNNEILPTLRAFNEDVFGPLALLIKVKDEDEAIEIANSSRFGLDAAVFTTCE 437

Query: 355 NKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            +A  ++  +E G+V IN  P  G  ++PF G+KDSGIG +GI  S+ M+T  KT V N
Sbjct: 438 KRARKVARKLEVGSVFINEYPRHGIGYYPFGGMKDSGIGREGIGYSLEMLTTTKTIVHN 496



>gb:AP006878_575857 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 507

 Score =  160 bits (404), Expect = 4e-38
 Identities = 87/230 (37%), Positives = 133/230 (57%), Gaps = 5/230 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGGKD  +VL+DA ++     +VKG  SYSGQRC A+++++  E + +          
Sbjct: 268 MELGGKDPAVVLDDAPLEETVEKLVKGMVSYSGQRCDAIRLIIAEEGIYEQLKRELVAAL 327

Query: 673 XXXXVGAPEDDCD--ITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD- 503
                  P +D D  + P+++E SA  IE +  DA EKGA     +KR+G  +WP+LL+ 
Sbjct: 328 SKIEPENPLEDEDAIMGPLINERSAEKIEEVYRDALEKGAVPLTGFKRKGAYVWPVLLEA 387

Query: 502 --HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
              V P +R   E+ FGP+  ++++++ +E +   N+S FGL   VF+ D ++A  ++  
Sbjct: 388 SREVLPGLRAFQEDVFGPLTILVKVSNEDEAVELANSSRFGLDAAVFSGDDSRARKVARR 447

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           +E G V IN  P  G  ++PF G+KDSGIG +GI  SI  +T  KT V N
Sbjct: 448 LEVGAVFINEFPRHGIGYYPFGGMKDSGIGREGIGYSIETLTTTKTIVRN 497



>gb:AY632421_638097 Streptomyces viridochromogenes PTT biosynthetic
           gene.
          Length = 466

 Score =  149 bits (377), Expect = 6e-35
 Identities = 90/246 (36%), Positives = 123/246 (50%), Gaps = 1/246 (0%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG A+  ++     L +ELGG D   VL DAD+  AA     G  + +GQ C  +K V V
Sbjct: 220 TGHAVAAQAAGKRQL-LELGGNDPLFVLPDADLRRAAKLAADGSCATAGQSCRGIKRVFV 278

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E VAD               G P  +D D+ P+VSE +A  +E  +  A   GA     
Sbjct: 279 WEEVADEFTALLEPAVAAKRAGDPRREDTDLGPLVSEEAALVVERRIARAVRDGARLVTG 338

Query: 544 YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT 365
            +R+G L+ P +LDHV PD  +  EE FGPV PVIR+   +E +   N + +GLQ  V T
Sbjct: 339 GERDGALVRPAVLDHVPPDTELVTEETFGPVAPVIRVRDADEAVRLSNGTAYGLQAGVLT 398

Query: 364 KDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTV 185
           +D      I+  +  G V +   P     H PF G+K SG+G +GI  +I  MT  KT  
Sbjct: 399 RDSAAFWDIAARLRVGAVNLGEGPHFDSPHIPFGGVKSSGVGREGIRYAIAEMTVTKT-- 456

Query: 184 INLPTP 167
           + LP P
Sbjct: 457 VTLPGP 462



>sp|Q58806|YE11_METJA Hypothetical aldehyde-dehydrogenase like
           protein MJ1411 (EC 1.2.1.-).>gb:U67581_207525
           Methanocaldococcus jannaschii DSM 2661 section 123 of
           150 of the complete genome.>gb:L77117_1100283
           Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 463

 Score =  147 bits (370), Expect = 4e-34
 Identities = 87/241 (36%), Positives = 139/241 (57%), Gaps = 1/241 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I KK+G +  + +ELGG +  IVL+DAD++ A   ++KG F Y+GQ C +V ++LV 
Sbjct: 225 GELITKKAG-FKKIALELGGVNPNIVLKDADLNKAVNALIKGSFIYAGQVCISVGMILVD 283

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           ES+AD              VG P D+  D+ P++S   A ++E +V  A ++G       
Sbjct: 284 ESIADKFIEMFVNKAKVLNVGNPLDEKTDVGPLISVEHAEWVEKVVEKAIDEGGKLLLGG 343

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KR+  L +P +L+ V  D  +   E F PV+P+IR N  EE I   N++ +GL   +FT 
Sbjct: 344 KRDKALFYPTILE-VDRDNILCKTETFAPVIPIIRTNE-EEMIDIANSTEYGLHSAIFTN 401

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINK++  ++ +E G V IN +     D+ PF G+K SG+G +G+  ++  M+ +KT +I
Sbjct: 402 DINKSLKFAENLEFGGVVINDSSLFRQDNMPFGGVKKSGLGREGVKYAMEEMSNIKTIII 461

Query: 181 N 179
           +
Sbjct: 462 S 462



>gb:AE010400_262740 Methanopyrus kandleri AV19 section 99 of 157 of
           the complete genome.>gb:AE009439_903521 Methanopyrus
           kandleri AV19, complete genome.
          Length = 471

 Score =  146 bits (369), Expect = 5e-34
 Identities = 81/227 (35%), Positives = 125/227 (55%), Gaps = 1/227 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGG D  IV E AD++ AA   V+G   ++GQ C AV+  +V+E V +        
Sbjct: 242 ITLELGGNDPVIVDETADVEAAAEAAVRGACYHAGQVCIAVERAIVVEDVYEEFLEAAVE 301

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                 VG P ++D D+ P++ + +   +   V DA E+GA      + EG L  P +L 
Sbjct: 302 VAESLKVGDPLDEDTDVGPLIDDGAVEKVRRHVEDAVERGAEILTGGEPEGRLFPPTVLA 361

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V  D  +A EE FGPVLPVIR    EE I   N++++GL   VFT+ +++A+  +  +E
Sbjct: 362 DVPEDALVAREETFGPVLPVIRAKDFEEAIRIANSTDYGLHAAVFTERLDRAVKATRKLE 421

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
            G V +N +     D+ PF G+K SG+G +G+  ++   T+ KT VI
Sbjct: 422 AGGVIVNESTIYRADYMPFGGVKASGVGREGVPQAVREFTEEKTVVI 468



>gb:BX957223_844740 Methanococcus maripaludis S2 complete genome;
           segment 5/5.
          Length = 465

 Score =  146 bits (368), Expect = 6e-34
 Identities = 84/235 (35%), Positives = 133/235 (56%), Gaps = 1/235 (0%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K+     + +ELGG +  IVL+D+DI LAA + VK  F  +GQ C +V  VLV E V + 
Sbjct: 230 KNAKMKKVTLELGGNNPMIVLKDSDIKLAAKSAVKSKFLNAGQVCISVGQVLVEEEVVET 289

Query: 700 XXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNL 524
                        +G P D + DI P++S  SA  IE L+  +  +G        R+ +L
Sbjct: 290 FTKYVIEETKKLILGNPLDKNTDIGPLISPESALRIENLIKQSVSEGGELLIGGNRQNSL 349

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
           I P +++ +  +  ++  E FGP+LP++ +   EE ++  N S +GLQ  +FT +IN A+
Sbjct: 350 ISPAVIN-IDEENILSKIETFGPILPILTVKDSEEAVNIANNSKYGLQAGLFTNNINNAM 408

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            I+D +E G + INS+P    D+ PF G+K SG+G +GI  ++  M++ KT VI+
Sbjct: 409 KIADELEYGGIMINSSPTFRKDNMPFGGVKKSGLGREGIKYTVEEMSETKTVVIH 463



>pir|B64476|B64476 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase (EC 1.2.1.-) - Methanococcus jannaschii
          Length = 463

 Score =  144 bits (364), Expect = 2e-33
 Identities = 86/241 (35%), Positives = 138/241 (57%), Gaps = 1/241 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  I KK+G +  + +ELGG +  IVL+DAD++ A   ++KG F Y+GQ C +V ++LV 
Sbjct: 225 GELITKKAG-FKKIALELGGVNPNIVLKDADLNKAVNALIKGSFIYAGQVCISVGMILVD 283

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           ES+AD              VG P D+  D+ P++S   A ++E +V  A ++G       
Sbjct: 284 ESIADKFIEMFVNKAKVLNVGNPLDEKTDVGPLISVEHAEWVEKVVEKAIDEGGKLLLGG 343

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KR+  L +P +L+ V  D  +   E F PV+P+IR N  EE I   N++ +GL   +FT 
Sbjct: 344 KRDKALFYPTILE-VDRDNILCKTETFAPVIPIIRTNE-EEMIDIANSTEYGLHSAIFTN 401

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINK++  ++ +E G V IN +     D+ PF G+K SG+G +G+  ++  M+ + T +I
Sbjct: 402 DINKSLKFAENLEFGGVVINDSSLFRQDNMPFGGVKKSGLGREGVKYAMEEMSNIXTIII 461

Query: 181 N 179
           +
Sbjct: 462 S 462



>gb:STMBCPD_192727 Streptomyces hygroscopicus genes for P-methylase
           and bialaphos biosynthesis-related unknown product,
           complete cds.
          Length = 417

 Score =  142 bits (357), Expect = 1e-32
 Identities = 82/230 (35%), Positives = 115/230 (50%), Gaps = 1/230 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D   VL DAD+  AA     G  + +GQ C  +K + V E VAD          
Sbjct: 186 LELGGNDPLFVLPDADLPHAARLAAGGACATAGQSCRGIKRIFVWEEVADEFTDLLSTEV 245

Query: 673 XXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G P   D D+ P++SE +A  +E  + DA   GA      +R+G L+ P +LD V
Sbjct: 246 AGKQAGDPRRSDTDLGPLISEEAALVVERRIADAVRDGARLVTGGERDGALVHPAVLDRV 305

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
             D  +  EE FGPV PVIR+   +E +   N++ +GLQ  V T+D  +   ++  +  G
Sbjct: 306 PADTELVREETFGPVAPVIRVRGADEAVRLSNSTAYGLQAGVLTRDSARFWDLAARLRVG 365

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTP 167
            V +   P     H PF G+K  GIG +GI  +I  MT  KT  + LP P
Sbjct: 366 AVNLGEGPHFDSPHIPFGGVKACGIGREGIRYAIAEMTVTKT--VTLPGP 413



>gb:BA000012_671638 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 481

 Score =  141 bits (356), Expect = 2e-32
 Identities = 81/234 (34%), Positives = 115/234 (49%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DA ID A      G F + GQ C + + ++V E +AD       
Sbjct: 246 PALLELGGKAPLLVLDDAAIDAAVNAATFGAFMHQGQICMSTERLIVDERIADEFVSKLA 305

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                   G P     +  ++S  +A+ +E L+ DA  KGA      KR G ++   LLD
Sbjct: 306 ARASQLPAGDPRGHVVLGSLISSQAADKMEELIADAVAKGAKLVAGGKRTGTVVEATLLD 365

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
           HV P MR+  EE FGPV PVIR+   +E +   N + +GL   VF++DI +A+ ++  +E
Sbjct: 366 HVTPAMRVYAEESFGPVKPVIRVKDEDEAVRVANDTEYGLSSAVFSRDIKRAMAVAARIE 425

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
            G   IN          PF G+K SG G  G   SI   T ++   I  P   Y
Sbjct: 426 AGICHINGPTVGDEAQMPFGGVKGSGYGRFGGKASIAEFTDLRWVTIEDPGQHY 479



>pir|H69230|H69230 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000871_28670 Methanobacterium
           thermoautotrophicum from bases 886211 to 896661 (section
           77 of 148) of the complete genome.>gb:AE000666_925752
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 455

 Score =  141 bits (356), Expect = 2e-32
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 1/199 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGG D  IV++DADID A    V+G + YSGQ C AVK ++V E VAD        
Sbjct: 241 ITLELGGNDPLIVMDDADIDSAVEAAVRGSYLYSGQVCIAVKRMIVHEDVADEFADKLVN 300

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                  G P D   D+ P+++E +A  +E ++  A E GA       R GN + P +LD
Sbjct: 301 ITGSLRAGDPMDVRTDVGPLINEDAAIEVERVIGAAVEDGAELLCGGSRRGNFVEPTVLD 360

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
           HV P M +   E FGPV P+IR N  +E I   N + + LQ  VFT++I  A+ ++  +E
Sbjct: 361 HVVPGMEVIERETFGPVSPIIRFNGADEAIRIANGTCYALQAGVFTENIRTALRMAREIE 420

Query: 322 TGTVQINSAPARGPDHFPF 266
            GTV +N       DH PF
Sbjct: 421 AGTVLVNKQSTFRVDHMPF 439



>gb:AE014291_307822 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 481

 Score =  139 bits (349), Expect = 1e-31
 Identities = 80/241 (33%), Positives = 118/241 (48%)
 Frame = -2

Query: 895 IAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVME 716
           I   + +G   P+ +ELGGK   IVLEDAD+D A      G F   GQ C + +  +V E
Sbjct: 236 IIARRAAGHLKPVLLELGGKAPFIVLEDADLDQAVDAAAFGAFMNQGQICMSTERFIVHE 295

Query: 715 SVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR 536
            VAD               G P  +  +  +V   SA  ++ L+ DA  KG       KR
Sbjct: 296 KVADAFAEKLAAKARSLPAGDPRGNVVLGSLVDLKSAQRMDALIADAVAKGGRVLAGGKR 355

Query: 535 EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDI 356
           +G ++   ++D V P M I  +E FGPV P+IR+ S EE I   N + +GL   +F++++
Sbjct: 356 DGAVVEATIIDGVTPQMDIYTQESFGPVKPIIRVKSAEEAIRVANDTEYGLSSAIFSQNV 415

Query: 355 NKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            +A+ +S  +ETG   IN          PF G+K S  G  G   +IN  T+++   I  
Sbjct: 416 KRALALSRKLETGICHINGPTVADEAQVPFGGVKSSDYGRFGGKAAINEFTELRWITIEG 475

Query: 175 P 173
           P
Sbjct: 476 P 476



>pir|AB3447|AB3447 salicylaldehyde dehydrogenase (EC 1.-.-.-)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009591_253478 Brucella melitensis 16M
           chromosome I, section 148 of 195 of the complete
           sequence.>gb:AE008917_979390 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 333

 Score =  138 bits (348), Expect = 1e-31
 Identities = 80/241 (33%), Positives = 118/241 (48%)
 Frame = -2

Query: 895 IAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVME 716
           I   + +G   P+ +ELGGK   IVLEDAD+D A      G F   GQ C + +  +V E
Sbjct: 88  IIARQAAGHLKPVLLELGGKAPFIVLEDADLDQAVDAAAFGAFMNQGQICMSTERFIVHE 147

Query: 715 SVADXXXXXXXXXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR 536
            VAD               G P  +  +  +V   SA  ++ L+ DA  KG       KR
Sbjct: 148 KVADAFAEKLAAKARSLPAGDPRGNVVLGSLVDLKSAQRMDALIADAVAKGGRVLAGGKR 207

Query: 535 EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDI 356
           +G ++   ++D V P M I  +E FGPV P+IR+ S EE I   N + +GL   +F++++
Sbjct: 208 DGAVVEATIIDGVTPQMDIYTQESFGPVKPIIRVKSAEEAIRVANDTEYGLSSAIFSQNV 267

Query: 355 NKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            +A+ +S  +ETG   IN          PF G+K S  G  G   +IN  T+++   I  
Sbjct: 268 KRALALSRKLETGICHINGPTVADEAQVPFGGVKSSDYGRFGGKAAINEFTELRWITIEG 327

Query: 175 P 173
           P
Sbjct: 328 P 328



>gb:BA000023_690604 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 468

 Score =  138 bits (347), Expect = 2e-31
 Identities = 85/246 (34%), Positives = 134/246 (54%), Gaps = 4/246 (1%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXP-LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG+AI  K+ +    + MELGG D  IVLEDA+ID A++  V+  + Y+GQ C A K ++
Sbjct: 222 TGLAIASKAVSLGKRIIMELGGSDPIIVLEDANIDRASSIAVRARYEYAGQNCNAGKRII 281

Query: 724 VMESVADXXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V E + D              VG P D+  DI PV+++ S   +   + DA+ KG     
Sbjct: 282 VREEIYDKFVKAFKEKVKALKVGDPLDESTDIGPVINQESVEKLNKALEDAQSKGGNVEV 341

Query: 547 PYKR-EGNLIWPL-LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGC 374
             K  E    +PL L+ +   DM +   E FGP+ P++ + S EE I+  N++ +GLQ  
Sbjct: 342 LNKGPETGYFFPLSLVTNPSLDMLVLKTEIFGPIAPIVSVKSDEEAINIANSTEYGLQSA 401

Query: 373 VFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +F+ D+N+A+ I+  ++ G + IN +     D  PF G K +GIG +G+ +++  MT+ K
Sbjct: 402 IFSNDVNRALKIAKELKFGAIIINDSTRLRWDSLPFGGFKKTGIGREGVRDTMLEMTENK 461

Query: 193 TTVINL 176
              I L
Sbjct: 462 LIAITL 467



>pir|F90347|F90347 hypothetical protein gapN-2 [imported] -
           Sulfolobus solfataricus>gb:AE006793_222649 Sulfolobus
           solfataricus P2 section 152 of 272 of the complete
           genome.>gb:AE006641_1108497 Sulfolobus solfataricus P2,
           complete genome.
          Length = 470

 Score =  138 bits (347), Expect = 2e-31
 Identities = 84/247 (34%), Positives = 133/247 (53%), Gaps = 5/247 (2%)
 Frame = -2

Query: 901 TGIAIXKKS-GAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG+ I  K+      + MELGG D  I+LEDA+I+ A++  V+  F Y+GQ C A K ++
Sbjct: 224 TGLKIASKAISLGKRIIMELGGSDPIIILEDANIERASSIAVRARFEYAGQNCNAGKRII 283

Query: 724 VMESVADXXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V + V D              VG P D+  D+ PV+++ S   +  ++ DAK KG    +
Sbjct: 284 VRQEVYDKFVKAFNEKAKALKVGEPLDETTDVGPVINKESVENLNSVLEDAKVKGGRV-E 342

Query: 547 PYKR--EGNLIWPL-LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQG 377
              R  E    +PL ++ +   DM +   E FGP++P++ + S EE I   N++ +GLQ 
Sbjct: 343 ILNRGPESGSFFPLTMVTNPSLDMLVLKSEVFGPIVPIVSVKSDEEAIRIANSTEYGLQS 402

Query: 376 CVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKV 197
            +FT D+N+A+ +S  ++ G V IN +     D  PF G K +GIG +G+  ++  MT+ 
Sbjct: 403 AIFTNDVNRALKLSRELKFGAVIINDSTRLRWDSLPFGGFKKTGIGREGVRETMLEMTEN 462

Query: 196 KTTVINL 176
           K   I L
Sbjct: 463 KLIAITL 469



>pir|B83867|B83867 NADP-dependent glyceraldehyde-3-phosphate
           dehydrogenase BH1738 [imported] - Bacillus halodurans
           (strain C-125)>gb:BA000004_655684 Bacillus halodurans
           C-125 DNA, complete genome.
          Length = 482

 Score =  137 bits (346), Expect = 2e-31
 Identities = 83/244 (34%), Positives = 127/244 (52%), Gaps = 1/244 (0%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  I + +G    L MELG     IVL+DA++  A A+ V G F  +GQ C  V+ + V
Sbjct: 236 TGEKIARSAGV-KKLAMELGSNSPTIVLQDAELMEAVASCVSGAFCAAGQNCIGVQRIYV 294

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            +SV +              +G  + ++ DI P++SE  A  IE  V +AKE+GA     
Sbjct: 295 EQSVFNSFIQSFVAQTKQLRLGDKQSEETDIGPMISEKEAKRIERWVEEAKEEGARVLTG 354

Query: 544 YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT 365
            +R G    P +L +V P  R+A EE F P++ +  ++S+ E I   N  +FGLQ  +FT
Sbjct: 355 GRRTGAYFEPTVLTNVSPSSRLAKEEAFAPIVIIEGVHSLTEAIARANDVDFGLQAGLFT 414

Query: 364 KDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTV 185
            ++  A    + +E G + +N +     D  PF GIK SG+G +G+  +I  MT+ K   
Sbjct: 415 NNLTAAFSAIEKLEVGGIMVNDSSDVRIDAMPFGGIKKSGLGREGVRYAIEEMTEQKVVA 474

Query: 184 INLP 173
            +LP
Sbjct: 475 FHLP 478



>gb:PSEORF1_160797 Pseudomonas aeruginosa pah genes for 12 ORFs
           (components of naphthalene dioxygenase, dehydrogenase,
           hydratase-aldolase, isomerase).
          Length = 483

 Score =  137 bits (345), Expect = 3e-31
 Identities = 84/226 (37%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADID A    V G F + GQ C + + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLIVDEKIADEFVAKFVEKT 308

Query: 673 XXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G P    DC I P+VS +S   I GL  DA +KGA        +G L+   +LDH
Sbjct: 309 KRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGLAQGALMPATILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V+ DMRI  EE FGP+  VIR     E +   N S +GL   VF +DIN+A+ +  ++E 
Sbjct: 369 VKSDMRIYDEETFGPITVVIRCKGEAEAVRIANDSVYGLSSGVFGRDINRALRVGMSIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G+V IN +  +     P+ G K++G G       I+  T++K   I
Sbjct: 429 GSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTEIKWLTI 474



>sp|Q52460|NAHF_PSESP Salicylaldehyde dehydrogenase (EC
           1.2.1.65).>pir|E49343|E49343 salicylaldehyde
           dehydrogenase (EC 1.2.1.-) - Pseudomonas sp. (strain
           C18)>gb:PSEDOXOP_160531 Pseudomonas sp. dox operon
           (doxABCDEFGHIJ) genes, complete cds.>gb:AF010471_468354
           Pseudomonas putida plasmid NPL1
           naphthalene-1,2-dioxygenase reductase component (nahA1),
           naphthalene-1,2-dioxygenase ferredoxin component
           (nahA2), naphthalene-1,2-dioxygenase terminal oxygenase
           large subunit (nahA3), naphthalene-1,2-dioxygenase
           terminal oxygenase small subunit (nahA4),
           1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase
           (nahB), salicylaldehyde dehydrogenase (nahF),
           1,2-dihydroxynaphthalene dioxygenase (nahC),
           2-hydroxybenzalpyruvate aldolase (nahE) and
           2-hydroxychromene-2-carboxylate isomerase (nahD) genes,
           complete cds.>gb:AF491307_515623 Pseudomonas putida NCIB
           9816-4 plasmid pDTG1, complete
           sequence.>gb:AY125981_590805 Pseudomonas fluorescens
           plasmid pLP6a naphthalene dioxygenase reductase
           component (nahAa), ferredoxin (nahAb), naphthalene
           dioxygenase large subunit (nahAc), naphthalene
           dioxygenase small subunit (nahAd), dihydrodiol
           dehydrogenase (nahB), and salicylaldehyde dehydrogenase
           (nahF) genes, complete cds; and 1,2-dihydroxynaphthalene
           dioxygenase (nahC) gene, partial cds.>gb:AY208917_597548
           Pseudomonas sp. ND6 plasmid pND6-1, complete sequence.
          Length = 483

 Score =  137 bits (345), Expect = 3e-31
 Identities = 84/226 (37%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADID A    V G F + GQ C + + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLIVDEKIADEFVAKFVEKT 308

Query: 673 XXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G P    DC I P+VS +S   I GL  DA +KGA        +G L+   +LDH
Sbjct: 309 KRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGLAQGALMPATILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V+ DMRI  EE FGP+  VIR     E +   N S +GL   VF +DIN+A+ +  ++E 
Sbjct: 369 VKSDMRIYDEETFGPITVVIRCKGEAEAVRIANDSVYGLSSGVFGRDINRALRVGMSIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G+V IN +  +     P+ G K++G G       I+  T++K   I
Sbjct: 429 GSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTEIKWLTI 474



>gb:AE009879_256850 Pyrobaculum aerophilum strain IM2 section 134 of
           201 of the complete genome.>gb:AE009441_899476
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 478

 Score =  137 bits (344), Expect = 4e-31
 Identities = 87/249 (34%), Positives = 123/249 (49%), Gaps = 2/249 (0%)
 Frame = -2

Query: 901 TGIAIXKKSG-AWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG  I  K+G A   + +ELGG D  I+L+DAD++LA    V G F + GQ CT+ K ++
Sbjct: 228 TGREIASKAGGALKTVTLELGGSDPLIILDDADLNLAVRIAVFGAFFHQGQICTSSKRII 287

Query: 724 VMESVADXXXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V E V D              VG P D   +  P++S   A+ +E    DA  +G     
Sbjct: 288 VHERVYDVFVKKFVERVSQLKVGDPRDRTVEQGPLISPRQADEMERFYQDAVSRGGRALT 347

Query: 547 PYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVF 368
             KR G   WP +   V  + RI  EE FGP+ PV+ + + +E +   N + +GL   V 
Sbjct: 348 GGKRAGAYFWPTVFVDVDRNFRIMREEVFGPIRPVVPVKNDDEAVEVANDTEYGLSAAVV 407

Query: 367 TKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTT 188
           T +IN+A  I++A+E+G V IN        H PF GIK SG G +G   S +  T  +  
Sbjct: 408 TTNINRAFKIAEAIESGMVHINDVTMLEESHVPFGGIKASGFGREGGEWSFHETTYDRWL 467

Query: 187 VINLPTPSY 161
            I L    Y
Sbjct: 468 TITLRERKY 476



>gb:Y14173_210988 Pseudomonas putida plasmid NPL-41 nahC gene and
           partial nahF and nahQ genes.
          Length = 264

 Score =  137 bits (344), Expect = 4e-31
 Identities = 84/227 (37%), Positives = 117/227 (51%), Gaps = 3/227 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADID A    V G F + GQ C + + ++V E +AD          
Sbjct: 29  LELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLIVDEKIADEFVAKFVEKT 88

Query: 673 XXXXVGAP---EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                G P     DC I P+VS +S   I GL  DA +KGA        +G L+   +LD
Sbjct: 89  KRLSAGDPCRLTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGLAQGALMPATMLD 148

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
           HV+ DMRI  EE FGP+  VIR     E +   N S +GL   VF +DIN+A+ +  ++E
Sbjct: 149 HVKSDMRIYDEETFGPITVVIRCKGEAEAVRIANDSVYGLSSGVFGRDINRALRVGMSIE 208

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
            G+V IN +  +     P+ G K++G G       I+  T++K   I
Sbjct: 209 YGSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTEIKWLTI 255



>pir|C84250|C84250 glyceraldehyde-3-phosphate dehydrogenase
           [imported] - Halobacterium sp. NRC-1>gb:AE005031_62527
           Halobacterium sp. NRC-1 section 62 of 170 of the
           complete genome.>gb:AE004437_887446 Halobacterium sp.
           NRC-1 complete genome.
          Length = 480

 Score =  136 bits (342), Expect = 6e-31
 Identities = 86/244 (35%), Positives = 125/244 (51%), Gaps = 5/244 (2%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G  + ++SG    L MELGG    IV EDAD+D AA     G   Y+GQRC+AV  VL  
Sbjct: 238 GEHVARQSGI-TRLHMELGGNAPAIVFEDADLDAAADAATAGSLKYAGQRCSAVSRVLAH 296

Query: 718 ESVADXXXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           ESV D              +G   D D  + P+VS   A+++  LV DA ++GAT  +  
Sbjct: 297 ESVHDELVSRIDDAMAEWSIGDLFDTDTTLGPLVSADQADWVAELVDDAVDRGATVVRGG 356

Query: 541 KREG----NLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGC 374
           +R      +   P LL  V  D RI  EE FGPV  V  +   ++ +   N S   L   
Sbjct: 357 ERHVEDGVHYYEPTLLADVPRDARIVDEEQFGPVCAVTTVTDEDDAVRTANGSELALDAA 416

Query: 373 VFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           VFT D ++A+ +++ +  G V+IN AP+ G    PF G   SGIG +G+ ++I+   + K
Sbjct: 417 VFTADHDRAMRVAERVNAGAVRINGAPSHGLGDVPFGGNDASGIGREGLDSTIHEFVREK 476

Query: 193 TTVI 182
           + ++
Sbjct: 477 SIIL 480



>pir|D90323|D90323 hypothetical protein gapN-1 [imported] -
           Sulfolobus solfataricus>gb:AE006776_222455 Sulfolobus
           solfataricus P2 section 135 of 272 of the complete
           genome.>gb:AE006641_1108303 Sulfolobus solfataricus P2,
           complete genome.
          Length = 470

 Score =  135 bits (340), Expect = 1e-30
 Identities = 83/246 (33%), Positives = 131/246 (53%), Gaps = 4/246 (1%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXP-LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG+ I  K+ +    + MELGG D  I+LEDA+I+ A++  V+  F Y+GQ C A K ++
Sbjct: 224 TGLKIASKAVSLGKRIIMELGGSDPIIILEDANIERASSIAVRARFEYAGQNCNAGKRII 283

Query: 724 VMESVADXXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V E + D              VG P D+  D+ PV+++ S   +  ++ DAK KG     
Sbjct: 284 VREEIYDKFVKAFNDKARALKVGDPLDETTDVGPVINKESVENLNSVLADAKAKGGKVEI 343

Query: 547 PYKR-EGNLIWPL-LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGC 374
             K  E    +PL ++ +   DM +   E FGP++P++ + S EE I   N++ +GLQ  
Sbjct: 344 LNKGPESGSFFPLTMVTNPSLDMLVLKSEVFGPIVPIVSVKSDEEAIRIANSTEYGLQSA 403

Query: 373 VFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +FT D+N+A+ +S  ++ G V IN +     D   F G K S IG +G+  ++  MT+ K
Sbjct: 404 IFTNDVNRALKLSRELKFGAVIINDSTRLRWDSLAFGGFKKSSIGREGVRETMLEMTENK 463

Query: 193 TTVINL 176
              I L
Sbjct: 464 LIAITL 469



>gb:CP000011_868173 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 484

 Score =  135 bits (339), Expect = 1e-30
 Identities = 84/241 (34%), Positives = 123/241 (51%), Gaps = 5/241 (2%)
 Frame = -2

Query: 898 GIAIXKKSGA---WXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVV 728
           G+AI K   A   +  + +ELGG D  IVL+DAD++ AAA   +G +  SGQRCTAVK +
Sbjct: 238 GVAIGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRI 297

Query: 727 LVMESVADXXXXXXXXXXXXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFC 551
           LV + VA                G P D  + +  V+ E++A   E  V +A  +GA   
Sbjct: 298 LVHKRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLL 357

Query: 550 QPYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCV 371
               R G L  P +LD V   M +  EE FGPV P+I  +++++ I   N + FGL   V
Sbjct: 358 TGNARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGV 417

Query: 370 FTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVK 194
            T   +  +   + +  GTV +   P    +  PF GIKDSG+G  +G+  ++   T +K
Sbjct: 418 CTDRADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLK 477

Query: 193 T 191
           T
Sbjct: 478 T 478



>gb:BX571966_793585 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 481

 Score =  135 bits (339), Expect = 1e-30
 Identities = 84/241 (34%), Positives = 123/241 (51%), Gaps = 5/241 (2%)
 Frame = -2

Query: 898 GIAIXKKSGA---WXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVV 728
           G+AI K   A   +  + +ELGG D  IVL+DAD++ AAA   +G +  SGQRCTAVK +
Sbjct: 235 GVAIGKSIAAKAGYRRIVLELGGNDPLIVLDDADLERAAALAAQGSYKNSGQRCTAVKRI 294

Query: 727 LVMESVADXXXXXXXXXXXXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFC 551
           LV + VA                G P D  + +  V+ E++A   E  V +A  +GA   
Sbjct: 295 LVHKRVAPRFTELLVEHTRAWTYGDPFDPANRMGTVIDEAAAALFEARVDEAVAQGARLL 354

Query: 550 QPYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCV 371
               R G L  P +LD V   M +  EE FGPV P+I  +++++ I   N + FGL   V
Sbjct: 355 TGNARRGALYAPTVLDRVDASMTLVREETFGPVSPIIAFDTIDDAIRISNGTAFGLSSGV 414

Query: 370 FTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVK 194
            T   +  +   + +  GTV +   P    +  PF GIKDSG+G  +G+  ++   T +K
Sbjct: 415 CTDRADAIVRFVNELNVGTVNVWEVPGYRLELTPFGGIKDSGLGYKEGVQEAMKSFTNLK 474

Query: 193 T 191
           T
Sbjct: 475 T 475



>gb:AF039533_472124 Pseudomonas stutzeri naphthalene degradation
           upper-pathway gene cluster (nahAa, nahAb, nahAc, nahAd,
           nahB, nahF, nahC, nahE, and nahD) and transposon-like
           protein (tnpA1) gene, complete cds.
          Length = 483

 Score =  134 bits (338), Expect = 2e-30
 Identities = 83/226 (36%), Positives = 118/226 (52%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADID A    V G F   GQ C + + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDADIDAAVKAAVFGSFLVQGQICMSTERLVVDEKIADEFAAKFAEKA 308

Query: 673 XXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G P    DC I P+VS +S   I GL  DA +KGAT       +G ++   +LDH
Sbjct: 309 KRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGATVACGGMAQGAVMPATILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V+ +MRI  EE FGP+  VIR +   E I   + S +GL   VF +DIN+A+ +  ++E 
Sbjct: 369 VKSNMRIYDEETFGPITVVIRCSGEAEAIRIASDSAYGLSSGVFGRDINRALRVGMSIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G+V IN +  +     P+ G K++G G       I+  T++K   I
Sbjct: 429 GSVHINGSTVQSEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTI 474



>gb:AF036940_471633 Ralstonia sp. U2 plasmid pWWU2 putative
           chemotaxis protein gene, partial cds; LysR-like regular
           protein (nagR), ferredoxin reductase (nagAa),
           salicylate-5-hydroxylase large oxygenase component
           (nagG), salicylate-5-hydroxylase small oxygenase
           component (nagH), ferredoxin (nagAb), naphthalene 1,2
           dioxygenase large oxygenase component (nagAc),
           naphthalene 1,2 dioxygenase small oxygenase component
           (nagAd), cis-naphthalene dihydrodiol dehydrogenase
           (nagB), salicylaldehyde dehydrogenase (nagF),
           1,2-dihydroxynaphthalene dioxygenase (nagC), putative
           aldolase (nagQ), trans-o-hydroxybenzylidenepyruvate
           hydratase-aldolase (nagE), 2-hydroxychromene carboxylate
           isomerase (nagD), glutathione-S-transferase-like protein
           (nagJ), gentisate 1,2-dioxygenase (nagI),
           fumarylpyruvate hydrolase (nagK), maleylpyruvate
           isomerase (nagL), NagM (nagM), and NagN (NagN) genes,
           complete cds; and putative transposase gene, partial
           cds.
          Length = 483

 Score =  133 bits (335), Expect = 4e-30
 Identities = 84/226 (37%), Positives = 116/226 (51%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADID A    V G F + GQ C + + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEFVAKFVEKT 308

Query: 673 XXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G P    DC I P+VS +S + I GL  DA  KGA        EG ++   +LDH
Sbjct: 309 KQLSAGDPCVTGDCIIGPMVSPNSGDRINGLFKDAISKGAKVVCGGIAEGAVMPATILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V  DM+I  EE FGP+  VIR  S  + I   N S +GL   VF +D+N+A+ +  A+E 
Sbjct: 369 VTADMQIYDEETFGPITVVIRCKSEADAIRIANDSAYGLSSGVFGRDVNRALRVGMAIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G+V IN +  +     P+ G K +G G       I+  T++K   I
Sbjct: 429 GSVHINGSTVQNEAQAPYGGTKATGYGRFDGRAVIDEFTELKWLTI 474



>gb:BA000028_697626 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 475

 Score =  133 bits (334), Expect = 5e-30
 Identities = 81/226 (35%), Positives = 117/226 (51%), Gaps = 1/226 (0%)
 Frame = -2

Query: 850 ELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXXX 671
           ELGG  A IV +DADI+ AA    K G+S SGQ C +V+ + V E + D           
Sbjct: 250 ELGGNAATIVHQDADIETAARLCAKTGYSNSGQSCISVQRIYVQEEIKDNFIELLKQEVS 309

Query: 670 XXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHVR 494
              VG P D   DI  +V E +A  +   + +A E GA   Q   + G  + P +L +  
Sbjct: 310 KLKVGDPLDPHTDIGTLVDEKAAGRVIEWINEAVESGAEIIQGGTKNGASVEPTVLFNPP 369

Query: 493 PDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETGT 314
              ++  EE FGP++ VI   ++EE I   N S FGLQ  +FT  I+ A  ++D ME G 
Sbjct: 370 KKSKVVCEEVFGPIVSVIPYKNIEEAIQESNDSPFGLQTGIFTNQIDLAYRVADEMEVGG 429

Query: 313 VQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + IN       DH P+ G+K+SGIG +G   ++  MT+ K  V+ +
Sbjct: 430 IVINGTSNFRLDHLPYGGVKNSGIGREGPRYALEEMTESKMVVLRV 475



>gb:AB004059_668 Pseudomonas putida DNA for reductase, ferredoxin,
           iron sulfer protein and dehydrogenase, complete cds.
          Length = 483

 Score =  132 bits (332), Expect = 9e-30
 Identities = 83/226 (36%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DA+ID A    V G F + GQ C + + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDANIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEFVAKFVEKT 308

Query: 673 XXXXVGAP--EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
               VG P    DC I P+VS +S   I GL  DA +KGA        +G ++   +LDH
Sbjct: 309 KRLSVGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGMAQGAVMPATILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V+ DMRI  EE FGP+  VIR     E I   N S +GL   VF +DIN+A+ +  ++E 
Sbjct: 369 VKSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSVYGLSSGVFGRDINRALRVGMSIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G V IN +  +     P+ G K++G G       ++  T++K   I
Sbjct: 429 GCVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVVDEFTELKWLTI 474



>gb:BA000028_695248 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 497

 Score =  132 bits (331), Expect = 1e-29
 Identities = 75/213 (35%), Positives = 108/213 (50%), Gaps = 6/213 (2%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +E+GGK+A IV++DAD+DLA   ++   F  SGQRCTA   V+V   V          
Sbjct: 250 VSLEMGGKNAVIVMDDADLDLAVEGILWSAFGTSGQRCTACSRVIVHHKVKKTLEERLLA 309

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQ-----PYKREGNLIW 518
                 +G   ED   + P+++E+  N I+  +   K++GAT             G    
Sbjct: 310 AMDHLTIGNGLEDGIKVGPIINEAGLNKIKKYIEVGKQEGATLLAGGTEWETNNPGYYFT 369

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P L    +PDMRIA EE FGPV+ +I ++S EE I   N   FGL   +FTKD+N+    
Sbjct: 370 PTLFTDAKPDMRIAQEEIFGPVVSLIEVSSFEEAIEVNNQVTFGLSSSIFTKDVNRVFKA 429

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
              ++TG V +N+       H PF G K +G G
Sbjct: 430 QRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG 462



>pir|H98159|H98159 hypothetical protein AGR_L_1010GM [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>pir|AI3127|AI3127 vanillin: NAD oxidoreductase
           vdh [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE008222_234743 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 26 of 187 of the
           complete sequence.>gb:AE009392_251466 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 162 of
           187 of the complete sequence.>gb:AE007870_1079856
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1089309 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 483

 Score =  131 bits (330), Expect = 2e-29
 Identities = 80/237 (33%), Positives = 120/237 (50%), Gaps = 2/237 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWX-PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           G  I + +G +  P  +ELGGK   IVL+DADID A A    G +   GQ C + + ++V
Sbjct: 234 GRVIAETAGRYLKPALLELGGKAPFIVLDDADIDAAVAAAAFGAYMNQGQICMSTERIIV 293

Query: 721 MESVADXXXXXXXXXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
           ++S+AD               G P E    +  +VS  +A+ I  LV DA  KGA     
Sbjct: 294 LDSIADTFVEAFAKKAASLTAGDPREGKTPLGSLVSAEAASRIRVLVDDAVSKGARRVAG 353

Query: 544 YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT 365
              +G ++  + +D V P MR+  EE FGPV+ +IR  S++E +   N S FGL   VF 
Sbjct: 354 GGGDGTMLDAIAVDGVTPAMRLYSEESFGPVVSIIRAGSIDEAVSIANESEFGLSAAVFG 413

Query: 364 KDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +D  +A+ ++  +E+G   +N          PF G+K SG G  G T  I   T+++
Sbjct: 414 RDQARALSVAARIESGICHVNGPTVHDEAQLPFGGVKASGYGRFGGTAGIAEFTELR 470



>gb:AY641982_638347 Edwardsiella ictaluri clone pBK71AB hypothetical
           proteins, rmpB-like protein, hypothetical protein,
           putative permease, NAD-dependent aldehyde dehydrogenase,
           and putative phosphopyruvate decarboxylase genes,
           complete cds.
          Length = 465

 Score =  131 bits (329), Expect = 2e-29
 Identities = 78/237 (32%), Positives = 123/237 (51%), Gaps = 2/237 (0%)
 Frame = -2

Query: 877 SGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXX 698
           +  +  + +ELGG D  I++ DAD++ A   VV+G +S SGQRCTAVK VL  +S+    
Sbjct: 229 TAGYRKIVLELGGNDPLIIMPDADLERATDLVVRGSYSNSGQRCTAVKRVLAHKSIVHDL 288

Query: 697 XXXXXXXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                        G P     +   V+ E +A  I+ +V  A ++GA      +R G L+
Sbjct: 289 NYLVAEKSKAWVTGDPMQSATMMGTVIDEEAAIRIQNVVNGAIDQGARLLSGNQRNGALL 348

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P +L +V P M++  +E FGPV P+I   ++ E I   N++ +GL   + T  ++    
Sbjct: 349 SPTVLTNVDPKMQLVTQETFGPVTPIITFETISEAIAIANSTAYGLSSALCTNRLDWIKE 408

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVKTTVINLP 173
            S  +  GT+ +   P    +  PF GIKDSG+G  +G+  S+   T +KT  I+LP
Sbjct: 409 FSSRLNVGTMNVWEVPGFRTELSPFGGIKDSGLGLKEGVRESMKNYTNIKT--ISLP 463



>gb:AY123973_590641 Rhodococcus sp. Phi2 cyclohexanone oxidation
           gene cluster, partial sequence.
          Length = 459

 Score =  130 bits (328), Expect = 3e-29
 Identities = 86/211 (40%), Positives = 109/211 (51%), Gaps = 4/211 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IVL DAD+D AAA  V G     GQ CTA K  LV E V D          
Sbjct: 229 LELGGSDPFIVLGDADVDAAAAAAVVGRLGNGGQACTASKRFLVEEPVYDEFVRKFLDGM 288

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGA---TFCQPYKREGNLIWPLLL 506
                  P   +  + P+ S S+ + ++ LV DA  +GA   T   P   +G    P +L
Sbjct: 289 ISWQPSDPTSPETKLGPLSSRSAVDELDELVQDAVSRGAQVLTGGDPRDEKGAYYPPTVL 348

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V PDMR  +EE FGPV  V R+ S++E I   N S FGL   VFT D  KA  +++ +
Sbjct: 349 VGVTPDMRAYYEELFGPVAVVHRVGSLDEAIEAANDSPFGLSSSVFTSDPQKADRVAEEL 408

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
           ETG V INS     PD  PF G+K SG+G +
Sbjct: 409 ETGMVWINSTSKSSPD-LPFGGVKRSGVGRE 438



>pir|T44939|T44939 glyceraldehyde-3-phosphate dehydrogenase (NADP)
           (EC 1.2.1.9) [validated] - Thermoproteus
           tenax>gb:TTGAPN_198444 Thermoproteus tenax GAPN gene.
          Length = 501

 Score =  130 bits (328), Expect = 3e-29
 Identities = 83/240 (34%), Positives = 119/240 (49%), Gaps = 6/240 (2%)
 Frame = -2

Query: 880 KSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADX 701
           K G      MELGG D  IVLEDAD+DLAA  + +G +SY+GQRC A+K+VL    V   
Sbjct: 253 KVGGVKQYVMELGGGDPAIVLEDADLDLAADKIARGIYSYAGQRCDAIKLVLAERPVYGK 312

Query: 700 XXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG-N 527
                        VG P D   D+ P++S S+ + +   + DA EKG       +R G  
Sbjct: 313 LVEEVAKRLSSLRVGDPRDPTVDVGPLISPSAVDEMMAAIEDAVEKGGRVLAGGRRLGPT 372

Query: 526 LIWPLLL----DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
            + P L+    D V+ DM +   E F PV   + +  +++ I   N   +GL   VF +D
Sbjct: 373 YVQPTLVEAPADRVK-DMVLYKREVFAPVASAVEVKDLDQAIELANGRPYGLDAAVFGRD 431

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           + K       +E G + IN  P  G  ++PF G K SG+  +GI  ++  +T  KT V N
Sbjct: 432 VVKIRRAVRLLEVGAIYINDMPRHGIGYYPFGGRKKSGVFREGIGYAVEAVTAYKTIVFN 491



>gb:AY034888_1559674 Tortula ruralis aldehyde dehydrogenase Aldh21A1
           (RNP123) mRNA, complete cds.
          Length = 483

 Score =  130 bits (327), Expect = 3e-29
 Identities = 79/226 (34%), Positives = 117/226 (51%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDA-DIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXX 677
           MELGG   CIV +   D+D     ++ GGF   GQ C  ++ + V E + D         
Sbjct: 252 MELGGNAPCIVDDYVPDLDYTIQRLINGGFYQGGQSCIHMQRLYVHERLYDEVKAEFLAQ 311

Query: 676 XXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                VG P EDD  I P++SE  A  +E  V +A EKG        R+G ++ P +L+ 
Sbjct: 312 VKKLKVGNPFEDDTFIGPMISEKDATRVEDWVKEAVEKGGKLLCGGSRKGAVMQPTVLED 371

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V  D     EE FGPV+   + +  +E +  CN +++GLQ  +FTKD+NKA    + ME 
Sbjct: 372 VPMDAMARKEEIFGPVVLFYKYSDFKEAVKECNNTHYGLQSGIFTKDLNKAFYAFEHMEV 431

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G V +N +PA   D  P+ G+KDSGI  +G+  ++    + K  V+
Sbjct: 432 GGVILNDSPALRVDSQPYGGLKDSGIQREGVKYAMEDYLETKVLVM 477



>gb:BX571966_793852 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 490

 Score =  130 bits (327), Expect = 3e-29
 Identities = 77/223 (34%), Positives = 120/223 (53%), Gaps = 2/223 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IV+EDAD++ AA    KG +  SGQRCTAVK +LV  +VA           
Sbjct: 254 LELGGNDPLIVMEDADLERAAQLAAKGSYKNSGQRCTAVKRILVERTVARPFTELLVEHS 313

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G P D+  DI  ++ +++A      V +A++ GA     ++R+G    P +L+ V
Sbjct: 314 RRWQTGDPMDERVDIGTLIDDAAAIECARRVDEARDAGARVLLGHQRDGAAYAPTVLERV 373

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
            P +R+  +E FGPV PVI    ++E +   N++ +GL   V T  ++    +   ++ G
Sbjct: 374 GPALRLVQQETFGPVSPVITFCGLDEAVAIANSTRYGLSSGVCTNRLDYITHLIAHLDVG 433

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGS-QGITNSINMMTKVKT 191
           TV +   P    +  PF G+KDSG+GS +G+  +I   T +KT
Sbjct: 434 TVNVWEVPGFRLESTPFGGVKDSGLGSKEGMQEAIKNFTNLKT 476



>gb:BA000040_730948 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 482

 Score =  130 bits (327), Expect = 3e-29
 Identities = 78/235 (33%), Positives = 114/235 (48%), Gaps = 1/235 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGK   +VL+DAD+D A A V  G F   GQ C + + V+V ESVAD       
Sbjct: 246 PVLLELGGKAPLVVLDDADLDAAVAAVAFGAFINQGQVCMSTERVIVDESVADQFVAKLA 305

Query: 682 XXXXXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P      I  ++ E+ A  +  L+ DA  +GA      +R G ++   +L
Sbjct: 306 KKAGALPAGDPRSGPVVIGSMIDEAPARHVVALIDDAIGRGAVKLAGGERAGTVVPATVL 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V P MRI  EE FGPV+ VIR   V++ +   N + +GL   VF +D+ +A+ ++  +
Sbjct: 366 DRVVPGMRIYSEESFGPVVSVIRARGVDDAVRLANDTEYGLSAAVFGRDVARALTVAQRI 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           E+G   +N          PF G+K SG G  G    I   T ++   I      Y
Sbjct: 426 ESGICHVNGPTVHDEAQMPFGGVKGSGYGRFGGQAGIAEFTDLRWITIETQPQHY 480



>gb:BA000028_697227 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 486

 Score =  130 bits (327), Expect = 3e-29
 Identities = 86/235 (36%), Positives = 120/235 (51%), Gaps = 10/235 (4%)
 Frame = -2

Query: 856 QMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXX 677
           Q+E+GGK+  IV +DAD+DLA    + GG S +GQ+CTA   V+V  SV D         
Sbjct: 252 QLEMGGKNPVIVADDADLDLAVKATISGGLSSTGQKCTATSRVIVQRSVYDAFKEKLLTQ 311

Query: 676 XXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNLI 521
                VG   ED   + P VSES    +   +   KE+GAT      R       +GN +
Sbjct: 312 IQALTVGNGLEDGNWMGPSVSESQLETVLHYIKKGKEEGATLLTGGHRLTDAEHKDGNFV 371

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P + + V  DM IA EE FGPVL +I++ + EE +   N + +GL   VFT++I K + 
Sbjct: 372 EPTVFEDVTNDMTIAQEEIFGPVLALIKVETFEEAMKLANDTEYGLSAAVFTENIRKMLT 431

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGS--QGITNSINMMTKVKTTVI 182
             D +E G V++N+  A      PF G+K S   S  QG   +I   T +KT  I
Sbjct: 432 FIDDIEVGLVRVNAETAGVELQAPFGGMKSSSSHSREQG-KAAIEFFTSIKTVFI 485



>gb:BA000028_697094 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 486

 Score =  130 bits (326), Expect = 5e-29
 Identities = 73/223 (32%), Positives = 115/223 (51%), Gaps = 1/223 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGG  A IVLEDAD+D A +  V   F++ GQ C +   ++V E V D        
Sbjct: 250 VHLELGGNSALIVLEDADVDYAVSAGVFSRFTHQGQICMSANRIIVHEDVYDEFVQKYAD 309

Query: 679 XXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                  G P D   I  P+++E        L+    E+GA      +  GN++ P++  
Sbjct: 310 KVKTLTCGDPADSSTIIGPLINERQVQNTVNLIEKGVEEGAHPLVRGQVNGNVVEPVIFT 369

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V PDM+IA EE F PV+ +++++S E+ I + NAS++GL G V T D+N+   ++  +E
Sbjct: 370 EVTPDMQIANEEFFAPVVAIMKVSSEEQAIAYANASSYGLSGAVHTSDVNRGAEVAKQLE 429

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +G + IN        +  F G+K+SG+G      S+   T  K
Sbjct: 430 SGMIHINDGTINDEPNVAFGGVKNSGVGRLNGEWSLEAFTTTK 472



>gb:AE010987_268175 Methanosarcina acetivorans str. C2A, section 332
           of 534 of the complete genome.>gb:AE010299_908734
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 503

 Score =  130 bits (326), Expect = 5e-29
 Identities = 79/236 (33%), Positives = 121/236 (51%), Gaps = 9/236 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+  I+++DAD++LA   V+ G F  +GQRCTA   +++ E + D        
Sbjct: 257 VSLELGGKNPVIIMDDADLELALEGVLWGAFGTTGQRCTATSRLILHEKIKDEFTARLLA 316

Query: 679 XXXXXXVG---APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-----EGNL 524
                 VG    PE D  I P+++++    IE  V    E+GAT     K       G  
Sbjct: 317 KTKLLRVGNGLLPETD--IGPIINKAQLEKIERYVRIGMEEGATLLLGGKAIDPGLPGYF 374

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P +   VRPDMRIA EE FGPVL +I ++ +EE I   N + +GL   ++T+++ KA 
Sbjct: 375 FEPTVFTDVRPDMRIAQEEIFGPVLSIITVSGLEEAIEVANNTRYGLSSAIYTENVGKAF 434

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVKTTVIN 179
                +E G   +N+       H PF G+K +G G  +  T +I   T++K   I+
Sbjct: 435 RAVKKIEAGITYVNAPTIGAEVHLPFGGVKGTGNGFREAGTEAIKEFTEIKAVYID 490



>gb:AB126619_15527 Geobacillus kaustophilus genomic DNA,
           clone:GKB15K.>gb:BA000043_738496 Geobacillus
           kaustophilus HTA426 DNA, complete genome.
          Length = 478

 Score =  129 bits (325), Expect = 6e-29
 Identities = 71/241 (29%), Positives = 125/241 (51%), Gaps = 1/241 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           GIAI  K+G    + +ELG   A IV E  D+D      V G F++ GQ C +++ + V 
Sbjct: 237 GIAIRNKAGL-KRVTLELGSNSAVIVDEQVDLDRIIPRCVFGAFTFQGQVCISLQRIYVH 295

Query: 718 ESVADXXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           E+  D               G P D   D++ +++ +  +     + +AK+ GA      
Sbjct: 296 ENRYDEFVEKFVAAAKQLKTGDPLDPTTDVSALITPNDVDRALSWIEEAKQGGANVVLGG 355

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           +R+GN++ P ++    P M+++ +E F P++ + R+ S++E I   N S +GLQ  ++T 
Sbjct: 356 ERDGNILLPTVIVDAEPTMKVSCQEVFAPIVLINRVRSIDEAIELVNDSRYGLQAGIYTD 415

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +++ A   +  +  G V IN  P    DH P+ G+K+SG G +G+  +I  MT++K  + 
Sbjct: 416 NVHTAWKAAKQLHVGGVLINDIPTFRVDHMPYGGVKESGFGREGVRYAIEEMTELKLIIF 475

Query: 181 N 179
           N
Sbjct: 476 N 476



>pir|E90504|E90504 hypothetical protein gapN-3 [imported] -
           Sulfolobus solfataricus>gb:AE006908_223907 Sulfolobus
           solfataricus P2 section 267 of 272 of the complete
           genome.>gb:AE006641_1109755 Sulfolobus solfataricus P2,
           complete genome.
          Length = 509

 Score =  129 bits (325), Expect = 6e-29
 Identities = 84/231 (36%), Positives = 117/231 (50%), Gaps = 6/231 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG D  IVL DAD+  AA  +  G  SY+GQRC +VK+VLV E V D          
Sbjct: 269 MELGGGDPAIVLSDADLAWAAQRIAAGIISYTGQRCDSVKLVLVEEEVYDTLKDLLIKEL 328

Query: 673 XXXXV-GAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG-NLIWPLLLD 503
                 G P D    + PV+   + +  E  + DA EKG       KR G   I P+L++
Sbjct: 329 TKSVKVGDPRDPLTTVGPVIDVKTVDEWEKAIKDAVEKGGKILFGGKRLGPTYIEPVLIE 388

Query: 502 HVRP---DMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
             +    DM    +E F     +I++ +++E +   N+  +GL   +F KDINK   +  
Sbjct: 389 APKETLKDMYFYNKEVFASAALLIKVKNIDEALEISNSRKYGLDAAIFGKDINKIRKLQR 448

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            +E G + IN  P  G  +FPF G KDSGIG +GI  +I  +T  K+ V N
Sbjct: 449 FLEVGAIYINDYPRHGIGYFPFGGRKDSGIGREGIGYTIQYVTAYKSIVYN 499



>gb:BX321863_774328 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 8/10.
          Length = 443

 Score =  129 bits (324), Expect = 8e-29
 Identities = 81/222 (36%), Positives = 114/222 (51%), Gaps = 1/222 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IVL DADI  AA   V G F  +GQ C A K ++V++ + +          
Sbjct: 214 LELGGSDPFIVLGDADIPAAAKAAVIGRFQNNGQSCIAAKRLIVLKEIEEVFTSTLLAEV 273

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
               VG P D+  DI P+VSE +A  +E  V DA  KGA       R+G    P +L  V
Sbjct: 274 EKLVVGDPLDEATDIGPLVSEQAAETMEQFVLDAVAKGAMVRTGGTRKGAYFTPTVLTGV 333

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
              M +  +E FGPVLPVI  ++VEE I   NA+ FGL   V+++D+ K   ++  +  G
Sbjct: 334 HSAMEVMTQEVFGPVLPVITADTVEEAITLANATRFGLGASVWSRDLEKGEQVARQLAAG 393

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
              +NS     P   PF GI++SG+G +     +     +KT
Sbjct: 394 ATFVNSITKSDP-RMPFGGIRESGLGRELSYWGVREFANIKT 434



>gb:AE017180_399407 Geobacter sulfurreducens PCA, complete genome.
          Length = 475

 Score =  128 bits (322), Expect = 1e-28
 Identities = 79/242 (32%), Positives = 118/242 (48%), Gaps = 1/242 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G+ I ++SG    + +ELG     I+ +D D+D A A  V G F+ SGQ C +V+ + V 
Sbjct: 235 GVQIKERSGL-KRVTLELGSNSPTIIEDDGDVDAAVARCVVGSFANSGQVCISVQRIFVH 293

Query: 718 ESVADXXXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           +                  VG P D DCDI P++S          + +A   GA      
Sbjct: 294 QRRYREFVDKFVAATQKLKVGDPMDRDCDIGPMISREELQRAVEWLGEATSLGARLETGG 353

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
              GN + P +L  V PDM++   E F P++ VI   + ++ +   + S +GLQ  V+T 
Sbjct: 354 TVAGNCLTPAILSGVTPDMKVVCSEVFAPIVSVIPYETFDQALDMADDSIYGLQAGVYTS 413

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DINKA      ++ G V IN  P    DH P+ G K SG+G +GI  ++  MT +K   +
Sbjct: 414 DINKAFKAIRRLDVGGVIINDIPTFRVDHMPYGGNKQSGLGREGIRYAMEEMTNIKFVCL 473

Query: 181 NL 176
           NL
Sbjct: 474 NL 475



>gb:PPU536324_159840 Pseudomonas putida ech gene, vdh gene, fcs gene
           and aat gene (partial).
          Length = 485

 Score =  128 bits (322), Expect = 1e-28
 Identities = 75/229 (32%), Positives = 118/229 (51%), Gaps = 2/229 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVK-GGFSYSGQRCTAVKVVLVMESVADXXXXXX 686
           P  +ELGGK   +VL DAD++ AA +    G +   GQ C + + ++V ++VAD      
Sbjct: 248 PAVLELGGKAPFLVLADADLEAAAVDAAAFGAYFNQGQICMSTERLIVDQAVADEFVAKL 307

Query: 685 XXXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLL 509
                      P + D  +  ++   +   I+ LV DA  KGAT     +R G+++ P+L
Sbjct: 308 GEKVRRLRAADPSQPDAPLGSLIDAGAGERIQALVDDAVGKGATLVAGGERTGSVMQPVL 367

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           LDHV   MR+  EE FGPV  V+R +  E  +   N S FGL   +F++D  +A+ ++  
Sbjct: 368 LDHVNAGMRLYREESFGPVAVVLRASGDEALLALANDSEFGLSAAIFSRDTQRALALAQR 427

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +E+G   IN          PF G+K SG GS G T +I+  T+++   +
Sbjct: 428 LESGICHINGPTVHDEAQMPFGGVKASGYGSFGSTAAIDAFTQLRWVTV 476



>pir|AD2277|AD2277 aldehyde dehydrogenase [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_684760 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 498

 Score =  128 bits (322), Expect = 1e-28
 Identities = 72/234 (30%), Positives = 124/234 (52%), Gaps = 9/234 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +E+GGK+A +V+EDAD++LA    + G F  +GQRCTA   +++   + +          
Sbjct: 251 LEMGGKNAQVVMEDADLELALDGALWGAFGTTGQRCTATSRLILHRDIKEKFTTMLRERT 310

Query: 673 XXXXVGA-PEDDCDITPVVSESSANFIEGLVTDAKEKGATFC-------QPYKREGNLIW 518
               +GA  E + DI P+++      +   +  A+E+GA          +   ++G    
Sbjct: 311 SQLRLGAGTEPETDIGPIINNRQLQRVHEYMNIAREEGAKILIGGEIATEGQLQQGYFFQ 370

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +LD+V P MR+A EE FGPV+ +I +++ EE I   N + +GL   V+T+DIN+A + 
Sbjct: 371 PTILDNVTPQMRVAREEIFGPVVALIEVSTFEEAIAILNDTKYGLSSSVYTRDINRAFVA 430

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVKTTVIN 179
              +E G   IN        H PF G+K +G G  +  T ++++ T+ K+  ++
Sbjct: 431 MRDIEAGITYINGPTIGAEVHLPFGGVKQTGNGHREAGTTALDVFTEWKSVYVD 484



>gb:AP006840_567911 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 477

 Score =  128 bits (321), Expect = 2e-28
 Identities = 77/218 (35%), Positives = 113/218 (51%), Gaps = 8/218 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + MELGG    IV EDAD+D A   VV   F  +GQ C     + V ES+A         
Sbjct: 241 VSMELGGNAPFIVFEDADLDAAVQGVVISKFRNAGQTCICANRIYVQESIAPAFTERLVE 300

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 VG   E+  ++ P++ E++   +EG V+DA+ KGA       R        G  
Sbjct: 301 AVRGLRVGHGLEEGINVGPLIDEAAYVKVEGHVSDARGKGARVLTGGHRLTGPGFDRGFF 360

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P LLD V  +MRI  EE FGPV P++   + EE I   N +N+GL   +FT+++ + +
Sbjct: 361 YAPTLLDQVSDEMRIVHEETFGPVAPILTFRTEEEVIRRANDTNYGLAAYIFTRNLGRTV 420

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQG 230
            +S+A+E G V +N +    P   PF G+K+SG+G +G
Sbjct: 421 RVSEALEYGMVAVNDSLLAVP-QAPFGGVKESGLGREG 457



>pir|H72562|H72562 probable aldehyde dehydrogenase APE1786 -
           Aeropyrum pernix  (strain K1)>gb:BA000002_652533
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 485

 Score =  127 bits (320), Expect = 2e-28
 Identities = 81/247 (32%), Positives = 130/247 (52%), Gaps = 6/247 (2%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG+ + + +G    L MELGG D  IVL DAD+  AA+ +  G  SYSGQRC A+K+VLV
Sbjct: 230 TGVKVMRSAGI-KQLIMELGGGDPAIVLADADLKSAASKIATGITSYSGQRCDAIKLVLV 288

Query: 721 MESVADXXXXXXXXXXXXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E V +              VG P +D   + P++ + + + +   + +A  +GA     
Sbjct: 289 EEPVYNEMKKLLVEELSKIKVGDPRNDSTTMGPLIDKEAVDAMVEAIEEAVSRGAKLLYG 348

Query: 544 YKREGNL-IWPLLLD----HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQ 380
            +R G+  I P L++    +V  ++++  +E F PV  +   ++++E I   N   +GL 
Sbjct: 349 GERIGDTYITPALVEVEDKNVLRELKLYKDEVFAPVAVITSFSTLDEAIELANGRRYGLD 408

Query: 379 GCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTK 200
             +F + + +   +   +E G + IN  P  G  ++PF G KDSGIG +GI  SI  +T 
Sbjct: 409 AAIFGESMARIRKLIRFLEVGAIYINEYPRHGIGYYPFGGRKDSGIGREGIGYSIEYVTA 468

Query: 199 VKTTVIN 179
           +KT V N
Sbjct: 469 LKTIVYN 475



>gb:BX571966_794028 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_867998
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 482

 Score =  127 bits (318), Expect = 4e-28
 Identities = 73/234 (31%), Positives = 111/234 (47%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D A   +  G F   GQ C + + V+   ++AD       
Sbjct: 247 PALLELGGKAPVVVLDDADLDAAVDAIAFGAFFNQGQICMSTERVIAARAIADALVDKLA 306

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                   G P     +  +VS  +A     LV DA  +GA      + +G ++ P ++D
Sbjct: 307 AKARTLAAGDPRAGLPLGAMVSRDAAARAAALVDDAASRGAALPLGCRVDGAIMQPTIVD 366

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V PDMR+  EE F PV+ V+R    E  I   N S FGL   VF +D+ +A+ ++  +E
Sbjct: 367 RVTPDMRLYREESFAPVVAVLRAGDDEHAIALANDSAFGLAASVFGRDLARALAVARRIE 426

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           +G   +N          PF G+K SG G  G   SI   T+++   +     +Y
Sbjct: 427 SGICHVNGPTVHDEAQMPFGGVKASGYGRFGGAASIAEFTELRWLTVQTAPRAY 480



>gb:AP006627_562351 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 481

 Score =  126 bits (317), Expect = 5e-28
 Identities = 83/242 (34%), Positives = 117/242 (48%), Gaps = 1/242 (0%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVM 719
           G+ I KK+G      MELG     IVLEDA I+ A    V G F  +GQ C  V+ + V 
Sbjct: 237 GLEIAKKAGL-KKKSMELGSNSPVIVLEDAQIEDAVKANVSGAFWAAGQNCIGVQRLYVH 295

Query: 718 ESVADXXXXXXXXXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY 542
           E V D              +G    +  D+ P++SE  A  +  +V DA   GA      
Sbjct: 296 EEVYDRFKELFVKQSCAYLMGEKLSEKTDMGPLISEKEAKRVAFMVDDALRMGAALLCGG 355

Query: 541 KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           KR G    P +L++V  +  +A EE FGPV+ + +I S+ EGI   N S++GL   +FT+
Sbjct: 356 KRRGAFYEPTVLENVPDECMLAKEEIFGPVVLLYKIKSLAEGIERANQSDYGLHAGLFTE 415

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
            +N        +E G V +N +     D  PF G K SG+G +G+  SI  MT+ K    
Sbjct: 416 SMNAVFQAIQELEAGGVMVNDSSDFRIDAMPFGGTKQSGLGREGVKFSILEMTEQKVVCF 475

Query: 181 NL 176
            L
Sbjct: 476 KL 477



>gb:AL646077_548596 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 2/11.
          Length = 484

 Score =  126 bits (317), Expect = 5e-28
 Identities = 76/236 (32%), Positives = 118/236 (50%), Gaps = 2/236 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGK+  ++L+DAD+D A      G F   GQ C + + ++V  ++AD       
Sbjct: 247 PVLLELGGKNPLVILDDADLDAAVQAAAFGAFFNQGQICMSTERIIVDRAIADRFVERLT 306

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-EGNLIWPLL 509
                   G P +D   +  +V  S+A  I  LV DA  KGA       R +GN++ P +
Sbjct: 307 DKAGALRAGRPGQDGAVLGGMVDASAAQRIRHLVDDAVGKGARLRTGALRIDGNIVQPAV 366

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           +D V P M +  EE FGPV+ V+R    E+ I   N S +GL   VF++DI +A+ ++  
Sbjct: 367 VDGVTPAMALYGEESFGPVVAVLRAADDEDAIRLANDSEYGLSAAVFSRDIARAMQVARR 426

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           +E+G   IN          PF G+K SG G  G   +I+  T+++   +      Y
Sbjct: 427 IESGICHINGPTVHDEAQMPFGGVKASGYGRFGGKAAIDAFTELRWITVQAGARHY 482



>gb:CR555306_108459 Azoarcus sp. EbN1 complete genome.
          Length = 480

 Score =  126 bits (317), Expect = 5e-28
 Identities = 78/229 (34%), Positives = 111/229 (48%), Gaps = 1/229 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK   IVL+DAD+D A      G F + GQ C A   ++V   + D        
Sbjct: 245 ITLELGGKSPMIVLKDADVDYAVNAAAFGIFLHQGQVCMANSRLIVEAPIFDVFCDKLAT 304

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                 VG P D    I P++       ++  V DA  KGA      K +G    P +L 
Sbjct: 305 KIAGFKVGDPRDPQTVIGPLIDRKQCAVLDRHVADAVAKGAKLLHGGKSDGAFYQPTILA 364

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V PDM +  EE FGP + VIR    E+ +   N S +GL   + T D+ KA  +S  +E
Sbjct: 365 GVTPDMVVFREESFGPAVSVIRAADSEDALRLANDSCYGLSSGLITNDLQKAFDLSLRLE 424

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            G V IN +      H PF G+KDSG G +G  +S++ MT++K   + +
Sbjct: 425 AGMVHINDSSIMDEPHVPFGGVKDSGFGREGGHHSMDEMTELKWITVQM 473



>gb:PFL536325_157975 Pseudomonas fluorescens ferR gene, ech gene,
           vdh gene, fcs gene, aat gene and fcd gene.
          Length = 482

 Score =  126 bits (316), Expect = 7e-28
 Identities = 75/224 (33%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D A A    G +   GQ C + + ++V   VAD       
Sbjct: 246 PALLELGGKAPLLVLDDADLDAAVAAAAFGAYFNQGQICMSTERLIVDAKVADAFVAKLA 305

Query: 682 XXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P   D  +  +V  S+   I+ L+ DA  KGA      + +G+++ P LL
Sbjct: 306 AKVATLRAGDPSAADSVLGSLVDVSAGTRIKALIDDALSKGARLVVGGQLDGSILQPTLL 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V   MR+  EE FGPV  ++R +  EE +   N S FGL   +F++D  +A+ ++  +
Sbjct: 366 DGVTESMRLYREESFGPVAVLLRGSGDEELLRLANDSEFGLSAAIFSRDTGRALALAQRV 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           E+G   IN          PF G+K SG GS G   SI   T+++
Sbjct: 426 ESGICHINGPTVHDEAQMPFGGVKSSGYGSFGGKASIEHFTQLR 469



>sp|O93344|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:AF064253_2471394 Gallus gallus
           retinaldehyde dehydrogenase 2 (RALDH2) mRNA, complete
           cds.>gb:AF181680_2478897 Gallus gallus retinaldehyde
           dehydrogenase 2 (Raldh2) mRNA, complete cds.
          Length = 499

 Score =  126 bits (316), Expect = 7e-28
 Identities = 86/231 (37%), Positives = 117/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 266 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIYVEESIYEEFVRRSVERA 325

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 326 KRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGITEGAKLECGGKGLGRKGFFIEPTVF 385

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +V+E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 386 SNVTDDMRIAKEEIFGPVQEILRFKTVDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 445

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +   + +   ++VKT  I +P
Sbjct: 446 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGESGLREYSEVKTVTIKIP 495



>gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class 1,
           mRNA (cDNA clone MGC:79912 IMAGE:4031362), complete cds.
          Length = 502

 Score =  125 bits (315), Expect = 9e-28
 Identities = 83/231 (35%), Positives = 120/231 (51%), Gaps = 5/231 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+DLA  +   G F + GQ C A   + V E + D          
Sbjct: 269 LELGGKSPNIIFADADLDLAVEHAHNGLFYHQGQCCIAGSRIFVEEPIYDEFVRKSVERA 328

Query: 673 XXXXVGAPEDD--CDITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLL 509
               +G P     C   P + +   N I  L+   K++GA   C    +  +G  I P +
Sbjct: 329 KKRVLGDPLTPGVCQ-GPQIDKEQYNKILELIESGKKEGAKLECGGSAWGEKGFYISPTV 387

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
              V+ DMRIA EE FGPV  +++  +++E I   N +N+GL   VFTKD++KAIL+S A
Sbjct: 388 FSDVKDDMRIAKEEIFGPVQQILKFKTIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTA 447

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           ++ GTV IN   A  P   PF G K SG G +     ++  T+VKT ++N+
Sbjct: 448 LQAGTVWINCYSAMSPQS-PFGGFKMSGNGREMGEYGLHEYTEVKTVIMNI 497



>gb:AB016717_2460745 Xenopus laevis mRNA for aldehyde dehydrogenase
           class 1, complete cds.
          Length = 414

 Score =  125 bits (315), Expect = 9e-28
 Identities = 83/231 (35%), Positives = 120/231 (51%), Gaps = 5/231 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+DLA  +   G F + GQ C A   + V E + D          
Sbjct: 181 LELGGKSPNIIFADADLDLAVEHAHNGLFYHQGQCCIAGSRIFVEEPIYDEFVRKSVERA 240

Query: 673 XXXXVGAPEDD--CDITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLL 509
               +G P     C   P + +   N I  L+   K++GA   C    +  +G  I P +
Sbjct: 241 KKRVLGDPLTPGVCQ-GPQIDKEQYNKILELIESGKKEGAKLECGGSAWGEKGFYISPTV 299

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
              V+ DMRIA EE FGPV  +++  +++E I   N +N+GL   VFTKD++KAIL+S A
Sbjct: 300 FSDVKDDMRIAKEEIFGPVQQILKFKTIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTA 359

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           ++ GTV IN   A  P   PF G K SG G +     ++  T+VKT ++N+
Sbjct: 360 LQAGTVWINCYSAMSPQS-PFGGFKMSGNGREMGEYGLHEYTEVKTVIMNI 409



>gb:AE016786_332775 Pseudomonas putida KT2440 section 13 of 21 of
           the complete genome.>gb:AE015451_947852 Pseudomonas
           putida KT2440 complete genome.
          Length = 482

 Score =  125 bits (315), Expect = 9e-28
 Identities = 71/224 (31%), Positives = 112/224 (50%), Gaps = 1/224 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D        G +   GQ C + + ++V   +AD       
Sbjct: 246 PALLELGGKAPLLVLDDADLDATVEAAAFGAYFNQGQICMSTERLVVDSCIADAFVDKLA 305

Query: 682 XXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P+    +   +VS ++   I+ L+ DA  KGA      + EG+++ P LL
Sbjct: 306 VKIAGLRAGDPQASTSVLGSLVSAAAGERIKALIDDAVAKGARLVSGGQLEGSILQPTLL 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D+V   MR+  EE FGPV  V+R    E  +   N S FGL   +F++D ++A+ ++  +
Sbjct: 366 DNVDASMRLYREESFGPVAVVLRAEGDEALLQLANDSEFGLSSAIFSRDTSRALALAQRV 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           E+G   IN          PF G+K SG GS G   +I+  T+++
Sbjct: 426 ESGICHINGPTVHDEAQMPFGGVKSSGYGSFGSRTAIDQFTQLR 469



>pir|B83901|B83901 aldehyde dehydrogenase BH2010 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_655956
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 485

 Score =  125 bits (315), Expect = 9e-28
 Identities = 73/221 (33%), Positives = 111/221 (50%), Gaps = 1/221 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG +  IVL+DADI+ AA     G F + GQ C A+  ++V  S+ D          
Sbjct: 250 LELGGNNVMIVLDDADIEKAAEKAAVGKFLHQGQICMALNRIIVDASIYDSFVEVFKEKV 309

Query: 673 XXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G P +    I P+++      I+ LV ++  +GA        +GNL+ P +L  V
Sbjct: 310 SQLQTGNPAEPATLIGPLINYKQIGRIQQLVKESVAQGAVKVLEGHVQGNLMSPTILSEV 369

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
             DM +A EE FGP+ P+I+     E I   N S +GL G +FT  +++ + ++  ++TG
Sbjct: 370 TNDMPVAKEEIFGPIAPIIKAKDEAEAIAIANDSPYGLSGSIFTGSLHRGVQVAKQIDTG 429

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
            + +N  P     H  F G KDSGIG  G    ++  T VK
Sbjct: 430 MIHVNDQPVNEEAHISFGGEKDSGIGRFGGEWVLDKFTTVK 470



>gb:AY208917_597503 Pseudomonas sp. ND6 plasmid pND6-1, complete
           sequence.
          Length = 483

 Score =  125 bits (314), Expect = 1e-27
 Identities = 76/226 (33%), Positives = 111/226 (49%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DADI+ A    V G F Y GQ C + +  +V E+VAD          
Sbjct: 249 LELGGKAPFIVLDDADIEGAVNAAVFGAFLYQGQICMSTERFVVDEAVADAFVARFAERV 308

Query: 673 XXXXVGAPEDD--CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G P     C I P++ + S   I  L+ DA  KGA        E  L+ P L+D 
Sbjct: 309 NALETGLPAKSPGCVIGPMIGQGSVQRINHLLDDAVNKGAKIVTGGLAETALMGPTLVDC 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V  +M I  EE FGPV  ++R+   E+ +   N + +GL   +F++D+ KA+ ++  ++ 
Sbjct: 369 VTREMAIYDEETFGPVTTIVRVKGAEQALAVANDTAYGLSSSIFSRDVTKALGLASRLDA 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G V IN A  +     P+ G+K SG G       I   T+VK   +
Sbjct: 429 GCVHINGATVQNEPQAPYGGMKKSGYGRFDGNAVIEEFTEVKWVTV 474



>gb:AY048763_586752 Pseudomonas fluorescens salicylaldehyde
           dehydrogenase (nahF) gene, complete cds.
          Length = 483

 Score =  125 bits (313), Expect = 1e-27
 Identities = 80/226 (35%), Positives = 114/226 (50%), Gaps = 2/226 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL+DA+ID A    V G F + GQ C   + ++V E +AD          
Sbjct: 249 LELGGKSPLIVLDDANIDAAVKAAVFGSFLFQGQICMYTERLVVDEKIADEFVSKFVEKT 308

Query: 673 XXXXVG--APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
                G      DC I P+VS +S   I GL  DA +KG+        +G ++   +LDH
Sbjct: 309 KRLSAGDLCVTGDCIIGPMVSLNSGYRINGLFKDAIDKGSKVVCGGMVQGAVMPSTILDH 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V+ DMRI  EE FGP+  VIR     E I   N S +GL   VF +DIN+A+ +  ++E 
Sbjct: 369 VKSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSVYGLSSGVFGRDINRALRVGMSIEY 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           G V IN +  +     P+ G K++G G       ++  T++K   I
Sbjct: 429 GCVHINGSTVQNEVQAPYGGTKNTGYGRFDGRAVVDEFTELKWLTI 474



>gb:CP000031_84156 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 484

 Score =  125 bits (313), Expect = 1e-27
 Identities = 79/230 (34%), Positives = 115/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGGK   +V +DADI+ A +  + G F  SGQ C+    V V + + +          
Sbjct: 249 MELGGKSPLVVFDDADIENAVSGAILGNFYSSGQVCSNGTRVFVQKGIKEAFLSRLAERL 308

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQP---YKREGNLIWPLLL 506
               +G P D   +  P+VSE+  N + G V   K +GA          R+G  + P + 
Sbjct: 309 ATAVIGDPMDPATNFGPMVSEAQMNIVLGYVDKGKAEGARLVYGGTRLDRDGFYLLPTVF 368

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  DM IA EE FGPV+ V+  ++ EE +   NA+ FGL   VFT+DI +A  +    
Sbjct: 369 ADVTDDMTIAREEIFGPVMSVLDFDTEEEVLERANATEFGLAAGVFTRDITRAHRMVAGF 428

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E GT  INS     P   PF G K SG+G +    +IN  +++KT  +++
Sbjct: 429 EAGTCYINSYNL-APVEAPFGGSKQSGVGRENSKLAINHFSEMKTVFVSM 477



>sp|Q63639|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:RNU60063_2137521 Rattus
           norvegicus aldehyde dehydrogenase mRNA, complete cds.
          Length = 499

 Score =  125 bits (313), Expect = 1e-27
 Identities = 84/231 (36%), Positives = 117/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 266 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERA 325

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 326 KRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 385

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+++S AM
Sbjct: 386 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAM 445

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 446 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 495



>gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA
           (cDNA clone MGC:98380 IMAGE:7197199), complete cds.
          Length = 511

 Score =  124 bits (312), Expect = 2e-27
 Identities = 83/231 (35%), Positives = 117/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 278 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERA 337

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N +  L+     +GA   C  +   R+G  I P + 
Sbjct: 338 KRRIVGSPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 397

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+++S AM
Sbjct: 398 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAM 457

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 458 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 507



>gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A2, mRNA (cDNA clone MGC:76772
           IMAGE:30471325), complete cds.
          Length = 518

 Score =  124 bits (312), Expect = 2e-27
 Identities = 83/231 (35%), Positives = 117/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 285 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERA 344

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N +  L+     +GA   C  +   R+G  I P + 
Sbjct: 345 KRRIVGSPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 404

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+++S AM
Sbjct: 405 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAM 464

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 465 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 514



>sp|Q62148|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>pir|S74224|S74224 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 2 -
           mouse>gb:AK078553_1172383 Mus musculus 12 days embryo
           female mullerian duct includes surrounding region cDNA,
           RIKEN full-length enriched library, clone:6820449I02
           product:aldehyde dehydrogenase family 1, subfamily A2,
           full insert sequence.>gb:MMRALDH2_2117154 M.musculus
           mRNA for retinaldehyde-specific dehydrogenase.
          Length = 499

 Score =  124 bits (312), Expect = 2e-27
 Identities = 83/231 (35%), Positives = 117/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 266 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERA 325

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N +  L+     +GA   C  +   R+G  I P + 
Sbjct: 326 KRRIVGSPFDPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 385

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+++S AM
Sbjct: 386 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAM 445

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 446 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 495



>pir|T31289|T31289 succinate-semialdehyde dehydrogenase [NAD(P)] (EC
           1.2.1.16) - Sphingomonas aromaticivorans plasmid
           pNL1>gb:AF079317_477344 Sphingomonas aromaticivorans
           plasmid pNL1, complete plasmid sequence.
          Length = 490

 Score =  124 bits (311), Expect = 2e-27
 Identities = 79/232 (34%), Positives = 117/232 (50%), Gaps = 4/232 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + MELGG    +V +DAD+D A    +   F  +GQ C     +LV   + D        
Sbjct: 254 VSMELGGNAPLLVFDDADLDQAVEGAIASKFRNTGQTCVCANRILVQSGIHDRFVEALAA 313

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKRE--GNLIW-PL 512
                 VG   E   D  P+++ S+   ++G V DA  +GA      KR   G L + P 
Sbjct: 314 RVSAFRVGNGLEGATDQGPLITASALAKVQGHVADAVAQGAQLVTGGKRHEAGELFFQPT 373

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +L   RP MR+A EE FGPV PV R  +  E +   NA++ GL    FT+DI++A  +S+
Sbjct: 374 VLTGARPAMRLADEETFGPVAPVFRFETEAEALALANATHSGLAAYAFTRDIDRAWRVSE 433

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            +ETG V +NS      +  PF GIK+SG+G +G  + I    ++KT  + +
Sbjct: 434 GLETGMVGLNSGIV-STETAPFGGIKESGLGREGSRHGIEEFLEMKTISVGV 484



>gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family,
           member A2, transcript variant 2, mRNA (cDNA clone
           MGC:26444 IMAGE:4826743), complete cds.
          Length = 480

 Score =  124 bits (310), Expect = 3e-27
 Identities = 84/231 (36%), Positives = 116/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 247 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERA 306

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 307 KRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 366

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 367 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 426

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 427 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 476



>gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete
           cds.>gb:AB015228_1864684 Homo sapiens mRNA for RALDH2-T,
           complete cds.
          Length = 422

 Score =  124 bits (310), Expect = 3e-27
 Identities = 84/231 (36%), Positives = 116/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 189 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERA 248

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 249 KRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 308

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 309 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 368

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 369 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 418



>gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.
          Length = 518

 Score =  124 bits (310), Expect = 3e-27
 Identities = 84/231 (36%), Positives = 116/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 285 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERA 344

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 345 KRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 404

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 405 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 464

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 465 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 514



>gb:AJ621277_527467 Thermoproteus tenax aldh gene for aldehyde
           dehydrogenase.
          Length = 477

 Score =  124 bits (310), Expect = 3e-27
 Identities = 78/245 (31%), Positives = 122/245 (49%), Gaps = 9/245 (3%)
 Frame = -2

Query: 883 KKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVAD 704
           K +G      +  GG D  IV  DAD++ AA+ + +  F  +GQ C A K V V   V D
Sbjct: 232 KAAGRGKKFMIAPGGSDPAIVFADADLEAAASIIARARFENAGQNCNATKRVFVERKVYD 291

Query: 703 XXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFC---QPYKR 536
                         VG P D+  ++ PV+S+     +EG+V DA EKG       +  +R
Sbjct: 292 KFLDILRRKIAAIKVGDPMDESTEMGPVISDKMVKAMEGIVADAVEKGGKLLYGGRRMQR 351

Query: 535 EGNLIWPLLL--DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTK 362
           +G    P L+  D   P+ +   EE FGPVLPV       E +   N + +GLQ  VFT 
Sbjct: 352 KGYFFEPTLVAFDGRPPEAKAFREEVFGPVLPVAPFEDEREAVELANWTQYGLQSAVFTS 411

Query: 361 DINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGS---QGITNSINMMTKVKT 191
           D  +A  ++ A++ G V IN +     D  P+ G+K SG+ +   +G+ +++ + T++K 
Sbjct: 412 DYKRAFRVARAIKAGAVMINDSTRVRFDALPYGGVKMSGLSAGWREGVRSTMLLFTEIKY 471

Query: 190 TVINL 176
            V+N+
Sbjct: 472 YVLNI 476



>pir|C84401|C84401 aldehyde dehydrogenase (retinol) [imported] -
           Halobacterium sp. NRC-1>gb:AE005128_63735 Halobacterium
           sp. NRC-1 section 159 of 170 of the complete
           genome.>gb:AE004437_888654 Halobacterium sp. NRC-1
           complete genome.
          Length = 489

 Score =  124 bits (310), Expect = 3e-27
 Identities = 77/232 (33%), Positives = 109/232 (46%), Gaps = 1/232 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG +  IV EDAD+D A  + V G F +SGQ C ++   +V E V D          
Sbjct: 256 MELGGNNVHIVTEDADLDDAVDSGVFGSFLHSGQICISINRHVVHEDVYDEYVERLTERA 315

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G   D D  + P++ ES  + I   +    + GAT       +G ++ P +L   
Sbjct: 316 AALPTGTAHDADTVVGPIIDESQRDQILDYIERTVDAGATLETGGDHDGLVVEPTVLSDA 375

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
             DM  A  E FGPV PVI  +  +E +   N++ +GL G V   D  +A  I+D ++TG
Sbjct: 376 TNDMAAACNEHFGPVAPVIPFSDDDEAVEIANSTEYGLSGSVHAGDTGRARDIADRIDTG 435

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
            + IN  P     H PF G K+SG+G       +N  T+ K   I   T  Y
Sbjct: 436 MIHINDQPVNQEPHLPFGGYKNSGLGRYNGEYVLNEFTQEKWVSIQRETRDY 487



>sp|O94788|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).
          Length = 499

 Score =  124 bits (310), Expect = 3e-27
 Identities = 84/231 (36%), Positives = 116/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 266 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERA 325

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 326 KRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVF 385

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 386 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 445

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  + +P
Sbjct: 446 QAGTVWINCYNALNAQS-PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIP 495



>gb:HSM806186_2018223 Homo sapiens mRNA; cDNA DKFZp686G1675 (from
           clone DKFZp686G1675); complete cds.
          Length = 416

 Score =  123 bits (309), Expect = 4e-27
 Identities = 85/230 (36%), Positives = 120/230 (52%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 183 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYA 242

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     + +G  I P + 
Sbjct: 243 KKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVF 302

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  S+EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 303 SEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASAL 362

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 363 ESGTVWINCYNALYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 411



>gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family,
           member A3, mRNA (cDNA clone MGC:78582 IMAGE:6208628),
           complete cds.
          Length = 512

 Score =  123 bits (309), Expect = 4e-27
 Identities = 85/230 (36%), Positives = 120/230 (52%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     + +G  I P + 
Sbjct: 339 KKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  S+EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWINCYNALYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>gb:AY486161_621381 Rhodococcus sp. TK6 succinic semialdehyde
           dehydrogenase (ssd), putative regulator (chnR),
           6-hydroxyhexanoate dehydrogenase (chnD), caprolactone
           hydrolase (chnC), cyclohexanone monooxygenase (chnB),
           and 6-oxohexanoate dehydrogenase (chnE) genes, complete
           cds; and protocatechuate dioxygenase (pcd) gene, partial
           cds.
          Length = 460

 Score =  123 bits (309), Expect = 4e-27
 Identities = 83/211 (39%), Positives = 108/211 (51%), Gaps = 4/211 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IVL DAD+D AA+  V G     GQ CTA K  LV E V D          
Sbjct: 229 LELGGSDPFIVLGDADVDAAASAAVVGRLGNGGQACTASKRFLVEEPVYDEFVRKFLDGM 288

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR---EGNLIWPLLL 506
                  P   +  + P+ S S+ + ++ LV DA   GA       R   +G    P +L
Sbjct: 289 TGWQPSDPASPETKLGPLSSRSAVDELDELVQDAVSHGAEVLTGGDRPDEKGAYYPPTVL 348

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V P+MR   EE FGPV+ V R+ S++E I   N S FGL   VFT D +KA  +++ +
Sbjct: 349 VGVTPEMRAYHEELFGPVVVVHRVGSLDEAIEAANDSPFGLSSSVFTSDPDKADRVAEEL 408

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
           ETG V INS     PD  PF G+K SG+G +
Sbjct: 409 ETGMVWINSTSKSSPD-LPFGGVKRSGVGRE 438



>gb:AE013224_290378 Methanosarcina mazei strain Goe1, section 6 of
           379 of the complete genome.>gb:AE008384_964487
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 492

 Score =  123 bits (309), Expect = 4e-27
 Identities = 78/236 (33%), Positives = 118/236 (50%), Gaps = 9/236 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+  IV++DA+++LA   VV G F  +GQRCTA   +++ E + D        
Sbjct: 246 VSLELGGKNPVIVMDDANLELALEGVVWGAFGTTGQRCTATSRLILHEKIKDEFIKRLLA 305

Query: 679 XXXXXXVG---APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-----EGNL 524
                 VG    PE D  + PV++++    IE  V   KE+GA       R      G  
Sbjct: 306 KTKSLRVGNGLLPETD--VGPVINKAQLEKIEKYVRIGKEEGAAILVGGNRIDPGLPGYF 363

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P +   V P+MRIA EE FGPVL +I ++  +E I   N   +GL   ++T+++  A 
Sbjct: 364 FEPTIFTDVSPEMRIAQEEIFGPVLSIITVSDFDEAIEVANNIKYGLSSAIYTENVRTAF 423

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVKTTVIN 179
              + +E G   +N+       H PF GIK +G G  +  T +I   T+VK   I+
Sbjct: 424 RAIEKLEAGITYVNAPTIGAEVHLPFGGIKGTGNGFREAGTEAIKEFTEVKAVYID 479



>gb:SCO939121_178452 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 537

 Score =  123 bits (309), Expect = 4e-27
 Identities = 82/235 (34%), Positives = 118/235 (50%), Gaps = 12/235 (5%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+A +VLEDADI+ AAA  V+  FS +GQ C +++ + V  SVAD        
Sbjct: 271 VSLELGGKNAMLVLEDADIEKAAAGAVRACFSSAGQLCISIERLYVHASVADAFLERFAA 330

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQ---------PYKREG 530
                 +G       D+  +V E     +   V DA E+GA             PY  E 
Sbjct: 331 RTRAMRLGTSLSYGADMGSLVGERQLATVTAHVADAVERGAKLVAGGVARPDIGPYFYE- 389

Query: 529 NLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINK 350
               P +LD V   M +  EE FGPV+ V R  + +E + H N++ +GL   V+TKD  +
Sbjct: 390 ----PTILDGVVAPMTVCAEETFGPVVSVYRFTTEDEAVEHANSTPYGLNSSVWTKDARR 445

Query: 349 AILISDAMETGTVQINS--APARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
              ++  + TGTV IN   APA G    P  G+KDSG+G +  +  I   T+ +T
Sbjct: 446 GRDVAARLRTGTVNINEGYAPAYGSVQSPMGGMKDSGLGRRHGSEGILKYTEAQT 500



>gb:ACCPCAOP_18625 Acinetobacter sp. ADP1 dca-pca-qui-pob-hca
           supraoperonic gene cluster, complete
           sequence.>gb:CR543861_103663 Acinetobacter sp. ADP1
           complete genome.
          Length = 483

 Score =  123 bits (309), Expect = 4e-27
 Identities = 75/235 (31%), Positives = 115/235 (48%), Gaps = 1/235 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGK   ++L DAD+D A   V  G F   GQ C + + VLV + +AD       
Sbjct: 247 PVLLELGGKAPVVILNDADLDEAVNAVAFGAFFNQGQICMSTERVLVQDGIADRFIEKLI 306

Query: 682 XXXXXXXVGAPEDDCDITPVV-SESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P     +  V+ S  +A  I+ L+ DA++KGA      + +  L+ P L+
Sbjct: 307 QKTASLKAGNPTQQGSMLGVLESRRAAERIQHLLEDAQQKGANLPLGIQIQDTLMQPTLV 366

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             ++P+M +  EE FGPV  V R  S+E+G+   N S FGL   VF+++   A+ ++  +
Sbjct: 367 LDIQPEMLLYREESFGPVCTVQRFASIEDGVRLANDSEFGLSSAVFSQNFGLAMDVAKQI 426

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           ++G   IN A        PF G K SG G  G   SI   T+++   +      Y
Sbjct: 427 DSGICHINGATVHDEAQMPFGGTKSSGYGRFGSKASIAEFTELRWITVQTQPRHY 481



>sp|P47895|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC
           1.2.1.5).>pir|A55684|A55684 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) 6 precursor, salivary -
           human>gb:HSU07919_2021848 Human aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  123 bits (309), Expect = 4e-27
 Identities = 85/230 (36%), Positives = 120/230 (52%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     + +G  I P + 
Sbjct: 339 KKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  S+EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWINCYNALYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class I,
           mRNA (cDNA clone MGC:79911 IMAGE:3399386), complete cds.
          Length = 502

 Score =  123 bits (308), Expect = 6e-27
 Identities = 80/230 (34%), Positives = 119/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+DLA  +   G F + GQ C A   + V E + D          
Sbjct: 269 LELGGKSPNIIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERA 328

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               +G P   C +  P + +   + I  L+   K++GA   C    +  +G  I P + 
Sbjct: 329 KKRVLGDPFAPCVNQGPQIDKEQYDKILELIESGKKEGAKLQCGGSAWGEKGFYISPTVF 388

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV  +++  +++E I   N + +GL   VFTKD++KAIL+S A+
Sbjct: 389 SDVKDDMRIAKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTAL 448

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV IN   A  P   PF G K SG G +     ++  T+VKT ++ +
Sbjct: 449 QAGTVWINCYSAMSPQS-PFGGFKMSGNGREMGEYGLHEYTEVKTVIMKI 497



>gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogenase
           class 1, complete cds.
          Length = 502

 Score =  123 bits (308), Expect = 6e-27
 Identities = 80/230 (34%), Positives = 119/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+DLA  +   G F + GQ C A   + V E + D          
Sbjct: 269 LELGGKSPNIIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERA 328

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               +G P   C +  P + +   + I  L+   K++GA   C    +  +G  I P + 
Sbjct: 329 KKRVLGDPFAPCVNQGPQIDKEQYDKILELIESGKKEGAKLQCGGSAWGEKGFYISPTVF 388

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV  +++  +++E I   N + +GL   VFTKD++KAIL+S A+
Sbjct: 389 SDVKDDMRIAKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTAL 448

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV IN   A  P   PF G K SG G +     ++  T+VKT ++ +
Sbjct: 449 QAGTVWINCYSAMSPQS-PFGGFKMSGNGREMGEYGLHEYTEVKTVIMKI 497



>pir|A87547|A87547 vanillin dehydrogenase [imported] - Caulobacter
           crescentus>gb:AE005909_213536 Caulobacter crescentus
           CB15 section 235 of 359 of the complete
           genome.>gb:AE005673_923435 Caulobacter crescentus CB15
           complete genome.
          Length = 470

 Score =  123 bits (308), Expect = 6e-27
 Identities = 73/224 (32%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGK   IVLEDAD+D A      G F   GQ C + + ++V++++AD       
Sbjct: 234 PVLLELGGKAPLIVLEDADLDEAVKAAAFGAFMNQGQICMSTERIIVVDAIADAFVAKFA 293

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                  VG P E    +  VV   +   ++GLV DA   GA         G L+   ++
Sbjct: 294 AKASSLAVGDPREGKTPLGAVVDLKTVTHVQGLVADALADGAVQVSGGPANGVLMPATVV 353

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V P MR+  EE FGPV+ VIR    E  I   N + +GL   VFT+DI + + ++  +
Sbjct: 354 DKVTPAMRLFREESFGPVVAVIRARDEEHAIALANDTEYGLSASVFTRDIARGLKVARRI 413

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           ++G   +N          PF G+K SG G  G    ++  T+++
Sbjct: 414 QSGICHVNGPTVHDEAQMPFGGVKASGYGRFGGKAGVDAFTELR 457



>gb:CP000009_862522 Gluconobacter oxydans 621H, complete genome.
          Length = 456

 Score =  122 bits (307), Expect = 7e-27
 Identities = 89/238 (37%), Positives = 124/238 (52%), Gaps = 9/238 (3%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQ-MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           G A+  ++GA      MELGG DA IVL+DAD+DLA    V G F+ +GQ CTA K ++V
Sbjct: 213 GQAVAAQAGAALKKDTMELGGSDAFIVLDDADLDLAVKWAVWGRFANNGQVCTAAKRMIV 272

Query: 721 MESVADXXXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E V D              +G P D D    P+ S  +         +A + GAT    
Sbjct: 273 HEKVYDAFLDGLKTAITRFRIGNPLDRDTTHGPMSSLRAMELALDQTAEAVKGGATLVAG 332

Query: 544 YKR---EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGC 374
            KR   +G  + P +L  V  D  + ++E FGPV  V ++ S +  I   N S +GL G 
Sbjct: 333 GKRMDRKGFFMEPTILTDVSKDNPVFYQEIFGPVAVVHKVASEQAAIDLANDSPYGLGGA 392

Query: 373 VFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ----GITNSIN 212
           VF++DI +A  +++ +ETG V IN+A A  P+  PF GIK+SG G +    GI   IN
Sbjct: 393 VFSRDIARAEKVAEQVETGMVFINTATAAAPE-LPFGGIKNSGFGRELSFLGIEEFIN 449



>gb:BA000040_734677 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 483

 Score =  122 bits (307), Expect = 7e-27
 Identities = 74/235 (31%), Positives = 112/235 (47%), Gaps = 1/235 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DADID A      G F+ SGQ C + + ++V E++AD       
Sbjct: 247 PAVLELGGKAPLVVLDDADIDSAVNAAAFGAFANSGQICMSTERIIVDEAIADEFVRRLA 306

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                  +G P +    +  VV  ++      L+ DA  KGA      K E  L+   L+
Sbjct: 307 DKASKLPLGDPRKGPVVLGSVVDMTTVKRCNDLIEDALAKGAKLLCGGKAETTLMPATLI 366

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           DHV   MRI  EE FGP+ P++R+   +  I   N + +GL   VFT+D ++ + ++  +
Sbjct: 367 DHVSSAMRIYSEESFGPIKPIVRVKGEDAAIACANDNAYGLSSAVFTRDTSRGMRVASRI 426

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           ++G   IN          PF G+KDSG G  G  + +   T  +   I      Y
Sbjct: 427 QSGICHINGPTVHDEAQMPFGGVKDSGYGRFGGKSGVAEFTDTRWMTIQTSERHY 481



>gb:PFPHCOAHL_158013 Pseudomonas fluorescens genes encoding
           p-hydroxycinnamoyl CoA hydratase/lyase and vanillin:
           NAD+ oxidoreductase.
          Length = 482

 Score =  122 bits (307), Expect = 7e-27
 Identities = 74/224 (33%), Positives = 110/224 (49%), Gaps = 1/224 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD++ A      G +   GQ C + + ++V   VAD       
Sbjct: 246 PALLELGGKAPLLVLDDADLEAAVQAAAFGAYFNQGQICMSTERLIVDAKVADAFVAQLA 305

Query: 682 XXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P D +  +  +V  S+   I+ L+ DA  KGA      + EG+++ P LL
Sbjct: 306 AKVETLRAGDPADPESVLGSLVDASAGTRIKALIDDAVAKGARLVIGGQLEGSILQPTLL 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V   MR+  EE FGPV  V+R    E  +   N S FGL   +F++D  +A+ ++  +
Sbjct: 366 DGVDASMRLYREESFGPVAVVLRGEGEEALLQLANDSEFGLSAAIFSRDTGRALALAQRV 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           E+G   IN          PF G+K SG GS G   SI   T+++
Sbjct: 426 ESGICHINGPTVHDEAQMPFGGVKSSGYGSFGGKASIEHFTQLR 469



>pir|G75592|G75592 succinate-semialdehyde dehydrogenase -
           Deinococcus radiodurans (strain R1)>gb:AE001862_39937
           Deinococcus radiodurans R1 section 1 of 2 of the
           complete chromosome 2.>gb:AE001825_885259 Deinococcus
           radiodurans R1 complete chromosome 2.
          Length = 487

 Score =  122 bits (307), Expect = 7e-27
 Identities = 75/219 (34%), Positives = 111/219 (50%), Gaps = 3/219 (1%)
 Frame = -2

Query: 877 SGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXX 698
           +G    + +ELGG    +V +DAD++ AA+ VV   F  SGQ C     V V   VA+  
Sbjct: 250 AGTIKRVSLELGGHAPFLVFDDADLERAASEVVASKFRNSGQTCVCTNRVYVQRGVAEEF 309

Query: 697 XXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLI 521
                       +G P D+   + PVV ++  + ++  V DA  KGA      +    L 
Sbjct: 310 IRLLTEKTAALQLGDPFDEATQVGPVVEQAGLDKVQRQVQDALTKGAQATTGGQVSSGLF 369

Query: 520 W-PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
           + P +L  V PD  I  EE FGPV PV   ++ EEG+   N S +GL    +T+D+ +A 
Sbjct: 370 FQPTVLVDVAPDSLILREETFGPVAPVTIFDTEEEGLRLANDSEYGLAAYAYTRDLGRAF 429

Query: 343 LISDAMETGTVQINSA-PARGPDHFPFQGIKDSGIGSQG 230
            I++ +E G V IN   P+    H PF G+K+SG+G +G
Sbjct: 430 RIAEGLEYGIVGINDGLPSSAAPHVPFGGMKNSGVGREG 468



>gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.
          Length = 518

 Score =  122 bits (306), Expect = 9e-27
 Identities = 85/231 (36%), Positives = 114/231 (49%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA     V +S+ +          
Sbjct: 285 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERA 344

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P  ++   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 345 KRRIVGSPFDPTTEQGPQTNKKQYNKILELIQSGITEGAKLECGGKALGRKGFFIEPTVF 404

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +VEE I   N S++GL   VFT DINKA+ +S AM
Sbjct: 405 SNVADDMRIAREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAM 464

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   T+ KT  I +P
Sbjct: 465 QAGTVWINCYNALNAQS-PFGGYKMSGNGREMGEYGLREYTEAKTVTIKIP 514



>gb:BA000043_736776 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 513

 Score =  122 bits (305), Expect = 1e-26
 Identities = 80/228 (35%), Positives = 120/228 (52%), Gaps = 8/228 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+LEDAD+DLA    + G F +SGQ C +   + V + + D          
Sbjct: 258 LELGGKSPNILLEDADLDLAVPGSLFGVFLHSGQLCESGTRLFVPDRLHDEVVERLVALT 317

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE------GNLIW 518
               +G P D   D+ PV+S+     +   +   K++GAT  C  ++ E      G+ + 
Sbjct: 318 KTLQIGHPLDPATDVGPVISKRQKETVLSYIEAGKQEGATIVCGGHEVEVPGCEGGHFVA 377

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +  +V  DM+IA EE FGPVL +IR + VEE +   N + +GL   V+T+D+NKA  I
Sbjct: 378 PTIFSNVTNDMKIAQEEIFGPVLSIIRYHDVEEAVTMANDTIYGLAAGVWTRDVNKAYAI 437

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +  ++ G V IN       D  PF G K SGIG +    S++  T++K
Sbjct: 438 AGRLQAGVVWINDWHMLRND-APFGGYKQSGIGREMGKYSLDAYTQLK 484



>gb:BA000023_693170 Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 506

 Score =  122 bits (305), Expect = 1e-26
 Identities = 79/230 (34%), Positives = 113/230 (49%), Gaps = 5/230 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG D  IVL+D+D    A  +V G  SYSGQRC ++K +     V +          
Sbjct: 267 MELGGGDPAIVLDDSDPKTTAQKIVTGITSYSGQRCDSIKFIFAEPKVYEELKNYIVEEL 326

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG-NLIWPLLLDH 500
               VG P E D  + P++   + +  E  V DA EKG       KR G   I P L++ 
Sbjct: 327 KKVKVGDPREADTVMGPIIDTRTVDEFEYAVKDAVEKGGNILYGGKRLGPTYIEPTLIEI 386

Query: 499 VRP---DMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
            +    D+ +  +E F  +  + ++N+++E I   N   +GL   +F  DI K   +   
Sbjct: 387 DKEKIKDLYLYKKEVFLSIAVITKVNNIDEAIELSNGRRYGLDAAIFGNDITKIRKLIRM 446

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           +E G V +N  P  G  +FPF G KDSGIG +GI  +I  +T  KT V N
Sbjct: 447 LEVGAVYVNEYPKHGIGYFPFGGRKDSGIGREGIGYTIENVTAYKTIVYN 496



>gb:AF061751_474796 Burkholderia sp. strain RP007 PAH-catabolic gene
           cluster, complete sequence.
          Length = 483

 Score =  122 bits (305), Expect = 1e-26
 Identities = 73/231 (31%), Positives = 114/231 (49%), Gaps = 2/231 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   +VL+DADID A    V G F Y GQ C + + ++V E +AD          
Sbjct: 249 LELGGKAPLVVLDDADIDEAVKAAVFGAFLYQGQICMSTERIVVDEKIADTFVARFAARA 308

Query: 673 XXXXVGAPED--DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDH 500
               VG P     C + P++   S + I  ++ DA  +GA        +G ++   ++D 
Sbjct: 309 RELPVGDPATCGGCVVGPMIVRESGDRINAMINDAVNQGANVVAGGFADGAVMPATIVDR 368

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V P MRI  EE FGP+  V+R    ++ +   N + +GL   VF +D+ +A+ ++  +E 
Sbjct: 369 VTPAMRIYDEETFGPITTVVRAKDADDAVRIANDTAYGLSSAVFGRDVTRALSVAMRIEA 428

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTP 167
           G+  IN +  +     P+ G K SG G       I+  T++K   I  PTP
Sbjct: 429 GSCHINGSTVQNEAQAPYGGTKASGYGRFDGRAVIDEFTELKWITIE-PTP 478



>gb:AE016866_352348 Pseudomonas syringae pv. tomato str. DC3000
           section 11 of 21 of the complete
           genome.>gb:AE016853_1037523 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 482

 Score =  122 bits (305), Expect = 1e-26
 Identities = 74/224 (33%), Positives = 111/224 (49%), Gaps = 1/224 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D A      G +   GQ C + + ++V + VAD       
Sbjct: 246 PALLELGGKAPFLVLDDADLDAAVEAAAFGAYFNQGQICMSTERLIVDQKVADVFVAKLT 305

Query: 682 XXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P+D   +   +V  S+ + I+ L+ DA   GAT     + +G+++ P LL
Sbjct: 306 AKIETLRAGHPDDSQSVLGSLVDVSAGSRIKALIDDAVNLGATLVIGGQLQGSILQPALL 365

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V   MR+  EE FGPV  VIR    E  +   N S  GL   +F++D  +A+ ++  +
Sbjct: 366 DGVTDRMRLYREESFGPVAVVIRGEGDEALLALANDSELGLSAAIFSRDTGRALALAQRV 425

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           E+G   IN          PF G+K SG GS G   SI   T+++
Sbjct: 426 ESGICHINGPTVHDEAQMPFGGVKSSGYGSFGGKASIEHFTQLR 469



>gb:SCO939124_179349 Streptomyces coelicolor A3(2) complete genome;
           segment 21/29.
          Length = 481

 Score =  122 bits (305), Expect = 1e-26
 Identities = 77/229 (33%), Positives = 110/229 (48%), Gaps = 5/229 (2%)
 Frame = -2

Query: 853 MELGGKDACIVL----EDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXX 686
           +ELGG  A +VL     D D+D AA  +        GQ C +V+ V+   +V D      
Sbjct: 248 LELGGNGAAVVLADWASDEDLDRAATRIATFSNYQGGQSCISVQRVIADAAVYDRLLPRI 307

Query: 685 XXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLL 509
                    G P DD  D+ P+VSE++A  +E  V +A + GA      KR+G    P +
Sbjct: 308 VAAVEAQVTGDPNDDATDVGPLVSEAAAERVEAWVREAVDAGAKLLTGGKRDGASYAPTV 367

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           L  +  D  +A EE FGPVL V R+    E     N S +GLQ  VFT D+  A     A
Sbjct: 368 LTELPADTTLAHEEVFGPVLSVQRVTGEAEAFAAVNDSKYGLQAGVFTHDLQAAFRAHRA 427

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +E G V I   P+   D  P+ G K SG+G +G+  +++  T  +  V+
Sbjct: 428 LEVGGVVIGDIPSYRADQMPYGGAKQSGVGREGVKFAMDDYTYERVLVL 476



>gb:PSVDHORF2_161948 Pseudomonas sp. vdh gene and
           ORF2.>gb:A92116_1451202 Sequence 27 from Patent
           EP0845532.
          Length = 481

 Score =  122 bits (305), Expect = 1e-26
 Identities = 74/228 (32%), Positives = 116/228 (50%), Gaps = 1/228 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D A      G +   GQ C + +  L++ +VAD       
Sbjct: 246 PAVLELGGKAPFLVLDDADLDAAVEAAAFGAYFNQGQICMSTER-LIVTAVADAFVEKLA 304

Query: 682 XXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P D   +   ++  ++   I+ LV DA  KGA        +G+++ P+LL
Sbjct: 305 RKVATLRAGDPNDPQSVLGSLIDANAGQRIQVLVDDALAKGARQVVGGGLDGSIMQPMLL 364

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V  +MR+  EE FGPV  V+R +  EE +   N S FGL   +F++D+++A+ ++  +
Sbjct: 365 DQVTEEMRLYREESFGPVAVVLRGDGDEELLRLANDSEFGLSAAIFSRDVSRAMELAQRV 424

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           ++G   IN          PF G+K SG GS G   SI   T+++   I
Sbjct: 425 DSGICHINGPTVHDEAQMPFGGVKSSGYGSFGSRASIEHFTQLRWLTI 472



>sp|O32507|GABD_DEIRA Succinate-semialdehyde dehydrogenase [NADP+]
           (EC 1.2.1.16) (SSDH).>pir|C75589|C75589 probable
           succinic-semialdehyde dehydrogenase - Deinococcus
           radiodurans (strain R1)>gb:AB003475_633 Deinococcus
           radiodurans gene for aldehyde dehydrogenase, succinic
           semialdehyde dehydrogenase,partial and complete
           cds.>gb:AE001863_40266 Deinococcus radiodurans R1
           section 2 of 2 of the complete chromosome
           2.>gb:AE001825_885588 Deinococcus radiodurans R1
           complete chromosome 2.
          Length = 477

 Score =  122 bits (305), Expect = 1e-26
 Identities = 74/211 (35%), Positives = 108/211 (51%), Gaps = 4/211 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IVL+  D+D        G  S +GQ C A K ++V++ + D          
Sbjct: 239 LELGGSDPFIVLDAEDLDTTVKAAATGRLSNTGQACIAAKRLMVVDDLYDEFVSRLGQTF 298

Query: 673 XXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
                G P D    + P+ SE +A  ++  V DA +KGAT     Q  +  G  + P +L
Sbjct: 299 SAFVPGDPADPSTRLGPLSSEQAARDLQAQVQDAIDKGATVVAGGQRPEHPGAFVQPTVL 358

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V PDMR   EE FGPV  V R+   +E +   NAS +GL G VF+ D+++A  +++ +
Sbjct: 359 TDVTPDMRAYHEELFGPVAVVYRVRDEDEAVALANASTYGLGGAVFSSDLDRAQRVAERL 418

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
           +TG V IN   +   D  PF G+K SG G +
Sbjct: 419 DTGMVWINHPTSSAAD-LPFGGVKRSGFGRE 448



>gb:AE017180_399121 Geobacter sulfurreducens PCA, complete genome.
          Length = 541

 Score =  121 bits (304), Expect = 2e-26
 Identities = 74/220 (33%), Positives = 112/220 (50%), Gaps = 5/220 (2%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L + L  K+  IVL DAD++LA    + G  +++GQRCTA+K++ V ESVA         
Sbjct: 283 LVLGLEAKNPAIVLPDADLNLAVEECLAGSLAFNGQRCTALKLLFVHESVAQQFIALFSR 342

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQP--YKREGNLIWPLL 509
                  G P +    ITP+  E    ++E L+ DA  +GA           G    P L
Sbjct: 343 ALSAIGTGMPWQAGVMITPLPEEGKTAYLEELLADASARGAAVVNEGGGTVTGTYFHPAL 402

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           +  V P MR+  EE FGPV+P++    +EE I     S++G Q  +F ++      + D 
Sbjct: 403 VYPVAPGMRLYTEEQFGPVVPIVPFTDIEEPIRAIRESDYGQQVSIFGRNSALLAPLIDH 462

Query: 328 M--ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSI 215
           +  +   V INS   RGPD FPF G KDS +G+  +++++
Sbjct: 463 LVNQVSRVNINSQCQRGPDVFPFTGRKDSAVGTLSVSDAL 502



>gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1)
           mRNA, complete cds.
          Length = 502

 Score =  121 bits (303), Expect = 2e-26
 Identities = 79/230 (34%), Positives = 118/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+DLA  +   G F + GQ C A   + V E + D          
Sbjct: 269 LELGGKSPNIIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERA 328

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               +G P   C +  P + +   +    L+   K++GA   C    +  +G  I P + 
Sbjct: 329 KKRVLGDPFAPCVNQGPQIDKEQYDKCLELIESGKKEGAKLQCGGSAWGEKGFYISPTVF 388

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV  +++  +++E I   N + +GL   VFTKD++KAIL+S A+
Sbjct: 389 SDVKDDMRIAKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTAL 448

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV IN   A  P   PF G K SG G +     ++  T+VKT ++ +
Sbjct: 449 QAGTVWINCYSAMSPQS-PFGGFKMSGNGREMGEYGLHEYTEVKTVIMKI 497



>gb:BA000030_700465 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 481

 Score =  121 bits (303), Expect = 2e-26
 Identities = 76/229 (33%), Positives = 111/229 (48%), Gaps = 5/229 (2%)
 Frame = -2

Query: 853 MELGGKDACIVL----EDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXX 686
           +ELGG  A +VL     DAD+D AA  +        GQ C +V+ V+   SV +      
Sbjct: 248 LELGGNGAAVVLADYASDADLDWAAGRIATFSNYQGGQSCISVQRVIADASVYERLLPRV 307

Query: 685 XXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLL 509
                    G P DD  ++ P+VSE +A  +E  V +A + GA      KREG    P +
Sbjct: 308 VAAVEAQVTGDPSDDATEVGPLVSEDAAKRVESWVDEAAQAGARVLTGGKREGASYAPTV 367

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           L  V  D+ ++ EE FGPVL V ++          N S +GLQ  VFT D+  A     A
Sbjct: 368 LVDVPADVTLSCEEVFGPVLTVQKVEGEAAAFAAVNESKYGLQAGVFTHDLQAAFRAHRA 427

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +E G V I   P+   D  P+ G+K SG+G +G+  +++  T  +  V+
Sbjct: 428 LEVGGVVIGDVPSYRADQMPYGGVKQSGVGREGVKFAMDDYTYERVLVL 476



>gb:AE013477_292671 Methanosarcina mazei strain Goe1, section 259 of
           379 of the complete genome.>gb:AE008384_966780
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 454

 Score =  121 bits (303), Expect = 2e-26
 Identities = 77/232 (33%), Positives = 121/232 (52%), Gaps = 4/232 (1%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGG D  IVLEDADID AA   V+  F  +GQ C A K  +V+E V         
Sbjct: 224 PFVLELGGSDPFIVLEDADIDRAAEVGVRARFINTGQSCIAAKRFIVVEDVVVDFIEAFE 283

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGA---TFCQPYKREGNLIWP 515
                  VG P +++ DI PV  +   + +E ++ DAK+KGA    + + +K+ G    P
Sbjct: 284 LHMQELKVGDPMDEETDIGPVAKKEFIDSLERVLKDAKKKGAEPRVYGEEHKK-GFFFRP 342

Query: 514 LLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILIS 335
            ++     DM++   E FGP+ PV+ +   +E +   N+++FGL   +++ D+ +A  ++
Sbjct: 343 TIVPAASTDMKVLNMEVFGPIAPVVMVKDEDEAVKIANSTDFGLGAEIWSADLKRAEHLA 402

Query: 334 DAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
             +++G V IN      P   PF G+K SGIG +     +     +KT VIN
Sbjct: 403 KRIKSGFVTINGRVKSDP-RLPFGGVKKSGIGRELSHYGLKEFVNIKTVVIN 453



>sp|Q8MI17|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>gb:AY038801_1424256 Oryctolagus cuniculus aldehyde
           dehydrogenase 1A1 (ALDH1A1) mRNA, complete cds.
          Length = 496

 Score =  121 bits (303), Expect = 2e-26
 Identities = 76/230 (33%), Positives = 116/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 263 LELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERA 322

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P   + +  P + +   N I  L+   K++GA   C   P+  +G  I P + 
Sbjct: 323 KKYVLGNPLAPEVNQGPQIDKEQYNKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVF 382

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   +FTKD++KA+ +S A+
Sbjct: 383 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTTYGLSAGIFTKDLDKAVTVSSAL 442

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +     +   T+VKT  + +
Sbjct: 443 QAGTVWVNCYSVVSA-QVPFGGFKMSGNGRELGEYGLQQYTEVKTVTVKI 491



>gb:AY123972_590629 Arthrobacter sp. BP2 cyclohexanone oxidation
           gene cluster, partial sequence.
          Length = 478

 Score =  120 bits (302), Expect = 3e-26
 Identities = 82/211 (38%), Positives = 103/211 (48%), Gaps = 4/211 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG D  IVL+DADID AAA  V G  S  GQ CTA K  +V +SV +          
Sbjct: 248 LELGGSDPFIVLDDADIDAAAAAAVIGRLSNGGQACTASKRFIVADSVYEEFLQKFLDAM 307

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKRE---GNLIWPLLL 506
                G P D    + P+ S +    ++ LV DA   GA      +R    G      +L
Sbjct: 308 ASWQTGDPTDSGTKLGPLASAAGVEELDELVQDAVSHGAKLLLGGERPDGPGAYYPATVL 367

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V P MR   EE FGPV  V R+ S++E I   N S FGL   VFT D   A  +++ +
Sbjct: 368 AGVTPAMRAFTEELFGPVAVVYRVGSLQEAIDLANNSPFGLSSSVFTSDARNAERLAEEL 427

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
           E G V INS     PD  PF G+K SG G +
Sbjct: 428 EVGMVWINSTSKSSPD-LPFGGVKGSGFGRE 457



>pir|C95964|C95964 probable aldehyde dehydrogenase protein (EC
           1.2.1.-) [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymB>gb:RME591985_165627
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 485

 Score =  120 bits (302), Expect = 3e-26
 Identities = 86/235 (36%), Positives = 117/235 (49%), Gaps = 6/235 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLED-ADIDLAAAN--VVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           +ELGG D  I+L D +D DLA A    V G    SGQRCTAVK +L  ESVAD       
Sbjct: 253 LELGGNDPLIILNDLSDDDLARAADLAVAGATKNSGQRCTAVKRILCQESVADRFVPLVL 312

Query: 682 XXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                   G P D   D+  V+ E +A   E  V  A E+GA       R G L+ P+++
Sbjct: 313 ERAKRLRFGDPMDRSTDLGTVIHEKAAALFEERVMRAAEEGADILYHPGRSGALLPPIVV 372

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEG-IHHCNASNFGLQGCVFTKDINKAILISDA 329
           D V     +  EE FGP++P++R+   ++  I   N++ FGL   V T D  +       
Sbjct: 373 DRVPHQSDLVLEETFGPIIPIVRVPDDDDATITLSNSTAFGLSSGVCTNDYRRMQKYIAG 432

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIG-SQGITNSINMMTKVKTTVINLPTP 167
           ++ GTV I   P    +  PF GIKDSG G  +G+  ++   T VKT   +LP P
Sbjct: 433 LKVGTVNIWEVPGYRIEMSPFGGIKDSGNGYKEGVIEAMKSFTNVKT--FSLPWP 485



>gb:BX571965_790622 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_864779
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 483

 Score =  120 bits (301), Expect = 4e-26
 Identities = 73/235 (31%), Positives = 110/235 (46%), Gaps = 1/235 (0%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGGK   +VL+DAD+D A A    G F+ SGQ C + + ++V E +AD       
Sbjct: 247 PAVLELGGKAPFVVLDDADLDAAVAAAAFGAFANSGQICMSTERIIVDERIADAFVAKLA 306

Query: 682 XXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLL 506
                  +G P +   +   V+   +      L+ DA  KGA      K +  L+   L+
Sbjct: 307 DKAASLPLGDPRNGPVVLGSVIDAQTVERCNALIDDALAKGAVLRCGGKADSTLMPATLV 366

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
           D V P MR+  EE FGPV  ++R+   E  I   N + FGL   VF++D+ +A+ ++  +
Sbjct: 367 DRVTPAMRLYAEESFGPVKGIVRVAGEEAAIACANDNAFGLSSAVFSRDVARAMRVAARI 426

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPSY 161
           E G   +N          PF G+KDSG G  G    I   T ++   +      Y
Sbjct: 427 EAGICHVNGPTVHDEAQMPFGGMKDSGFGHFGGKAGIAEFTDLRWITVQTAPRHY 481



>gb:AY596298_634885 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 483

 Score =  120 bits (301), Expect = 4e-26
 Identities = 81/232 (34%), Positives = 110/232 (47%), Gaps = 6/232 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   +V  DAD+D AA  +  G F  +GQ C A   ++V E V +          
Sbjct: 252 LELGGKGPAVVFPDADLDAAARGIQYGIFMNAGQMCWANSRIVVHEDVYEEMVSRMAEIA 311

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY-----KREGNLIWPL 512
               +G   +DD  + PVVS      I   +   KE+GAT          K  G+ + P 
Sbjct: 312 ENIPLGGGIDDDGQMGPVVSAGQQQEILDYIETGKEEGATVAAGGGVPGDKETGHFVEPT 371

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +   V  +M IA EE FGPVL  I ++  E  I   N S FGL  CV+T D+ +A  ++D
Sbjct: 372 VFADVDNEMTIAQEEIFGPVLTAIEVSDEEAAIDVANDSPFGLTACVWTNDLTRAHTVTD 431

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            ++ G V +N  P   P   PF G K SG G      +I   T+VK   INL
Sbjct: 432 RLDYGMVMVNETPNTWP-QTPFGGTKQSGHGRAQGEQAIESYTEVKNVHINL 482



>sp|Q53197|Y4UC_RHISN Hypothetical aldehyde-dehydrogenase like
           protein Y4UC (EC 1.2.1.-).>gb:AE000099_19903 Rhizobium
           sp. NGR234 plasmid pNGR234a, section 36 of 46 of the
           complete plasmid sequence.>gb:RSPNGR234_168178 Rhizobium
           sp. plasmid NGR234a DNA.
          Length = 512

 Score =  120 bits (301), Expect = 4e-26
 Identities = 75/242 (30%), Positives = 116/242 (47%), Gaps = 1/242 (0%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG AI + +G    L MELGG    IV+ D D D A    V G F  +GQ C   + +L+
Sbjct: 270 TGEAISRAAGL-KKLAMELGGNAPVIVMNDCDFDKAVEGCVSGAFWAAGQNCIGAQRILI 328

Query: 721 MESVADXXXXXXXXXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
              +                 G P ++D D+ P++S+  A   E  V +A + GAT    
Sbjct: 329 QSELYGRFRDAFVAATKKLKAGDPLQEDTDVGPMISKQVAERTEAAVNEAIKAGATLLCG 388

Query: 544 YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFT 365
             REG+L  P +L+      R+  EE F PV+ +   +++++GI   N  ++ L   +FT
Sbjct: 389 NYREGSLYHPTVLEGTPLTCRLWHEEVFAPVVMLAPFDTLDKGIEMANDPDYSLHAGIFT 448

Query: 364 KDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTV 185
            D+N A+  ++ +E G V IN +     D  PF G K   +G +G+  +   MT+ K   
Sbjct: 449 NDLNVALEAANRIEVGGVMINDSSDYRFDAMPFGGFKYGSMGREGVRFAYEDMTQPKVVC 508

Query: 184 IN 179
           IN
Sbjct: 509 IN 510



>gb:BA000030_702903 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 543

 Score =  120 bits (300), Expect = 5e-26
 Identities = 80/235 (34%), Positives = 117/235 (49%), Gaps = 12/235 (5%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+A +VLEDADID AAA  V+  FS +GQ C +++ + V ESVAD        
Sbjct: 277 VSLELGGKNAMLVLEDADIDKAAAGAVRACFSSAGQLCISIERLYVHESVADAFAERFAA 336

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQ---------PYKREG 530
                 +G       D+  +V E     +   V +A  KGA             PY  E 
Sbjct: 337 RTRAMRLGTSLAYGADMGSLVGERQLETVTRHVDEAVAKGAKLLAGGVARPDIGPYFYE- 395

Query: 529 NLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINK 350
               P +LD V   M +  EE FGPV+ + R  + +E +   N++ +GL   V+TKD  +
Sbjct: 396 ----PTILDGVEAPMSVCTEETFGPVVSLYRFKTEDEAVELANSTPYGLNASVWTKDGRR 451

Query: 349 AILISDAMETGTVQINS--APARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
              ++  + TGTV +N   APA G    P  G+KDSG+G +  +  I   T+ +T
Sbjct: 452 GRAVAARLRTGTVNVNDGYAPAYGSVQSPMGGMKDSGLGRRHGSEGILKYTEAQT 506



>gb:AP006627_563436 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 489

 Score =  120 bits (300), Expect = 5e-26
 Identities = 78/250 (31%), Positives = 122/250 (48%), Gaps = 10/250 (4%)
 Frame = -2

Query: 901 TGIAIXKKSGA-WXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG  + K + A     Q+E+GGK+  IVL+DAD+  A   ++ G F  +GQ+CTA   V+
Sbjct: 238 TGKRVAKAASANGIKYQLEMGGKNPVIVLDDADVQSAVQGILSGAFKSTGQKCTATSRVI 297

Query: 724 VMESVADXXXXXXXXXXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V E + +              +G        + P  SES  N +   +   +E+GAT   
Sbjct: 298 VQEGIYEELKAALLAETKKITIGDGMNSSIWMGPCASESQLNTVLEYIQIGQEEGATLLY 357

Query: 547 PYKR-------EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNF 389
             +R        G  + P + + V   MRIA EE FGPV+ ++++ +VEE I   N + F
Sbjct: 358 GGQRLTENEYAHGFYVEPAIFEQVTSTMRIAQEEIFGPVIALLKVKTVEEAIDIANDTEF 417

Query: 388 GLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSI-N 212
           GL   ++T +I  A+   D +E G V++NS  A      PF G+K S  G++    +   
Sbjct: 418 GLSASLYTSNIGSALSFIDDIEAGLVRVNSESAGVELQAPFGGMKASSTGTREQGEAAKE 477

Query: 211 MMTKVKTTVI 182
             T +KT +I
Sbjct: 478 FYTAIKTVLI 487



>gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6)
           mRNA, complete cds.
          Length = 512

 Score =  119 bits (299), Expect = 6e-26
 Identities = 85/230 (36%), Positives = 119/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE--GNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     E  G  I P + 
Sbjct: 339 KKSPVGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  ++EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SDVTDNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWINCYNAFYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>pir|E75574|E75574 aldehyde dehydrogenase - Deinococcus radiodurans
           (strain R1)>gb:AE001863_40148 Deinococcus radiodurans R1
           section 2 of 2 of the complete chromosome
           2.>gb:AE001825_885470 Deinococcus radiodurans R1
           complete chromosome 2.
          Length = 524

 Score =  119 bits (299), Expect = 6e-26
 Identities = 79/236 (33%), Positives = 115/236 (48%), Gaps = 6/236 (2%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           +  ELGGK+  +V +DAD+D A   VV   +S +G+RCT+   VL+ E + D        
Sbjct: 271 VHFELGGKNPVVVFDDADLDKALDAVVFMIYSLNGERCTSSSRVLIQEGIYDEFTRRIAE 330

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR---EGNLIWPL 512
                 VG P D D ++ P+V       +      A+++GAT     +R    GN + P 
Sbjct: 331 RAANIRVGDPLDPDTEVGPLVHPRHFEKVMSYFECARQEGATIAAGGERVGEAGNFVRPT 390

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           L    R DM+IA EE FGPVL  I      + +   N  N+GL G ++T D+ +A   + 
Sbjct: 391 LFTAARNDMKIAQEEIFGPVLTAIPFKDEADALELANDVNYGLAGYLWTNDLTRAHRFAH 450

Query: 331 AMETGTVQINSAPARGPDHF--PFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
            +E G + +NS   R   H   PF G+K+SGIG  G   S     + K   I+L T
Sbjct: 451 GLEAGMIWVNSENVR---HLPTPFGGVKNSGIGRDGGDYSFEFYMETKNIAISLGT 503



>pir|A70318|A70318 aldehyde dehydrogenase - Aquifex
           aeolicus>gb:AE000677_25924 Aquifex aeolicus VF5 section
           9 of 109 of the complete genome.>gb:AE000657_976455
           Aquifex aeolicus VF5 complete genome.
          Length = 476

 Score =  119 bits (299), Expect = 6e-26
 Identities = 75/232 (32%), Positives = 119/232 (51%), Gaps = 4/232 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELG   A I+ +D +++ A    V+GG++ +GQ C +V+ V V E + D        
Sbjct: 244 LVLELGSNSAIILHKDGNLEKAVEKTVQGGYAIAGQVCISVQRVFVHEDLYDEFIKRLKE 303

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR---EGNLIWPL 512
                 VG P  +D D+ P+++ S    I+  +++A +KGA       R   +  +  P 
Sbjct: 304 RVSKLKVGDPMNEDTDLGPMIAPSELERIQEWISEAVQKGAKIEAGGLRCAEDETIFSPT 363

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           ++  V  D ++  EE F PV+ V     +EE I   N+S++GLQ  VFT D+  A     
Sbjct: 364 IVSLVPEDSKLFKEEAFAPVVAVNPYKDIEEAIRWVNSSDYGLQVGVFTNDVKLAWKCIK 423

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            +E G V IN  P    DH P+ G+K SGIG +G   +I   T++KT + +L
Sbjct: 424 EIEAGGVLINEGPTFRADHMPYGGVKYSGIGREGPKFAIEDYTEIKTVIFDL 475



>gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA
           (cDNA clone MGC:85659 IMAGE:6959916), complete cds.
          Length = 422

 Score =  119 bits (298), Expect = 8e-26
 Identities = 83/231 (35%), Positives = 111/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+L DA+++ A        F   GQ C A     V ES+ D          
Sbjct: 189 LELGGKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERA 248

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P D + +  P V+E     + G ++  K +GA       P    G  I P + 
Sbjct: 249 KNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVF 308

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DM IA EE FGPV+ +++  S+EE I   N S +GL G VFT+DI+KA  IS  +
Sbjct: 309 GDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGL 368

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
             GTV IN     G    PF G K SGIG +     +   T+VKT  I +P
Sbjct: 369 RAGTVWINCYNVFGV-QAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVP 418



>gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial
           aldehyde dehydrogenase 2 family (ALDH2) mRNA, complete
           cds.
          Length = 516

 Score =  119 bits (298), Expect = 8e-26
 Identities = 83/231 (35%), Positives = 111/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+L DA+++ A        F   GQ C A     V ES+ D          
Sbjct: 283 LELGGKSPNIILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERA 342

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P D + +  P V+E     + G ++  K +GA       P    G  I P + 
Sbjct: 343 KNRIVGDPFDLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVF 402

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DM IA EE FGPV+ +++  S+EE I   N S +GL G VFT+DI+KA  IS  +
Sbjct: 403 GDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGL 462

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
             GTV IN     G    PF G K SGIG +     +   T+VKT  I +P
Sbjct: 463 RAGTVWINCYNVFGV-QAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVP 512



>gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precursor
           (ALDH2) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 516

 Score =  119 bits (298), Expect = 8e-26
 Identities = 81/233 (34%), Positives = 113/233 (48%), Gaps = 4/233 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK   I+L DA+++ A        F   GQ C A     V ES+ D        
Sbjct: 281 VSLELGGKSPNIILSDANMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVE 340

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPL 512
                 VG P D + +  P V E     + G ++  K +GA       P    G  I P 
Sbjct: 341 RAKNRIVGDPFDLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPT 400

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +   V+ DM+IA EE FGPV+ +++  S+EE I   N S +GL   VFT++I+KA  IS 
Sbjct: 401 VFGDVKDDMKIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAAAVFTQNIDKANYISH 460

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
            +  GTV IN     G    PF G K SGIG +     +++ T+VKT  I +P
Sbjct: 461 GLRAGTVWINCYNVFGV-QAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVP 512



>gb:AF162770_2477781 Taeniopygia guttata class I aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 517

 Score =  119 bits (298), Expect = 8e-26
 Identities = 85/231 (36%), Positives = 116/231 (50%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A     +G F   GQ CTA   + V ES+ +          
Sbjct: 285 LELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIYVEESIYEEFVRKSVKRA 344

Query: 673 XXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATF-C--QPYKREGNLIWPLLL 506
               VG+P D   +  P + +   N I  L+     +GA   C  +   R+G  I P + 
Sbjct: 345 KRKIVGSPFDPTTEQGPQIDKKQYNKILELIQSGITEGAKLECGGKGLGRKGFFIEPTVF 404

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  ++R  +++E I   N S+FGL   VFT DINKA+ +S AM
Sbjct: 405 SNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAM 464

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN   A      PF G K SG G +     +   ++VKT  I +P
Sbjct: 465 QAGTVWINCYNALNAQS-PFGGSK-SGNGREMGECGLREYSEVKTVTIKIP 513



>gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.>gb:AF280404_2061324 Mus musculus
           retinaldehyde dehydrogenase 3 (Raldh3) mRNA, complete
           cds.>gb:BC058277_2103153 Mus musculus aldehyde
           dehydrogenase family 1, subfamily A3, mRNA (cDNA clone
           MGC:67939 IMAGE:6515355), complete cds.
          Length = 512

 Score =  119 bits (298), Expect = 8e-26
 Identities = 85/230 (36%), Positives = 119/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE--GNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     E  G  I P + 
Sbjct: 339 KKRPVGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  ++EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SDVTDNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWINCYNAFYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>sp|Q29490|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:MPU03906_1441244 Macroscelides
           proboscideus aldehyde dehydrogenase I, eta-crystallin
           mRNA, complete cds.
          Length = 501

 Score =  119 bits (298), Expect = 8e-26
 Identities = 78/230 (33%), Positives = 117/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELG K+ CIV  DAD+D A     +G F+  GQ C A   + V E++ D          
Sbjct: 268 LELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEETIYDEFVQRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
                G P     +  P ++++  N I  L+   K++GA   C   P+  +G  I P + 
Sbjct: 328 KKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTIF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  +++  S++E I   N + +GL   VFTKD++KA+ +S A+
Sbjct: 388 SNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N   A      P  G K SG G +     I+  T+VKT  + +
Sbjct: 448 QAGTVWVNCYLAASAQS-PAGGFKMSGHGREMGEYGIHEYTEVKTVTMKI 496



>gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH6)
           mRNA, complete cds.>gb:AF246710_2482314 Gallus gallus
           retinaldehyde dehydrogenase 3 mRNA, complete cds.
          Length = 512

 Score =  119 bits (297), Expect = 1e-25
 Identities = 84/234 (35%), Positives = 118/234 (50%), Gaps = 4/234 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E +            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFLNQGQCCTAASRVFVEEQIYPEFVKRSVEYA 338

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE--GNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     E  G  I P + 
Sbjct: 339 KKRLVGDPFDARTEQGPQIDQKQFDKILELIESGKKEGAKLECGGLAIEDRGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  S+EE I   N + +GL   VFTK++++A+ ++ A+
Sbjct: 399 SEVTDNMRIAKEEIFGPVQPIMKFKSIEEVIRRANNTEYGLTAAVFTKNLDRALTLASAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTPS 164
           ++GTV IN   A      PF G K SG G +    ++   T+VKT  I L   S
Sbjct: 459 QSGTVWINCYNALYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLSQKS 511



>gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-like
           mRNA, complete cds.
          Length = 501

 Score =  119 bits (297), Expect = 1e-25
 Identities = 78/230 (33%), Positives = 116/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   N I GL+   K++GA       R GN    + P + 
Sbjct: 328 KKYILGNPLNSGINQGPQIDKEQHNKILGLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKD++KAI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSMDDVIKRANNTTYGLAAGVFTKDLDKAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N   A  P   PF G K SG G +   + +   T++KT  + +
Sbjct: 448 QAGMVWVNCYLA-VPVQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMQI 496



>gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A7, mRNA (cDNA clone IMAGE:6314273), partial
           cds.
          Length = 507

 Score =  119 bits (297), Expect = 1e-25
 Identities = 78/230 (33%), Positives = 116/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 274 LELGGKSPCIVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERA 333

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   N I GL+   K++GA       R GN    + P + 
Sbjct: 334 KKYILGNPLNSGINQGPQIDKEQHNKILGLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 393

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKD++KAI +S A+
Sbjct: 394 SNVTDEMRIAKEEIFGPVQQIMKFKSMDDVIKRANNTTYGLAAGVFTKDLDKAITVSSAL 453

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N   A  P   PF G K SG G +   + +   T++KT  + +
Sbjct: 454 QAGMVWVNCYLA-VPVQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMQI 502



>gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogenase
           mRNA, complete cds.>gb:AF175578_1247684 Placopecten
           magellanicus omega-crystallin mRNA, complete cds.
          Length = 492

 Score =  119 bits (297), Expect = 1e-25
 Identities = 78/232 (33%), Positives = 112/232 (48%), Gaps = 4/232 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   +V  DAD+D+A      G F   GQ C A     V E + D          
Sbjct: 260 LELGGKSPNVVFSDADLDIAVEACHNGLFFNMGQCCCAASRTYVQEDIYDVFTKKLVEKA 319

Query: 673 XXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNL---IWPLLL 506
               VG P D   ++ P V +   + I  L+    ++GA      KR GN+   + P + 
Sbjct: 320 KTRVVGDPFDSRSMSGPQVDQEQFDKILALIDSGVQQGAKLECGGKRHGNVGYFVQPTVF 379

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  DMRI  EE FGPV  +I+  ++EE +   N + +GL   + TKDI+K +  S  +
Sbjct: 380 SGVTEDMRIGKEEIFGPVQQIIKFKTMEEVVQRANKTTYGLAAAICTKDIDKVMTYSSQV 439

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
           + GTV +NS    G    PF G K SGIG +   + +   ++VKT +I  PT
Sbjct: 440 KAGTVWVNSFNVFGA-QCPFGGFKMSGIGRELGESGLQQYSEVKTIIIKTPT 490



>gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 493

 Score =  119 bits (297), Expect = 1e-25
 Identities = 81/251 (32%), Positives = 124/251 (49%), Gaps = 9/251 (3%)
 Frame = -2

Query: 901 TGIAIXKKS-GAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG AI + S G    + +ELGGK   IV  DAD+D A        F+ SGQ C A   + 
Sbjct: 243 TGQAIIRASAGNLKRVSLELGGKSPVIVCADADLDKAVPIAAMAAFANSGQICIAGSRLF 302

Query: 724 VMESVADXXXXXXXXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V   + D              +G   D   +I P+VS+   + +EG +   +E+GA    
Sbjct: 303 VERKIHDELVERLGKFASALKIGDGADPTTEIGPLVSQRQLDKVEGFLQSGREEGAKVVA 362

Query: 547 PYKR-------EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNF 389
             +R       +GN + P +   V  DM+IA +E FGPV+  +  ++++E +   NA+ +
Sbjct: 363 GGRRVREGNLAKGNFVEPTVFAGVSDDMQIARDEIFGPVISALPFDTLDEAVERANATPY 422

Query: 388 GLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINM 209
           GL   VFT+D++KA +IS ++  G+V +N+  A  P   PF G K SG G +G T  ++ 
Sbjct: 423 GLAAGVFTRDVSKAHVISRSLRAGSVWVNTYHALDP-AMPFGGYKMSGYGREGGTEHLDE 481

Query: 208 MTKVKTTVINL 176
               K   I L
Sbjct: 482 YLHTKGVWIKL 492



>gb:AE017005_377162 Bacillus cereus ATCC 14579 section 8 of 18 of
           the complete genome.>gb:AE016877_1017412 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 474

 Score =  119 bits (297), Expect = 1e-25
 Identities = 78/242 (32%), Positives = 123/242 (50%), Gaps = 3/242 (1%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADI-DLAAANVVKGGFSYSGQRCTAVKVVLV 722
           GI I +K+G    + +ELG   A I+ ED ++ D     V  G F  +GQ C +V+ V V
Sbjct: 232 GIGIKQKAGL-KRVTLELGSNAAVIIDEDVELTDEIIERVKWGAFVNNGQVCISVQRVFV 290

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGAT-FCQ 548
            E+                 VG P  ++ D++ ++S+     I+  V +A ++GAT  C 
Sbjct: 291 HETKIHEFLSKLKKAMESVVVGDPSLEETDVSALISKKDVERIDMWVQEAIKEGATVLCG 350

Query: 547 PYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVF 368
             K++  +  P +L +V   + +  +E FGP++ V      +E I   N S +GLQ  VF
Sbjct: 351 GKKQDARIFEPTVLTNVPDHVSVQCQEVFGPLMTVNTFKEFDEAIEQVNNSRYGLQAGVF 410

Query: 367 TKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTT 188
           T ++ KA+   D +E G V IN  P    DH P+ G+K+SG G +GI  +I  MT++K  
Sbjct: 411 TNNLFKAMRAIDELEVGGVMINDIPTFRVDHMPYGGVKESGTGREGIKYAIEEMTEMKLV 470

Query: 187 VI 182
            I
Sbjct: 471 CI 472



>gb:CR628337_115381 Legionella pneumophila str. Lens complete
           genome.
          Length = 465

 Score =  119 bits (297), Expect = 1e-25
 Identities = 80/245 (32%), Positives = 126/245 (51%), Gaps = 16/245 (6%)
 Frame = -2

Query: 877 SGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXX 698
           +G + P+ +ELGGKD   +  DAD+D A   V+ G F  SGQ C  ++ + V + + +  
Sbjct: 222 AGRFIPVNLELGGKDPAYIRADADLDHAVETVIDGAFFNSGQSCCGIERIYVHKEIYEQF 281

Query: 697 XXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGA-----TFCQPYKR 536
                       +G P+D +  + P+V  SSA+F+   + +A  +GA     T      R
Sbjct: 282 VNKAVNLVKQYKLGRPDDPETTLGPLVRASSADFVREQIKEAVAQGAVAHINTRDFVMDR 341

Query: 535 EGN-LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
            G   + P +L  V   MRI  EE FGPV+ ++ ++S EE I   N S++GL   VFT+D
Sbjct: 342 PGTPYLAPQILTDVNHRMRIMTEETFGPVVGIMSVDSDEEAIERMNDSDYGLTAAVFTQD 401

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSG-------IGSQGIT--NSINMM 206
           I++ I I + ++TGT  IN      P    + G+K SG       IG + +T   S ++ 
Sbjct: 402 IHRGIAIGERLQTGTFFINRCDYLDPG-LAWTGVKKSGRGCTLSAIGYEYLTRPKSFHIR 460

Query: 205 TKVKT 191
           TK++T
Sbjct: 461 TKIET 465



>sp|Q28399|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:U02483_1446207 Elephantulus edwardi
           aldehyde dehydrogenase 1/eta-crystallin mRNA, complete
           cds.
          Length = 501

 Score =  119 bits (297), Expect = 1e-25
 Identities = 78/230 (33%), Positives = 117/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELG K+ CIV  DAD+D A     +G F+  GQ C A   + V E++ D          
Sbjct: 268 LELGAKNPCIVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
                G P     +  P ++++  N I  L+   K++GA   C   P+  +G  I P + 
Sbjct: 328 KKYVFGNPLTPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  +++  S++E I   N + +GL   VFTKD++KA+ +S A+
Sbjct: 388 SNVTDDMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N   A      P  G K SG G +     I+  T+VKT  + +
Sbjct: 448 QAGTVWVNCYLAASAQS-PAGGFKMSGHGREMGEYGIHEYTEVKTVTMKI 496



>gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  118 bits (296), Expect = 1e-25
 Identities = 83/230 (36%), Positives = 119/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG++ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGRNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE--GNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     E  G  I P + 
Sbjct: 339 KKRPVGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MRIA EE FGPV P+++  ++EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SDVTDNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLASAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV +N   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWVNCYNAFYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>gb:AY052630_586928 Rhodococcus ruber strain SC1 cyclododecanone
           oxidation gene cluster, complete cds.
          Length = 474

 Score =  118 bits (296), Expect = 1e-25
 Identities = 75/228 (32%), Positives = 117/228 (51%), Gaps = 7/228 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK A IVL+DADID    N V+     SGQ C+A+  +LV  ++            
Sbjct: 246 LELGGKSANIVLDDADIDELMPNAVQWAMINSGQTCSALTRLLVPRAILTEAETAAKTIA 305

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC----QPYK--REGNLIWP 515
               VGAP+D D  + P+VS +    + G +    ++GAT      +P +    G  + P
Sbjct: 306 EAYTVGAPDDPDTTLGPLVSATQLKRVRGYIDRGVQEGATLITGGSEPVEGLAVGYYVKP 365

Query: 514 LLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILIS 335
            +   V PDM I  EE FGPVL +   ++ E+ +   N S +GL+G V+++D+++A  ++
Sbjct: 366 TIFSEVTPDMTIHREEIFGPVLSIAPYDTEEDAVRIANDSEYGLRGGVWSRDVDRARAVA 425

Query: 334 DAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
             M TG V IN        + PF G K SG G +  T+ +    ++K+
Sbjct: 426 ARMRTGQVMINGGEFN--PNAPFGGYKQSGTGREFGTHGLEEFLEIKS 471



>gb:AE010805_266707 Methanosarcina acetivorans str. C2A, section 150
           of 534 of the complete genome.>gb:AE010299_907266
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 454

 Score =  118 bits (296), Expect = 1e-25
 Identities = 75/234 (32%), Positives = 113/234 (48%), Gaps = 6/234 (2%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  +ELGG D  IVLEDADID A+   ++  F  +GQ C A K  +V+E V         
Sbjct: 224 PFVLELGGSDPFIVLEDADIDRASQFAIESRFLNAGQSCIAAKRFIVVEDVVVDFIEAFE 283

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY-----KREGNLI 521
                  +G P +++ DI PV  +   N +E ++ DAK KGA   +P+       +G   
Sbjct: 284 LHIQELKIGDPMDEETDIGPVAKKECVNILEKILKDAKRKGA---EPHVYGEEHAKGFFF 340

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P L+     DM+    E FGP+ PVI     +E +   N++ FG    +++ D+ +A  
Sbjct: 341 RPALIPAASEDMKACNFEVFGPIAPVIIAKDEDEAVEIANSTEFGFGAEIWSADLERAER 400

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
           ++  +  G V IN      P   PF G+K SGIG +     +     +KT V+N
Sbjct: 401 LAKRIRAGFVTINGMVKSDP-RLPFGGVKKSGIGRELSYYGLKQFVNIKTVVVN 453



>pir|F83355|F83355 probable glyceraldehyde-3-phosphate dehydrogenase
           PA2323 [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004658_56559 Pseudomonas aeruginosa PAO1,
           section 219 of 529 of the complete
           genome.>gb:AE004091_970659 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 541

 Score =  118 bits (296), Expect = 1e-25
 Identities = 75/231 (32%), Positives = 117/231 (50%), Gaps = 5/231 (2%)
 Frame = -2

Query: 847 LGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXXXX 668
           L  K+  IVL   D+D A    V G  S++GQRCTA+K++ V ESV              
Sbjct: 287 LDAKNPGIVLPQVDLDNAVNEAVTGALSFNGQRCTALKILFVHESVLRPFLDKFSARLAS 346

Query: 667 XXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG--NLIWPLLLDHV 497
              G P E    +TP+      +++EGL+ DA  KGA        E   +  +P LL  V
Sbjct: 347 LKPGMPWEPGVALTPLPEPGKVDYLEGLLNDALAKGARVVNAGGGEHRQSFFYPALLSPV 406

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM--E 323
            PDMR+  EE FGP++PV+    ++E I +   S++G Q  +F  D  +   + DA   +
Sbjct: 407 SPDMRLYHEEQFGPLVPVVPYRELDEVIDYVLRSDYGQQLSLFGNDPAQIGRLVDAFANQ 466

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
            G + +N+   RGPD +PF G K+S  G+  + +++ + + ++T V    T
Sbjct: 467 VGRINVNAQCQRGPDSYPFNGRKNSAEGTLSVHDALRVFS-IRTLVATRDT 516



>pir|T31293|T31293 aldehyde dehydrogenase homolog - Sphingomonas
           aromaticivorans plasmid pNL1>gb:AF079317_477348
           Sphingomonas aromaticivorans plasmid pNL1, complete
           plasmid sequence.
          Length = 479

 Score =  118 bits (296), Expect = 1e-25
 Identities = 68/229 (29%), Positives = 104/229 (45%), Gaps = 1/229 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   ++  DAD+D A    +   F Y GQ C     + V  S+ D          
Sbjct: 247 LELGGKSPLVICADADLDKAVNAALFSIFMYQGQVCMGASRIYVERSIFDQFTKAFAAAT 306

Query: 673 XXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G   D   +  P++SE   + +   + DA+ KGA      +  GN     +L  V
Sbjct: 307 GRANSGDLRDPTTMLGPIISERQRDRVRRHIDDARSKGAAVLAGGEWSGNSCAATILSGV 366

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
             +M +  EE FGPV  +   +++EE +   N + +GL   +FT+D++KA+  +   E G
Sbjct: 367 TAEMTVFEEETFGPVTSLFPFDTLEEALELANNTEYGLSASIFTRDLDKALAFAQRAEAG 426

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
            V IN+       H PF G K SG G +G    + +MT+ K   I   T
Sbjct: 427 MVHINAPTLHDEPHVPFGGTKASGFGREGTEADLEIMTEWKWVTIQSAT 475



>gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone
           MGC:63786 IMAGE:2644084), complete cds.
          Length = 516

 Score =  118 bits (295), Expect = 2e-25
 Identities = 81/233 (34%), Positives = 112/233 (48%), Gaps = 4/233 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK   I+L DA+++ A        F   GQ C A     V ES+ D        
Sbjct: 281 VSLELGGKSPNIILSDANMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVE 340

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPL 512
                 VG P D + +  P V E     + G ++  K +GA       P    G  I P 
Sbjct: 341 RAKNRIVGDPFDLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPT 400

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +   V+ DM IA EE FGPV+ +++  S+EE I   N S +GL   VFT++I+KA  IS 
Sbjct: 401 VFGDVKDDMTIAREEIFGPVMQILKFKSLEEVIERANDSKYGLAAAVFTQNIDKANYISH 460

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
            +  GTV IN     G    PF G K SGIG +     +++ T+VKT  I +P
Sbjct: 461 GLRAGTVWINCYNVFGV-QAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVP 512



>sp|Q29491|DHAN_MACPR Aldehyde dehydrogenase, cytosolic 2 (EC
           1.2.1.3) (ALDH class 1) (Non- lens ALDH1) (ALDH1-NL)
           (Fragment).>gb:MPU40486_1441251 Macroscelides
           proboscideus cytoplasmic aldehyde dehydrogenase ALDH1-nl
           mRNA, partial cds.
          Length = 240

 Score =  117 bits (294), Expect = 2e-25
 Identities = 81/235 (34%), Positives = 119/235 (50%), Gaps = 9/235 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 7   LELGGKSPCIVFADADLDNAVEFAHRGLFFHQGQCCVAASRLFVEESIYDEFVRRSVERA 66

Query: 673 XXXXVGAPEDDCDITPVVSESSA------NFIEGLVTDAKEKGATF-CQ--PYKREGNLI 521
               +G P     +TP VS+         + I  L+   K++GA   C   P+  +G  I
Sbjct: 67  KKYVLGNP-----LTPGVSQGPQIDKEQYDKIIDLIESGKKEGAKLECGGGPWGNKGYFI 121

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P +  +V  +MRIA EE FGPV  +++  S++E I   N + +GL   VFTKD++KA+ 
Sbjct: 122 QPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDEVIKRANNTFYGLAAGVFTKDLDKAVT 181

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           +S A++ GTV +N   A      PF G K SG G +     ++  T+VKT  + +
Sbjct: 182 VSAALQAGTVWVNCYMANSV-QCPFGGFKMSGNGRELGEYGLHEYTEVKTVTMKI 235



>gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, partial cds.
          Length = 502

 Score =  117 bits (293), Expect = 3e-25
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 328 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKDI+KAI IS A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 448 QAGTVWVNCYGVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



>gb:HUMALDH1Z_2029126 Human aldehyde dehydrogenase I (ALDH-1) mRNA,
           3' end.>gb:HUMALDHA1_2029129 Human aldehyde
           dehydrogenase 1 mRNA.
          Length = 340

 Score =  117 bits (293), Expect = 3e-25
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 107 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 166

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 167 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 226

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKDI+KAI IS A+
Sbjct: 227 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSAL 286

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 287 QAGTVWVNCYGVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 335



>gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1)
           mRNA, complete cds.
          Length = 501

 Score =  117 bits (293), Expect = 3e-25
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 328 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKDI+KAI IS A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 448 QAGTVWVNCYGVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



>gb:BA000028_697250 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 472

 Score =  117 bits (293), Expect = 3e-25
 Identities = 76/224 (33%), Positives = 111/224 (49%), Gaps = 2/224 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGG    +V+EDAD+D A A V+   F  +GQ C     V V ES+ D        
Sbjct: 244 ISLELGGHAPFVVMEDADLDKAVAGVIASKFRNAGQTCVCTNRVYVHESIKDIFQDKLTE 303

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-EGNLIWPLLL 506
                 VG   E+  +I P++ +S+ + ++  V DA  KG       K   G  + P ++
Sbjct: 304 AVSKLKVGNGLEEGINIGPLIDQSAVDKVDEQVKDAISKGGRVTFGGKSLRGLYVEPTIV 363

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
                DM   +EE FGP++PV      EE I   N S +GL   VFT++I +AI IS+A+
Sbjct: 364 VDATDDMLCMYEETFGPLVPVTTFRDEEEVIARANNSPYGLAAYVFTENIGRAIRISEAL 423

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           E G V +N      P   PF G K+SG+G +G    I    ++K
Sbjct: 424 EYGIVGLNDGAPSTP-QAPFGGFKESGLGREGGYYGIEEFLEIK 466



>gb:AE017354_460602 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 465

 Score =  117 bits (293), Expect = 3e-25
 Identities = 74/220 (33%), Positives = 114/220 (51%), Gaps = 7/220 (3%)
 Frame = -2

Query: 877 SGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXX 698
           +G + P+ +ELGGKD   +  DAD+D A   V+ G F  SGQ C  ++ + V + + +  
Sbjct: 222 AGRFIPVNLELGGKDPAYIRADADLDHAVETVIDGAFFNSGQSCCGIERIYVHKEIYEQF 281

Query: 697 XXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGA-----TFCQPYKR 536
                       +G P+D +  + P+V  SSA+F+   + +A  +GA     T      R
Sbjct: 282 VNKAVNLVKQYKLGRPDDPETTLGPLVRASSADFVREQIKEAVAQGAVAHINTRDFVMDR 341

Query: 535 EGN-LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
            G   + P +L  V   MRI  EE FGPV+ ++ ++S EE I   N S++GL   VFT+D
Sbjct: 342 PGTPYLAPQILTDVNHRMRIMTEETFGPVVGIMSVDSDEEAIERMNDSDYGLTAAVFTQD 401

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
           I++ I I + ++TGT  IN      P    + G+K SG G
Sbjct: 402 IHRGIAIGERLQTGTFFINRCDYLDPG-LAWTGVKKSGRG 440



>gb:AE017271_423374 Bacillus cereus ATCC 10987, section 8 of 18 of
           the complete genome.>gb:AE017194_1061793 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 489

 Score =  117 bits (293), Expect = 3e-25
 Identities = 83/235 (35%), Positives = 116/235 (49%), Gaps = 6/235 (2%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGK A IV EDAD+D A    ++  +   G+ C A   +LV ESV +       
Sbjct: 256 PVSLELGGKSANIVFEDADLDEAVQGSIEAIYRNQGEICLAGSRLLVQESVYEQFLEKFV 315

Query: 682 XXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-----EGNLI 521
                  VG P  +D D+  +VS+S    ++  V     +GA      KR     EGN  
Sbjct: 316 AAVKRIKVGDPLSEDTDMGALVSKSHLETVDRYVELGISEGAKLAYGGKRVESLVEGNFY 375

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P +L  V   MR+A EE FGPVL VI   + E+ I   N S +GL G V+T D+ +A  
Sbjct: 376 EPTILYDVDNSMRVAQEEIFGPVLVVIPFKTEEDAIRIANDSIYGLAGVVWTNDLRRAQR 435

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           +   +++G + IN    R     PF G K SGIG +G  +S    T+ KT  + L
Sbjct: 436 VVSQIDSGLLWINCWYVRDL-RTPFGGSKASGIGREGGRHSFEFYTEAKTVTMKL 489



>gb:PSP296087_161304 Pseudonocardia sp. K1 ORF y, thmS gene, thma
           gene, ORF x, thmD gene, thmB gene, thm C gene, ORF Q,
           ORF Z and thm H gene.
          Length = 479

 Score =  117 bits (293), Expect = 3e-25
 Identities = 76/229 (33%), Positives = 112/229 (48%), Gaps = 5/229 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLED----ADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXX 686
           +ELGG  A +V  D     D++ AA  +       +GQ C +V+ V V   + +      
Sbjct: 246 LELGGNAAAVVCSDWSSEQDLEWAAQRIALFANYQAGQSCISVQRVYVPRELYEVFTVLL 305

Query: 685 XXXXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLL 509
                    G P DD  D+ PV++E+SA  IE  + DA   GA      +R G  + P L
Sbjct: 306 SRHIGALRQGNPNDDATDVGPVINEASAIRIEQWIDDAVHAGAKILVGGRRNGTSLEPTL 365

Query: 508 LDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDA 329
           L  V    RI  +E FGPV+ +   +S++      N S+FGLQ  VFT+DI  A      
Sbjct: 366 LADVPLAARILRDEAFGPVVSITPFDSLDSAFAAVNDSDFGLQTGVFTRDIRTAFRAHRD 425

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +E G V I   P+   D  P+ G+KDSGIG +G+ ++++  T  K  V+
Sbjct: 426 LEVGGVIIGDVPSYRADQMPYGGMKDSGIGREGVRSAMDDFTVEKVLVL 474



>pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1,
           cytosolic [validated] - human>gb:AL591031_1929961 Human
           DNA sequence from clone RP11-151D14 on chromosome
           9q13-21.2 Contains a novel gene and the ALDH1A1 gene for
           aldehyde dehydrogenase 1 family member A1, complete
           sequence.>gb:AL591031_1929962 Human DNA sequence from
           clone RP11-151D14 on chromosome 9q13-21.2 Contains a
           novel gene and the ALDH1A1 gene for aldehyde
           dehydrogenase 1 family member A1, complete
           sequence.>gb:AY338497_1944176 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 (ALDH1A1) gene,
           complete cds.>gb:AY390731_1948914 Homo sapiens aldehyde
           dehydrogenase 1 A1 mRNA, complete
           cds.>gb:BC001505_1967642 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1, mRNA (cDNA clone
           MGC:2318 IMAGE:2988388), complete
           cds.>gb:BT006921_1990359 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, complete
           cds.>gb:HUMALDC13_2029121 Homo sapiens aldehyde
           dehydrogenase (ALDH1) gene, exon 13 and complete cds.
          Length = 501

 Score =  117 bits (293), Expect = 3e-25
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 328 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKDI+KAI IS A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 448 QAGTVWVNCYGVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



>sp|P00352|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1) (ALHDII) (ALDH- E1).
          Length = 500

 Score =  117 bits (293), Expect = 3e-25
 Identities = 79/230 (34%), Positives = 114/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 267 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 326

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 327 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 386

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKDI+KAI IS A+
Sbjct: 387 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSAL 446

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 447 QAGTVWVNCYGVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 495



>gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyde
           dehydrogenase, complete cds.
          Length = 496

 Score =  117 bits (292), Expect = 4e-25
 Identities = 74/230 (32%), Positives = 115/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 263 LELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERA 322

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P   + +  P + +   N I  L+   K++ A   C   P+  +G  I P + 
Sbjct: 323 KKYVLGNPLAPEVNQGPQIDKEQYNKILDLIESGKKQWAKLECGGGPWGNKGYFIQPTVF 382

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA E+ FGPV  +++  S+++ I   N + +GL   +FTKD++KA+ +S A+
Sbjct: 383 SNVTDEMRIAKEQIFGPVQQIMKFKSLDDVIKRANNTTYGLSAGIFTKDLDKAVTVSSAL 442

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +     +   T+VKT  + +
Sbjct: 443 QAGTVWVNCYSVVSA-QVPFGGFKMSGNGRELGEYGLQQYTEVKTVTVKI 491



>gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (from
           clone DKFZp469B0514).
          Length = 501

 Score =  117 bits (292), Expect = 4e-25
 Identities = 77/230 (33%), Positives = 115/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A  +   G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVLADADLDNAVESAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 328 KKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKD++KA+ IS A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDLDKAVTISSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 448 QAGTVWVNCYGV-VTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



>gb:AE017333_446654 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856471 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 485

 Score =  117 bits (292), Expect = 4e-25
 Identities = 72/221 (32%), Positives = 106/221 (47%), Gaps = 1/221 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG  A IVLEDAD++ A        F++ GQ C +   +LV + V            
Sbjct: 252 LELGGNSALIVLEDADLEYAVNAATFSRFTHQGQICMSANRILVQKEVYPEFLKLFSQKV 311

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G P D +  I PV++E  A  +   +    E+GAT       +GNL+ P +L  V
Sbjct: 312 SGLKTGDPLDPETVIGPVINERQAEHLRKSIEKGIEEGATPLLKGDIKGNLVEPTILADV 371

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
            PDM +A EE FGPV+ V+   +  + +   N + FGL G V T ++   + I+  +ETG
Sbjct: 372 TPDMSVAKEELFGPVVCVMPFETEADAVEIANDTPFGLSGAVHTGNVESGVAIAKQIETG 431

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
            + +N        H  F G K SGIG      S++  T +K
Sbjct: 432 MIHVNDTTINDEPHVAFGGEKQSGIGRLNGEWSLDEFTTLK 472



>gb:CR628336_112321 Legionella pneumophila str. Paris complete
           genome.
          Length = 465

 Score =  117 bits (292), Expect = 4e-25
 Identities = 79/245 (32%), Positives = 126/245 (51%), Gaps = 16/245 (6%)
 Frame = -2

Query: 877 SGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXX 698
           +G + P+ +ELGGKD   +  DAD++ A   V+ G F  SGQ C  ++ + V + + +  
Sbjct: 222 AGRFIPVNLELGGKDPAYIRADADLEHAVETVIDGAFFNSGQSCCGIERIYVHKEIYEQF 281

Query: 697 XXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGA-----TFCQPYKR 536
                       +G P+D +  + P+V  SSA+F+   + +A  +GA     T      R
Sbjct: 282 VNKAVNLVKQYKLGRPDDPETTLGPLVRASSADFVREQIKEAIAQGAIAHINTQDFVMDR 341

Query: 535 EGN-LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKD 359
            G   + P +L  V   MRI  EE FGPV+ ++ ++S EE I   N S++GL   VFT+D
Sbjct: 342 PGTPYLAPQILTDVNHRMRIMTEETFGPVVGIMSVDSDEEAIERMNDSDYGLTAAVFTQD 401

Query: 358 INKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSG-------IGSQGIT--NSINMM 206
           I++ I I + ++TGT  IN      P    + G+K SG       IG + +T   S ++ 
Sbjct: 402 IHRGIAIGERLQTGTFFINRCDYLDPG-LAWTGVKKSGRGCTLSAIGYEYLTRPKSFHIR 460

Query: 205 TKVKT 191
           TK++T
Sbjct: 461 TKIET 465



>gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.
          Length = 512

 Score =  116 bits (291), Expect = 5e-25
 Identities = 84/230 (36%), Positives = 118/230 (51%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK+ CIV  DAD+DLA     +G F   GQ CTA   V V E V            
Sbjct: 279 LELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFA 338

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATF-CQPYKRE--GNLIWPLLL 506
               VG P D   +  P + +   + I  L+   K++GA   C     E  G  I P + 
Sbjct: 339 KKRPVGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVF 398

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +MR A EE FGPV P+++  ++EE I   N++++GL   VFTK+++KA+ ++ A+
Sbjct: 399 SDVTDNMRRAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAAL 458

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           E+GTV IN   A      PF G K SG G +    ++   T+VKT  I L
Sbjct: 459 ESGTVWINCYNAFYA-QAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



>gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003758_1223627 Drosophila melanogaster
           chromosome 3R, section 96 of 118 of the complete
           sequence.
          Length = 485

 Score =  116 bits (291), Expect = 5e-25
 Identities = 78/232 (33%), Positives = 112/232 (48%), Gaps = 4/232 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK   +V +DADID A     +  FS  GQ C A     V E + D        
Sbjct: 254 VSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAA 313

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNL---IWPL 512
                 VG P E +    P + +     + G +   K++GA      KR GN+   + P 
Sbjct: 314 KAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPT 373

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +   V+ DMRIA EE FGPV  + + +S+EE I   N   +GL   V T DINKA+  ++
Sbjct: 374 VFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFAN 433

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
            ++ G+V IN   A  P   PF G K SGIG +   + ++   + KT  + L
Sbjct: 434 NVDAGSVWINCYDAVLPS-TPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 484



>gb:BA000031_707232 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 481

 Score =  116 bits (291), Expect = 5e-25
 Identities = 80/222 (36%), Positives = 112/222 (50%), Gaps = 2/222 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG    IV +DADID A A  +   F  +GQ C       V   V D          
Sbjct: 254 MELGGNAPFIVFDDADIDAAVAGAMASKFRNAGQTCVCANRFYVHSKVYDEFVAKFDAAV 313

Query: 673 XXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-EGNLIWPLLLDH 500
               VG   E+  +I PV+SES+   I+ L+  A E+GA      K  +G  + P++L  
Sbjct: 314 QQLKVGNGLEEGVNIGPVISESAKQGIQALIDGAIEQGAKPVSALKELDGLFMQPVVLKG 373

Query: 499 VRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMET 320
           V  DM+I  EE FGPV PVIR +S E+ I   N + +GL    ++++I++   I++A+E 
Sbjct: 374 VTHDMKIVSEEIFGPVAPVIRFDSDEQLIEMANDTIYGLASYFYSQNIHRVWKIAEALEY 433

Query: 319 GTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           G V IN       +  PF G+K SGIG +G    I+    VK
Sbjct: 434 GMVGINEGMI-STEVAPFGGVKQSGIGREGAKQGIDEYMDVK 474



>gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC
           clone B11B23.
          Length = 494

 Score =  116 bits (290), Expect = 7e-25
 Identities = 85/230 (36%), Positives = 115/230 (50%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DADID A   V  G +   GQ C A   V V E + D          
Sbjct: 265 LELGGKSPNIIFNDADIDQAIDWVNFGIYFNHGQTCCAGSRVYVQEGIYDKFVAAFKQRA 324

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               VG P  D+    P VS+   + I G +   KE+GAT     +R G+    I P + 
Sbjct: 325 QQNKVGDPFHDETFQGPQVSQLQYDRIMGYIKAGKEEGATVETGGERHGDKGYFIQPTIF 384

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +VR DM+I  EE FGPV  V + ++ EE I   N SN+GL   V TKD+N AI +S+ +
Sbjct: 385 TNVRHDMKIMKEEIFGPVCAVAKFSTEEEVIKLGNDSNYGLAAAVHTKDLNTAIRVSNHL 444

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
             GTV +N+  A      PF G K+SGIG +    ++   T+ K+  I L
Sbjct: 445 RAGTVWVNTYNAL-HHQLPFGGYKESGIGRELGEAALANYTQCKSVAIKL 493



>gb:BX572605_803373 Rhodopseudomonas palustris CGA009 complete
           genome; segment 13/16.
          Length = 513

 Score =  116 bits (290), Expect = 7e-25
 Identities = 78/230 (33%), Positives = 117/230 (50%), Gaps = 8/230 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           +  ELGGK+  IV  DAD+D A   VV   +S +G+RCT+   +LV  S+AD        
Sbjct: 270 VHFELGGKNPVIVFGDADLDRALDAVVFMIYSLNGERCTSSSRLLVQSSIADSFIEKLAA 329

Query: 679 XXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREG--NLIW 518
                 VG P D   ++ P++ +   + +   V  A++ GAT      P+   G  + + 
Sbjct: 330 RVRALKVGHPLDPATEVGPLIHQRHLDKVCSYVDVARKDGATIAVGGAPFDGPGGGHYVQ 389

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P L+ + R DM++A +E FGP L VI      E I   N   +GL G V+T D+ +A+ +
Sbjct: 390 PTLVTNARSDMQVAQDEVFGPFLTVIPFKDEAEAIQIANDVRYGLTGYVWTADMGRALRV 449

Query: 337 SDAMETGTVQINSAPARGPDHF--PFQGIKDSGIGSQGITNSINMMTKVK 194
           +DA+E G + +NS   R   H   PF G+K SGIG  G   S +   + K
Sbjct: 450 ADALEAGMIWLNSENVR---HLPTPFGGMKQSGIGRDGGDYSFDFYMETK 496



>gb:BA000035_714864 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 499

 Score =  116 bits (290), Expect = 7e-25
 Identities = 69/206 (33%), Positives = 100/206 (48%), Gaps = 1/206 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG    +VL DADI+ A A    G F + GQ C AV  ++V   V D          
Sbjct: 266 LELGGNAPMVVLSDADINKAVAAASMGSFLHQGQICMAVNRIIVEAPVYDQFLEGFAARV 325

Query: 673 XXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
                G   DD  +  P+V++S    + G +  A+E+GA        EG +I P +   V
Sbjct: 326 SKVAYGDQLDDATMVGPIVNDSQVESVSGKIDLAREQGARAVVSGPIEGRVIAPHVFADV 385

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
            PDM +  EE FGPV+ V++ ++ E  +   N + FGL   VFT+D+ + I  +  +E G
Sbjct: 386 TPDMELFREEIFGPVVGVVKADNEEHALELANDTEFGLSSAVFTEDLQRGINFARRVEAG 445

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIG 239
              IN        H  F G K+SG+G
Sbjct: 446 MTHINDITVNDEAHVMFGGEKNSGLG 471



>pir|T44987|T44987 aldehyde dehydrogenase (EC 1.2.1.-) [imported] -
           Haloferax volcanii megaplasmid pHV3>gb:HVU95374_138941
           Haloferax volcanii plasmid pHV3 putative
           sulfate/thiosulfate transport protein gene, partial cds,
           and aldehyde dehydrogenase and oxidoreductase genes,
           complete cds.
          Length = 496

 Score =  116 bits (290), Expect = 7e-25
 Identities = 77/228 (33%), Positives = 109/228 (47%), Gaps = 8/228 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG +A +V E AD+D AA   V G F + GQ C ++   +V ESV D          
Sbjct: 256 MELGGNNAHVVTEGADVDRAADAAVFGSFVHQGQVCISINRHIVHESVYDEYVEKLTERA 315

Query: 673 XXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNLIW 518
               VG A EDD  + P++ ES  + + G V +    GAT              +  ++ 
Sbjct: 316 AELPVGSAHEDDTVVGPIIDESQRDEMLGYVEETVAAGATLETGGSTADLDGVDDSLVVQ 375

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +L  V  DM  A  E FGP+ PVI  + V+E +   NA+ +GL G V   D+     I
Sbjct: 376 PTVLSGVTNDMAAARNEHFGPIAPVIPFSDVDEAVELANATEYGLSGSVHAGDLATGKEI 435

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           +  METG V +N  P     H PF G   SG+G+      ++ +T+ K
Sbjct: 436 ALRMETGNVHVNDQPINDEAHVPFSGTGASGVGTYNSDAFLDEITEDK 483



>gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA,
           complete cds.
          Length = 501

 Score =  115 bits (289), Expect = 9e-25
 Identities = 81/237 (34%), Positives = 116/237 (48%), Gaps = 9/237 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D        
Sbjct: 266 VSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVE 325

Query: 679 XXXXXXVGAPEDDCDITPVVSESSA------NFIEGLVTDAKEKGATF-CQ--PYKREGN 527
                 +G P     +TP VS+           I  L+   K++GA   C   P+  +G 
Sbjct: 326 RAKKYVLGNP-----LTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGY 380

Query: 526 LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKA 347
            I P +   V  DMRIA EE FGPV  +++  S+++ I   N + +GL   +FT DI+KA
Sbjct: 381 FIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKA 440

Query: 346 ILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I +S A+++GTV +N          PF G K SG G +      +  T+VKT  I +
Sbjct: 441 ITVSSALQSGTVWVNCYSVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKI 496



>pir|H95380|H95380 probable betaine-aldehyde dehydrogenase (EC
           1.2.1.8) [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymA>gb:AE007281_224912 Sinorhizobium
           meliloti 1021 plasmid pSymA section 87 of 121 of the
           complete plasmid sequence.>gb:AE006469_1102680
           Sinorhizobium meliloti 1021 plasmid pSymA, complete
           sequence.
          Length = 489

 Score =  115 bits (289), Expect = 9e-25
 Identities = 76/235 (32%), Positives = 122/235 (51%), Gaps = 4/235 (1%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ MELGGK A IV +DAD++ A +  + G F  +GQ C+    V +   + +       
Sbjct: 256 PVTMELGGKSALIVFDDADVEAAVSGAILGNFYSAGQICSNGTRVFLQRGIREAFLARLL 315

Query: 682 XXXXXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGA-TFCQPYKREGNLIW--P 515
                  +G P D+  DI P+VS +  N +   V  A+ +GA     P K      W  P
Sbjct: 316 ARVAALKIGDPMDEETDIGPLVSAAHRNRVATYVARAEVEGAYQMAPPRKLPPGDAWHEP 375

Query: 514 LLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILIS 335
           ++  +V   M +A EE FGPV+ V+  +  ++ +   NA++FGL   +FT+D+ +A  ++
Sbjct: 376 VVFTNVTDWMTLAREEVFGPVMAVLDFDDEQDVVARANATDFGLAAGIFTRDLVRAHRLA 435

Query: 334 DAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
             +E GTV IN A    P    F GIK SGIG +    +I+  T++K+  +++ T
Sbjct: 436 AELEAGTVWIN-AYNLTPAGMAFGGIKRSGIGRENGRVAIDHYTQLKSVFVSMQT 489



>pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3),
           cytosolic - sheep>gb:OAU12761_1441882 Ovis aries
           aldehyde dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  115 bits (289), Expect = 9e-25
 Identities = 81/237 (34%), Positives = 116/237 (48%), Gaps = 9/237 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D        
Sbjct: 266 VSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVE 325

Query: 679 XXXXXXVGAPEDDCDITPVVSESSA------NFIEGLVTDAKEKGATF-CQ--PYKREGN 527
                 +G P     +TP VS+           I  L+   K++GA   C   P+  +G 
Sbjct: 326 RAKKYVLGNP-----LTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGY 380

Query: 526 LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKA 347
            I P +   V  DMRIA EE FGPV  +++  S+++ I   N + +GL   +FT DI+KA
Sbjct: 381 FIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKA 440

Query: 346 ILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I +S A+++GTV +N          PF G K SG G +      +  T+VKT  I +
Sbjct: 441 ITVSSALQSGTVWVNCYSVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKI 496



>sp|P51977|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  115 bits (289), Expect = 9e-25
 Identities = 81/237 (34%), Positives = 116/237 (48%), Gaps = 9/237 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D        
Sbjct: 265 VSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVE 324

Query: 679 XXXXXXVGAPEDDCDITPVVSESSA------NFIEGLVTDAKEKGATF-CQ--PYKREGN 527
                 +G P     +TP VS+           I  L+   K++GA   C   P+  +G 
Sbjct: 325 RAKKYVLGNP-----LTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGY 379

Query: 526 LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKA 347
            I P +   V  DMRIA EE FGPV  +++  S+++ I   N + +GL   +FT DI+KA
Sbjct: 380 FIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKA 439

Query: 346 ILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I +S A+++GTV +N          PF G K SG G +      +  T+VKT  I +
Sbjct: 440 ITVSSALQSGTVWVNCYSVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKI 495



>sp|P48644|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  115 bits (289), Expect = 9e-25
 Identities = 81/237 (34%), Positives = 116/237 (48%), Gaps = 9/237 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D        
Sbjct: 265 VSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVE 324

Query: 679 XXXXXXVGAPEDDCDITPVVSESSA------NFIEGLVTDAKEKGATF-CQ--PYKREGN 527
                 +G P     +TP VS+           I  L+   K++GA   C   P+  +G 
Sbjct: 325 RAKKYVLGNP-----LTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGY 379

Query: 526 LIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKA 347
            I P +   V  DMRIA EE FGPV  +++  S+++ I   N + +GL   +FT DI+KA
Sbjct: 380 FIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKA 439

Query: 346 ILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           I +S A+++GTV +N          PF G K SG G +      +  T+VKT  I +
Sbjct: 440 ITVSSALQSGTVWVNCYSVVSA-QCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKI 495



>gb:BA000043_736951 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 493

 Score =  115 bits (288), Expect = 1e-24
 Identities = 72/215 (33%), Positives = 108/215 (50%), Gaps = 8/215 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +E+GGK+A IV++DAD+ LA   ++   F  SGQRCTA   V+V E V          
Sbjct: 244 VSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQELERRLLE 303

Query: 679 XXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQP--YKREGNLIW--- 518
                 +G   D+   + PV+ E +   I+  V    E+GA         REG+      
Sbjct: 304 AVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLVGGYILREGDYARGFY 363

Query: 517 --PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P +   V P+MRIA EE FGPV+ +I + S++E I   N+ ++GL   +FT+D+N   
Sbjct: 364 YAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLDEAIAVNNSVDYGLSSAIFTRDVNNVF 423

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
                ++TG V +N+       H PF G K +G G
Sbjct: 424 RAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG 458



>gb:BA000037_722411 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 506

 Score =  115 bits (288), Expect = 1e-24
 Identities = 78/232 (33%), Positives = 115/232 (49%), Gaps = 6/232 (2%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           +  ELGGK+  IV +DAD + A   VV   +S +GQRCT+   +L+   +          
Sbjct: 264 VHFELGGKNPVIVFDDADFERALDAVVFMIYSLNGQRCTSSSRLLIQNGIKPKFIEALKQ 323

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQ-----PYKREGNLIW 518
                 VG P D + ++ P+V +S  N +   +T A+E GAT        P K  GN + 
Sbjct: 324 RVESLQVGHPLDPETEVGPLVHQSHYNKVMSYMTAAEEDGATIAVGGRKLPEKGAGNYLT 383

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P L       MRIA EE FGPVL  I  +S EE +   N +++GL G ++T +  +A+ +
Sbjct: 384 PTLFTDADNTMRIAREEIFGPVLTCIGFDSEEEALEIANDTDYGLSGYIWTSNTGRAMRM 443

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           +  +E G + +NS   R     PF G+K SGIG  G   S +   + K   I
Sbjct: 444 ATKVEAGMIWVNSENNRNLPS-PFGGVKMSGIGRDGGDWSFDFYMETKNVCI 494



>gb:AB052732_7655 Geobacillus stearothermophilus genes for unknown
           product, aldehyde dehydrogenase and L-lysine
           dehydrogenase, partial and complete cds.
          Length = 458

 Score =  115 bits (288), Expect = 1e-24
 Identities = 72/215 (33%), Positives = 108/215 (50%), Gaps = 8/215 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +E+GGK+A IV++DAD+ LA   ++   F  SGQRCTA   V+V E V          
Sbjct: 209 VSLEMGGKNAVIVMDDADLTLAVDGIIWSAFGTSGQRCTACSRVIVHERVKQEFERRLLE 268

Query: 679 XXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQP--YKREGNLIW--- 518
                 +G   D+   + PV+ E +   I+  V    E+GA         REG+      
Sbjct: 269 AVKTLKIGNGLDETVKVGPVIHEEALQKIDRYVRIGVEEGAKLLVGGYILREGDYARGFY 328

Query: 517 --PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P +   V P+MRIA EE FGPV+ +I + S++E I   N+ ++GL   +FT+D+N   
Sbjct: 329 YAPTIFTDVTPNMRIAREEIFGPVVSIISVRSLDEAIAVNNSVDYGLSSAIFTRDVNNVF 388

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
                ++TG V +N+       H PF G K +G G
Sbjct: 389 RAMRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNG 423



>gb:BA000045_743923 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 498

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/213 (30%), Positives = 111/213 (52%), Gaps = 8/213 (3%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +E+GGK+A IV+EDAD++LA    + G F  +GQRCTA   +++   +            
Sbjct: 251 LEMGGKNAQIVMEDADLELALKGALWGAFGTTGQRCTATSRLILHRDIKQVFTEKLIEQA 310

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKRE----GNLIW 518
               +G   D + ++ P+++ES  + +   +  A+++G       +P + E    G+   
Sbjct: 311 RQLRLGPGIDPNTEVGPLINESQLSRVHEYIEIARQEGLKILLGGEPVRSEELVHGHFFE 370

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +LD V P  R+A EE FGPV+ ++ ++S E+ +   N + +GL   V+T+D+N+A   
Sbjct: 371 PTILDEVPPASRLAREEVFGPVVVLMTVDSFEQAVELLNDTPYGLSSSVYTRDVNRAFRA 430

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
              +E G   IN        H PF G+K +G G
Sbjct: 431 IRDIEAGITYINGPTTGAEVHLPFGGVKQTGNG 463



>gb:AE017355_463376 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 474

 Score =  115 bits (287), Expect = 2e-24
 Identities = 78/242 (32%), Positives = 120/242 (49%), Gaps = 3/242 (1%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADI-DLAAANVVKGGFSYSGQRCTAVKVVLV 722
           GI I  K+G    + +ELG   A I+ ED ++ D     V  G F  +GQ C +V+ V V
Sbjct: 232 GIGIKAKAGL-KRVTLELGSNAAVIIDEDVELTDELIERVKWGAFVNNGQVCISVQRVFV 290

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E   D              VG P  ++ D++ ++S+     I+  V +A ++GA     
Sbjct: 291 HEERMDDFLSKLRKAMETVVVGDPLIEETDVSALISKKDVERIDNWVQEAVKEGANVLYG 350

Query: 544 -YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVF 368
             KR+  +  P +L +V   + +  +E FGP++ V      +E I   N S +GLQ  VF
Sbjct: 351 GNKRDERVFEPTVLTNVPEHVSVQCQEVFGPLMTVNTFKEFDEAIEQVNNSRYGLQAGVF 410

Query: 367 TKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTT 188
           T ++ KA+   D +E G V IN  P    DH P+ G+K+SG G +GI  +I  MT++K  
Sbjct: 411 TNNLFKAMRAIDELEVGGVMINDIPTFRVDHMPYGGVKESGTGREGIKYAIEEMTEMKLV 470

Query: 187 VI 182
            I
Sbjct: 471 CI 472



>gb:AE017031_382402 Bacillus anthracis str. Ames section 8 of 18 of
           the complete genome.>gb:AE017225_407523 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452250 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012107 Bacillus
           anthracis str. Ames complete genome.
          Length = 474

 Score =  115 bits (287), Expect = 2e-24
 Identities = 78/242 (32%), Positives = 120/242 (49%), Gaps = 3/242 (1%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADI-DLAAANVVKGGFSYSGQRCTAVKVVLV 722
           GI I  K+G    + +ELG   A I+ ED ++ D     V  G F  +GQ C +V+ V V
Sbjct: 232 GIGIKAKAGL-KRVTLELGSNAAVIIDEDVELTDELIERVKWGAFVNNGQVCISVQRVFV 290

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E   D              VG P  ++ D++ ++S+     I+  V +A ++GA     
Sbjct: 291 HEERRDDFLSKLRKAMETVVVGDPLIEETDVSALISKKDVERIDNWVQEAVKEGANVLYG 350

Query: 544 -YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVF 368
             KR+  +  P +L +V   + +  +E FGP++ V      +E I   N S +GLQ  VF
Sbjct: 351 GNKRDERVFEPTVLTNVPEHVSVQCQEVFGPLMTVNTFKEFDEAIEQVNNSRYGLQAGVF 410

Query: 367 TKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTT 188
           T ++ KA+   D +E G V IN  P    DH P+ G+K+SG G +GI  +I  MT++K  
Sbjct: 411 TNNLFKAMRAIDELEVGGVMINDIPTFRVDHMPYGGVKESGTGREGIKYAIEEMTEMKLV 470

Query: 187 VI 182
            I
Sbjct: 471 CI 472



>gb:AE016787_333060 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_948137 Pseudomonas
           putida KT2440 complete genome.
          Length = 493

 Score =  115 bits (287), Expect = 2e-24
 Identities = 78/236 (33%), Positives = 116/236 (49%), Gaps = 6/236 (2%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELGGK   I+  DAD+D A    V G ++ SGQ C A   +LV + + D        
Sbjct: 249 LSLELGGKSPNIIFADADLDSAINGAVAGIYAASGQSCVAGSRLLVQDEIFDEFVERLIA 308

Query: 679 XXXXXXVGAPEDDC-DITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-----EGNLIW 518
                 +G P+DD  ++ P+ +      +EGLV  AK +GA      KR     +G    
Sbjct: 309 RAKRIRIGNPQDDASEMGPMATAQQLAVVEGLVAAAKAEGAKLHMGGKRADVEGDGWFYE 368

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P L +     M I  EE FGPV  VIR  + EE +   N S FGL   ++T+D+ +A  +
Sbjct: 369 PTLFECDSNAMTIMQEEVFGPVAAVIRFKTEEEALAMANDSQFGLAAGIWTRDLGRAHRL 428

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPT 170
           +  + +G + +N+  A      P  G K+SG G +   +S+   T++KT  INL T
Sbjct: 429 ARDVRSGIIWVNTYRAVSA-MAPIGGFKNSGYGRESGIDSVLAYTELKTVWINLST 483



>gb:AE016776_330104 Pseudomonas putida KT2440 section 3 of 21 of the
           complete genome.>gb:AE015451_945181 Pseudomonas putida
           KT2440 complete genome.
          Length = 472

 Score =  115 bits (287), Expect = 2e-24
 Identities = 70/228 (30%), Positives = 112/228 (49%), Gaps = 1/228 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L M+LGG    +VL+D D++    + V G F  +GQ C   + +LV  S+ +        
Sbjct: 242 LAMDLGGNAPVLVLKDCDLEATVESCVSGAFWAAGQNCIGTQRILVDASIYEAFRERFVA 301

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                  G P   + D+ P+++E++A  IE  V  A E GA     ++R G +  P +L+
Sbjct: 302 LTQAMVWGDPGRRETDMGPMITEAAARQIEARVNQAIEGGARLLCGHQRHGAVYAPTVLE 361

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V P  R+  EE F PV+ +    +VE+ I   NA  + L   VFT+D++ A+ ++  +E
Sbjct: 362 SVDPVSRLWLEEVFAPVVMLAPFETVEQAIALANAPEYSLHAGVFTRDLSLALSLARRIE 421

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            G V IN +     D  PF G K   +G +G+  +   MT+ K    N
Sbjct: 422 AGGVMINDSSDYRFDAMPFGGAKYGSLGREGVRFAYEDMTQPKVVCFN 469



>gb:AE006189_216418 Pasteurella multocida subsp. multocida str. Pm70
           section 156 of 204 of the complete
           genome.>gb:AE004439_1119148 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 486

 Score =  115 bits (287), Expect = 2e-24
 Identities = 79/253 (31%), Positives = 124/253 (49%), Gaps = 11/253 (4%)
 Frame = -2

Query: 901 TGIAIXKKSGAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLV 722
           TG  I K +G      MELGGK   ++ +DAD+D A    +   FS +G+RCTA   + +
Sbjct: 226 TGKHILKHAGL-KKYSMELGGKSPVLIFDDADLDRALDAALFTIFSLNGERCTAGSRIFI 284

Query: 721 MESVADXXXXXXXXXXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQ- 548
            E+V D              VG P+D +  +  +++    + + G +    E+GAT    
Sbjct: 285 QETVYDEFVKQFAARAKRLIVGDPQDFNTQVGSMITRQHYDKVTGYIRIGLEEGATLLAG 344

Query: 547 ---------PYKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNAS 395
                     + ++G+ I P +   V   MRIA EE FGPV+ +++     E +   N  
Sbjct: 345 GLERPQNLPAHLQKGHFIQPTVFADVDNRMRIAQEEIFGPVVCLMKFKDEAEALRLANDV 404

Query: 394 NFGLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSI 215
            +GL   ++TKDI KA+ +S+ +E G V +NS   R     PF GIK SGIG +G   S 
Sbjct: 405 EYGLASYIWTKDIAKALRLSNGIEAGMVFVNSQNVRDLRQ-PFGGIKASGIGREGGEYSF 463

Query: 214 NMMTKVKTTVINL 176
            +  ++K   I++
Sbjct: 464 EVFAELKNVCISM 476



>gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA
           clone MGC:80785 IMAGE:5513343), complete cds.
          Length = 521

 Score =  114 bits (286), Expect = 2e-24
 Identities = 81/231 (35%), Positives = 105/231 (45%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A        F   GQ C A     V E + +          
Sbjct: 288 LELGGKSPIIIFSDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRA 347

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P D   +  P V E   N I G +   K++GA       P    G  I P + 
Sbjct: 348 KNRIVGNPFDFKTEQGPQVDEEQFNKILGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVF 407

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +M IA EE FGPV+ +++  S+EE I   N S +GL   VFTKDI+KA   S ++
Sbjct: 408 GDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHTFSQSV 467

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
             GTV IN     G    PF G K SGIG +     +   T+VK   I +P
Sbjct: 468 RAGTVWINCYDVFGA-QAPFGGYKASGIGRELGEYGLEAYTEVKNVTIKIP 517



>gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (cDNA
           clone MGC:89020 IMAGE:7004710), complete cds.
          Length = 521

 Score =  114 bits (286), Expect = 2e-24
 Identities = 80/231 (34%), Positives = 106/231 (45%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D A        F   GQ C A     V E + +          
Sbjct: 288 LELGGKSPNIIFSDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRA 347

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P D   +  P V E   N + G +   K++GA       P    G  I P + 
Sbjct: 348 KNRIVGNPFDFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVF 407

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  +M IA EE FGPV+ +++  S+EE I   N S +GL   VFTKDI+KA  +S ++
Sbjct: 408 GDVTDNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSV 467

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
             GTV IN     G    PF G K SGIG +     +   T+VK   I +P
Sbjct: 468 RAGTVWINCYDVFGA-QAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIP 517



>gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1
           mRNA, complete cds.
          Length = 501

 Score =  114 bits (286), Expect = 2e-24
 Identities = 77/230 (33%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 328 KKYILGNPLTPGATQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFT DI+KA+ IS A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTNDIDKAVTISSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 448 QAGTVWVNCYGV-VTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



>gb:BX927156_834202 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment 9/10.
          Length = 496

 Score =  114 bits (286), Expect = 2e-24
 Identities = 70/213 (32%), Positives = 107/213 (50%), Gaps = 1/213 (0%)
 Frame = -2

Query: 874 GAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXX 695
           G    + +ELGG    +VL DADID AA     G F + GQ C ++  V+V  +V D   
Sbjct: 262 GPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFL 321

Query: 694 XXXXXXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIW 518
                       G P  +  +  PV+++S  + ++  +  AK++GAT       EG L+ 
Sbjct: 322 EKFVEAVKNIPTGDPSAEGTLVGPVINDSQLSGLKEKIELAKKEGATVQVEGPIEGRLVH 381

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +   V  DM IA EE FGP++ V++ +         NAS+FGL   V++KDI++A   
Sbjct: 382 PHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQF 441

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
           +  +++G V IN        H  F G K+SG+G
Sbjct: 442 ALQIDSGMVHINDLTVNDEPHVMFGGSKNSGLG 474



>gb:BA000036_720395 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:AX065101_1459464 Sequence 227 from
           Patent WO0100844.
          Length = 484

 Score =  114 bits (286), Expect = 2e-24
 Identities = 70/213 (32%), Positives = 107/213 (50%), Gaps = 1/213 (0%)
 Frame = -2

Query: 874 GAWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXX 695
           G    + +ELGG    +VL DADID AA     G F + GQ C ++  V+V  +V D   
Sbjct: 250 GPMKTVALELGGNAPFVVLADADIDAAAQAAAVGAFLHQGQICMSINRVIVDAAVHDEFL 309

Query: 694 XXXXXXXXXXXVGAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIW 518
                       G P  +  +  PV+++S  + ++  +  AK++GAT       EG L+ 
Sbjct: 310 EKFVEAVKNIPTGDPSAEGTLVGPVINDSQLSGLKEKIELAKKEGATVQVEGPIEGRLVH 369

Query: 517 PLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILI 338
           P +   V  DM IA EE FGP++ V++ +         NAS+FGL   V++KDI++A   
Sbjct: 370 PHVFSDVTSDMEIAREEIFGPLISVLKADDEAHAAELANASDFGLSAAVWSKDIDRAAQF 429

Query: 337 SDAMETGTVQINSAPARGPDHFPFQGIKDSGIG 239
           +  +++G V IN        H  F G K+SG+G
Sbjct: 430 ALQIDSGMVHINDLTVNDEPHVMFGGSKNSGLG 462



>gb:AE016786_332859 Pseudomonas putida KT2440 section 13 of 21 of
           the complete genome.>gb:AE015451_947936 Pseudomonas
           putida KT2440 complete genome.
          Length = 539

 Score =  114 bits (286), Expect = 2e-24
 Identities = 72/226 (31%), Positives = 114/226 (50%), Gaps = 5/226 (2%)
 Frame = -2

Query: 847 LGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXXXX 668
           L  K+  IVL   D+D A    V G  S++GQRCTA+K++ V E V +            
Sbjct: 285 LDAKNPGIVLPQVDLDNAVEEAVTGALSFNGQRCTALKILFVHEDVVEAFLDKFQHKLAA 344

Query: 667 XXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPY--KREGNLIWPLLLDHV 497
              G P E    +TP+      ++++GLV DA EKGA           G+  +P LL  V
Sbjct: 345 LKPGMPWEPGVALTPLPEPGKVDYLDGLVADATEKGARVLNENGGNSRGSFFYPALLYPV 404

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD--AME 323
             +MR+  EE FGP++PV+    ++  I +   S++G Q  +F  D      + D  A +
Sbjct: 405 SREMRVYHEEQFGPLVPVVPYRDLQTVIDYVLDSDYGQQLSLFGNDPATIGSLVDIFANQ 464

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTV 185
            G + IN+   RGPD +PF G K+S  G+  + +++ + + ++T V
Sbjct: 465 VGRININAQCQRGPDTYPFNGRKNSAEGTLSVDDALRVFS-IRTLV 509



>gb:AB112586_13741 Streptomyces sp. WA46 genes for salicylate
           degradation related proteins, complete cds.
          Length = 511

 Score =  114 bits (286), Expect = 2e-24
 Identities = 80/216 (37%), Positives = 109/216 (50%), Gaps = 8/216 (3%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P+ +ELGGKD  IV EDAD+D AAA+VV G    +G  C +++V  V+ESV D       
Sbjct: 246 PVLLELGGKDGVIVAEDADLDEAAAHVVWGAMQNTGHGCISLEVAYVVESVHDEFVRKIS 305

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNL------- 524
                  VG+ ++D +I PV   S  + I   + DA E+GAT        G L       
Sbjct: 306 ELAGQVRVGS-DEDAEIGPVPLPSQTSIIREHIQDALERGAT-----ATVGGLDAVGERY 359

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
           + P +L  V PD   A EE FGP L VI++   +E + H NA  +GL   VF++D  +A 
Sbjct: 360 VAPTILVGVAPDALAATEETFGPTLAVIKVADADEAVAHINAGRYGLGSAVFSRDRGEA- 418

Query: 343 LISDAMETGTVQINSAPARGPD-HFPFQGIKDSGIG 239
            I+  +  G   IN A     +   PF G  DSG G
Sbjct: 419 -IARRLRVGMTSINDALVFSMNPAVPFGGRGDSGYG 453



>sp|Q8HYE4|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1).
          Length = 500

 Score =  114 bits (286), Expect = 2e-24
 Identities = 77/230 (33%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIVL DAD+D A      G F + GQ C A   + V ES+ D          
Sbjct: 267 LELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERA 326

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +   + I  L+   K++GA   C   P+  +G  + P + 
Sbjct: 327 KKYILGNPLTPGATQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVF 386

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFT DI+KA+ IS A+
Sbjct: 387 SNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTNDIDKAVTISSAL 446

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +      +  T+VKT  + +
Sbjct: 447 QAGTVWVNCYGV-VTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 495



>gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1
           family, member B1 (predicted), mRNA (cDNA clone
           MGC:93759 IMAGE:7108511), complete cds.
          Length = 519

 Score =  114 bits (285), Expect = 3e-24
 Identities = 79/230 (34%), Positives = 112/230 (48%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD+D A     +  F   GQ C A     V ES+            
Sbjct: 286 LELGGKSPSIVLADADMDHAVDQCHEALFFNMGQCCCAGSRTFVEESIYHEFLERTVEKA 345

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     I G +   +++GA      + +   G  I P + 
Sbjct: 346 KKRKVGNPFELDTQQGPQVDKEQFEKILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVF 405

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V+ DMRIA EE FGPV P+ +   +EE I   N + +GL   VFT+D++KA+  S A+
Sbjct: 406 GNVQDDMRIAREEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKALYFSQAL 465

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +
Sbjct: 466 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKV 514



>gb:AE017340_457746 Idiomarina loihiensis L2TR, complete genome.
          Length = 480

 Score =  114 bits (285), Expect = 3e-24
 Identities = 76/233 (32%), Positives = 119/233 (51%), Gaps = 7/233 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELGG    +V +DADI+ AA  ++   F  +GQ C +   +LV +SVA+        
Sbjct: 247 LSLELGGNAPFLVFDDADIEQAAEQLIACKFRNAGQTCVSANRILVQQSVAEKFTDAVVS 306

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATF---CQPYKREGNLIW-P 515
                 VG   E++ D+ P++ + + + ++ LV  AK  GAT           G+L + P
Sbjct: 307 KVKALKVGPGTEENVDLGPLIDQDAVDKVQRLVLAAKSDGATIETGGSVMTELGDLFYAP 366

Query: 514 LLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILIS 335
            ++  V  +M I+ EE FGPV+ +    + EEGI   N + FGL      KD  +   +S
Sbjct: 367 TVITGVTEEMDISEEEIFGPVVAINTFETEEEGIEKANNTPFGLASYFAAKDTARIFRVS 426

Query: 334 DAMETGTVQINSAPARGPDHF--PFQGIKDSGIGSQGITNSINMMTKVKTTVI 182
           DA+E G V +N+    G  H   PF GIK+SG+G +G    I+   ++KT  +
Sbjct: 427 DALEYGMVGVNTG---GISHAYNPFGGIKESGVGREGSKYGIDEYLELKTVTL 476



>gb:AE017333_446206 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856021 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 488

 Score =  114 bits (285), Expect = 3e-24
 Identities = 70/234 (29%), Positives = 118/234 (50%), Gaps = 9/234 (3%)
 Frame = -2

Query: 856 QMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXX 677
           Q+E+GGK+  IV +DAD+D+A   V+ G F  +GQ+CTA   V+V+  V D         
Sbjct: 253 QLEMGGKNPVIVADDADLDIAVEAVISGAFRSTGQKCTATSRVIVLNGVYDRFKEKLLQQ 312

Query: 676 XXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNLI 521
                +G + ++D  + P+ ++   +     +   K++GA      +R        G  I
Sbjct: 313 TKEITIGDSLKEDVWMGPIANKQQLDNCLSYIAKGKQEGADLIFGGERLADGKYENGYYI 372

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P + D+V   M IA EE FGPV+ +I+ +++EE +   N   FGL   +FT++I + + 
Sbjct: 373 RPAIFDNVTSGMTIAQEEIFGPVIALIKADTLEEALETANDVKFGLSASIFTQNIRRMLS 432

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSI-NMMTKVKTTVI 182
            +D +E G +++N+  A      PF G+K S   S+    +     T VKT  +
Sbjct: 433 FTDEIEAGLIRVNAESAGVELQAPFGGVKQSSSHSREQGEAAKEFFTAVKTVFV 486



>gb:CR543861_102568 Acinetobacter sp. ADP1 complete genome.
          Length = 546

 Score =  114 bits (285), Expect = 3e-24
 Identities = 80/246 (32%), Positives = 120/246 (48%), Gaps = 10/246 (4%)
 Frame = -2

Query: 847  LGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXXXX 668
            L  K+A I+L DAD+DL     + G  S++GQRCTA+K+++V  S+AD            
Sbjct: 292  LDAKNAAIILPDADLDLTVKECLLGALSFNGQRCTALKMLMVHRSIADEFAQRLTTELGK 351

Query: 667  XXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKRE--GNLIWPLLLDHV 497
              VG P E    ITP+       ++  ++ DA+ KGA    P   E    + +P ++  V
Sbjct: 352  LKVGMPWEPGVFITPLPGMHRTAYMTEVIEDAEAKGAKVINPEGGEHCKTMFYPAVVYPV 411

Query: 496  RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM--E 323
              +MR+  EE FGPV+P+   + VE  + +   S+ G Q  +F  D  +   + D +  +
Sbjct: 412  TEEMRLYREEQFGPVVPICVYDDVETVLDYVTTSDHGQQVSIFGSDPEQIGHLVDPLVHQ 471

Query: 322  TGTVQINSAPARGPDHFPFQGIKDSGIGSQGITN-----SINMMTKVKTTVINLPTPSYT 158
               V INS   RGPD FPF G KDS  G+  + +     SI  M   K T  N    +  
Sbjct: 472  VCRVNINSQCQRGPDVFPFGGRKDSAEGTLSVHDALRAFSIRSMIATKQTDDNKGMLASM 531

Query: 157  MG*HYA 140
            +  HY+
Sbjct: 532  VSEHYS 537



>sp|P27463|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>pir|S14629|S14629 aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) 1, cytosolic - chicken>gb:GGADHR_2572902 Gallus
           gallus mRNA for aldehyde dehydrogenase 1 (aldh1 gene).
          Length = 509

 Score =  114 bits (285), Expect = 3e-24
 Identities = 78/231 (33%), Positives = 112/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I+  DAD+D AA     G F + GQ C A   + V E + D          
Sbjct: 276 LELGGKSPNIIFADADLDEAAEFAHIGLFYHQGQCCIAGSRIFVEEPIYDEFVRRSIERA 335

Query: 673 XXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATF-CQ--PYKREGNLIWPLLL 506
               +G P        P + +     I  L+   K++GA   C   P+  +G  I P + 
Sbjct: 336 KKYTLGDPLLPGVQQGPQIDKEQFQKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVF 395

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  DMRIA EE FGPV  +++  +++E I   N + +GL   VFTKDI+KA+  + A+
Sbjct: 396 SNVTDDMRIAKEEIFGPVQQIMKFKTIDEVIKRANNTTYGLAAAVFTKDIDKALTFASAL 455

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N   A      PF G K SG G +     +   T+VKT  I +P
Sbjct: 456 QAGTVWVNCYSAFSA-QCPFGGFKMSGNGRELGEYGLQEYTEVKTVTIKIP 505



>gb:BX571965_791439 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 486

 Score =  114 bits (284), Expect = 3e-24
 Identities = 71/226 (31%), Positives = 109/226 (48%), Gaps = 4/226 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L +ELGG    IV +DAD+D A    +   +  +GQ C       V E V D        
Sbjct: 256 LTLELGGNAPFIVFDDADLDAAVEGAIASKYRNNGQTCVCTNRFFVHERVYDAFADKLAA 315

Query: 679 XXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREG---NLIWPL 512
                 VG   E    + P+++E++   +E  + DA  KGA+     KR         P 
Sbjct: 316 AVSKLKVGRGTESGATLGPLINEAAVKKVESHIADALAKGASLMTGGKRHALGHGFFEPT 375

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +L  V+PDM +A EE FGP+ P+ R  S EE +   N + FGL   ++++DI +   +++
Sbjct: 376 VLTGVKPDMDVAKEETFGPLAPLFRFASEEELVRLANDTEFGLAAYLYSRDIGRVWRVAE 435

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           A+E G V IN+      +  PF G+K SG+G +G    I+    +K
Sbjct: 436 ALEYGMVGINTGLISN-EVAPFGGVKQSGLGREGSHYGIDDYVVIK 480



>gb:BA000028_697256 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 507

 Score =  114 bits (284), Expect = 3e-24
 Identities = 79/242 (32%), Positives = 118/242 (48%), Gaps = 6/242 (2%)
 Frame = -2

Query: 901 TGIAIXKKSG-AWXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG  I +    A     MELGGK   IV EDAD++ A      G FS++G+RCTA   + 
Sbjct: 251 TGSTIMRNGADALKRFSMELGGKSPIIVFEDADLERALDAATWGIFSFNGERCTANSRLY 310

Query: 724 VMESVADXXXXXXXXXXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           + ES+AD              VG P E++  I P++     N ++  +  A+E+G     
Sbjct: 311 LHESIADEFIEKLKQRVWNIRVGDPLENNTQIGPLIKTEHYNNVKKYLKIAEEEGCEIIS 370

Query: 547 PY----KREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQ 380
                    GN + P +L +   +MR+  EE FGPV+ V+  N   E I   N   +GL 
Sbjct: 371 GVIPKELNRGNYVAPTILLNASNEMRVVQEEIFGPVIAVMTFNDETEVIEKANDVRYGLA 430

Query: 379 GCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTK 200
           G V+T D+ +   ++ A+++G + +NS   R     PF G KDSGIG +G   +    T+
Sbjct: 431 GYVWTNDMKRGHRVAHAIDSGMLWVNSQNVRDL-RTPFGGSKDSGIGREGGHYAFEFYTE 489

Query: 199 VK 194
            K
Sbjct: 490 QK 491



>gb:CR378680_98479 Photobacterium profundum SS9 chromosome 2;
           segment 6/7.
          Length = 446

 Score =  114 bits (284), Expect = 3e-24
 Identities = 72/225 (32%), Positives = 118/225 (52%), Gaps = 3/225 (1%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           L MELGGKD  IV+ DA+++ AA+  V G F  SGQ CT+++ + V E +AD        
Sbjct: 222 LVMELGGKDPMIVMRDANLEQAASFAVAGSFENSGQMCTSIERIYVDERIADKFEQRVTE 281

Query: 679 XXXXXXVGA-PEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKRE-GNLIWPLLL 506
                 +G   + + +I P+++ +    I   + DA++KGA+      ++    I P ++
Sbjct: 282 IANMYQIGPWDQPNVNIGPIINATQHAKIVDQIKDAEQKGASILLGGSQQPERYIRPTVI 341

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL-ISDA 329
             + P+M+I  EE FGP++ + R  +++E I   NAS +GL   VF    N+ +  ++D 
Sbjct: 342 TGMTPEMKIETEETFGPIVAISRYQAIDEAIKRANASEYGLGAVVFG---NQGVQGVADE 398

Query: 328 METGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
           ++ G V IN     G D  P+ G K SG+G  G  +      +VK
Sbjct: 399 LDAGMVGINQGQGGGGD-APWVGAKQSGLGFHGSVDGHRQFAQVK 442



>pir|T50272|T50272 probable aldehyde dehydrogenase [imported] -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC922_1718469 S.pombe chromosome I cosmid
           c922.
          Length = 496

 Score =  114 bits (284), Expect = 3e-24
 Identities = 79/231 (34%), Positives = 115/231 (49%), Gaps = 6/231 (2%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +E GGK   +V EDAD+D A      G    SGQ CT+   + V +SV D          
Sbjct: 262 LECGGKSPFLVFEDADLDQAVKWAALGIMYNSGQICTSNSRIYVQDSVYDKFIELFKKHV 321

Query: 673 XXXXV-GAPEDDCDIT-PVVSESSANFIEGLVTDAKEKGATFC---QPYK-REGNLIWPL 512
               + G P DD  +  PVV+++  N I+  +   K++GA      +P   ++G  I P 
Sbjct: 322 IQDYIVGMPFDDNTVVGPVVNKTQYNRIKNYIEQGKKEGAKLVLGDEPLPLKQGYFISPT 381

Query: 511 LLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISD 332
           +      +M I  EE FGPV+ + +  + +E I   N + +GL    FTKD+ +A  +SD
Sbjct: 382 IFADCSENMTIVKEEIFGPVVAISKFKTEDEAIEKANNTTYGLAAMCFTKDLERAHRVSD 441

Query: 331 AMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            +E G V INS         PF GIK SGIG++  +N I M T++K   IN
Sbjct: 442 ELEAGMVFINST-ENSDIQAPFGGIKMSGIGNELGSNGIEMYTQIKAVHIN 491



>gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from
           clone DKFZp459D157).
          Length = 517

 Score =  113 bits (283), Expect = 4e-24
 Identities = 77/231 (33%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE I   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKMEEVIERANTTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>gb:BA000035_716370 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 540

 Score =  113 bits (283), Expect = 4e-24
 Identities = 79/231 (34%), Positives = 108/231 (46%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG    I+ EDAD+DLA    +       G+ CTA    LV +S+A           
Sbjct: 307 MELGGNAPFIIFEDADLDLAVEGAMGAKMRNIGEACTAANRFLVHDSIAQDFSRRLAERF 366

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQ---PYKREGNLIWPLLL 506
               +G   DD   + P+V   +   +  LV DA  +GAT        + EG    P +L
Sbjct: 367 NQLTLGNGLDDGVTVGPLVEAKARENVAKLVDDAVTEGATVLTGGTAGEGEGYFYQPTVL 426

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V P  RI  EE FGPV P+I   + EE I   N + +GL   +FT+D  +   ISD +
Sbjct: 427 VDVAPGARILTEEIFGPVAPIITFTTEEEAIQLANDTEYGLASYLFTRDYARMFRISDQL 486

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           E G +  NS         PF G+K SGIG +G T  I+  T+++   I  P
Sbjct: 487 EFGLLGFNSGVISNA-AAPFGGVKQSGIGREGGTEGIDEYTQLQYIGIRDP 536



>gb:AY596297_633304 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 489

 Score =  113 bits (283), Expect = 4e-24
 Identities = 66/206 (32%), Positives = 100/206 (48%), Gaps = 1/206 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG    +V EDADI+ AA     G F + GQ C ++   LV E V D          
Sbjct: 255 LELGGNGPFVVTEDADIEAAAKAGSVGAFGHQGQVCISINRHLVHEDVYDEYVEKLVEHA 314

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
               +G P ++D +  P+++ES    +   +    + GAT     + E   + P +L   
Sbjct: 315 ESLTIGNPLDEDVEFGPIINESQVEQLTSFIEQTVDAGATLETGGEVEDLFLEPTVLSEC 374

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
             DM  A  E FGPV PVI   S EE +   N + +GL   V++ D+     I+D ++ G
Sbjct: 375 TNDMSAACNEHFGPVAPVIPFESDEEAVELANDTEYGLAAGVYSSDVEHGRSIADQIDAG 434

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIG 239
            V +N  P +   + PF G+K+SG+G
Sbjct: 435 MVHVNDHPIQDEPNAPFGGMKNSGLG 460



>gb:AE017271_423540 Bacillus cereus ATCC 10987, section 8 of 18 of
           the complete genome.>gb:AE017194_1061959 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 474

 Score =  113 bits (283), Expect = 4e-24
 Identities = 76/242 (31%), Positives = 120/242 (49%), Gaps = 3/242 (1%)
 Frame = -2

Query: 898 GIAIXKKSGAWXPLQMELGGKDACIVLEDADI-DLAAANVVKGGFSYSGQRCTAVKVVLV 722
           G+ I  K+G    + +ELG   A I+ ED ++ D     V  G F  +GQ C +V+ V V
Sbjct: 232 GLGIKAKAGL-KRVTLELGSNAAVIIDEDVELTDELIERVKWGAFVNNGQVCISVQRVFV 290

Query: 721 MESVADXXXXXXXXXXXXXXVGAPE-DDCDITPVVSESSANFIEGLVTDAKEKGATFCQP 545
            E   D              VG P  ++ D++ ++S+     I+  V +A ++GA+    
Sbjct: 291 HEERMDEFLSKLQKAMETVVVGDPLLEETDVSALISKKDVERIDNWVQEAVKEGASVLYG 350

Query: 544 -YKREGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVF 368
             KR+  +  P +L +V   + +  +E FGP++ V      +E I   N S +GLQ  VF
Sbjct: 351 GNKRDERIFKPTVLTNVPEHVSVQCQEVFGPLMTVNTFKEFDEAIEQVNHSRYGLQAGVF 410

Query: 367 TKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTT 188
           T ++ K +   D +E G V IN  P    DH P+ G+K+SG G +GI  +I  MT++K  
Sbjct: 411 TNNLFKVMRAIDELEVGGVMINDIPTFRVDHMPYGGVKESGTGREGIKYAIEEMTEMKLV 470

Query: 187 VI 182
            I
Sbjct: 471 CI 472



>pir|C69814|C69814 benzaldehyde dehydrogenase homolog yfmT -
           Bacillus subtilis>gb:D86418_120830 Bacillus subtilis
           genomic DNA 69-70 degree region, partial
           sequence.>gb:BSUB0004_752700 Bacillus subtilis complete
           genome (section 4 of 21): from 611631 to 813719.
          Length = 485

 Score =  113 bits (283), Expect = 4e-24
 Identities = 72/221 (32%), Positives = 108/221 (48%), Gaps = 1/221 (0%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGG  A IVLEDADI+ A    V   F++ GQ C +   VLV  S+ D          
Sbjct: 252 LELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIYDKFLELYQAKV 311

Query: 673 XXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLDHV 497
               VG P D D  I P+++    + +   V  A E+GA   +     G ++ P +L  V
Sbjct: 312 ESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNGTIVEPTILKDV 371

Query: 496 RPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAMETG 317
           +P M IA EE FGPV+  ++ +S +E +   N + FGL G V T ++ + +  +  +ETG
Sbjct: 372 KPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLERGVAFAKRIETG 431

Query: 316 TVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVK 194
            + +N        +  F G K SG+G      S+   T +K
Sbjct: 432 MIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLK 472



>pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB,
           cytosolic - rat>gb:RATALDH_2131446 Rat aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  113 bits (283), Expect = 4e-24
 Identities = 76/230 (33%), Positives = 112/230 (48%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 268 LELGGKSPCIVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERA 327

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P D      P + +     I  L+   K++GA       R GN    + P + 
Sbjct: 328 KKYVLGNPLDSGISQGPQIDKEQHAKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S++E I   N + +GL   VFTKD+++AI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +     +   T++KT  + +
Sbjct: 448 QAGTVWVNCYLTLSV-QCPFGGFKMSGNGREMGEQGVYEYTELKTVAMKI 496



>sp|P08157|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>pir|A29055|A29055 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) - Emericella nidulans>gb:EMEALDA_1676593
           A.nidulans aldA gene encoding aldehyde dehydrogenase,
           complete cds.
          Length = 497

 Score =  113 bits (283), Expect = 4e-24
 Identities = 81/225 (36%), Positives = 113/225 (50%), Gaps = 4/225 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IV +DADID A +    G F   GQ C A   +LV E + D          
Sbjct: 263 LELGGKSPNIVFDDADIDNAISWANFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERA 322

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               VG P E D    P VS+   + I   +   K+ GAT      R GN    I P + 
Sbjct: 323 QKNKVGNPFEQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVF 382

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  DM+IA EE FGPV+ + +   V E I   N++++GL   V TK++N AI +S+A+
Sbjct: 383 TDVTSDMKIAQEEIFGPVVTIQKFKDVAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNAL 442

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
           + GTV IN+         PF G K SG+G +  + ++   T++KT
Sbjct: 443 KAGTVWINNYNMIS-YQAPFGGFKQSGLGRELGSYALENYTQIKT 486



>sp|P13601|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1.3)
           (ALDH class 1) (ALHDII) (ALDH-E1).
          Length = 500

 Score =  113 bits (283), Expect = 4e-24
 Identities = 76/230 (33%), Positives = 112/230 (48%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D A     +G F + GQ C A   + V ES+ D          
Sbjct: 267 LELGGKSPCIVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERA 326

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P D      P + +     I  L+   K++GA       R GN    + P + 
Sbjct: 327 KKYVLGNPLDSGISQGPQIDKEQHAKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 386

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S++E I   N + +GL   VFTKD+++AI +S A+
Sbjct: 387 SNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSAL 446

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + GTV +N          PF G K SG G +     +   T++KT  + +
Sbjct: 447 QAGTVWVNCYLTLSV-QCPFGGFKMSGNGREMGEQGVYEYTELKTVAMKI 495



>gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, partial cds.
          Length = 518

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE +   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family,
           member B1, mRNA (cDNA clone MGC:2230 IMAGE:3356389),
           complete cds.>gb:BT007418_1990856 Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, complete cds.
          Length = 517

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE +   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on
           chromosome 9p11-13.3 Contains a novel gene, possible
           ortholog of mouse insulin-like growth factor binding
           protein 7 (IGFBP7), a novel gene similar to aldehyde
           dehydrogenase 1 family, member B1 (ALDH5, ALDHX,
           MGC2230) (ALDH1B1), a novel gene and four CpG islands,
           complete sequence.
          Length = 517

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE +   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>gb:AX064887_1459357 Sequence 13 from Patent WO0100844.
          Length = 490

 Score =  113 bits (282), Expect = 6e-24
 Identities = 79/231 (34%), Positives = 108/231 (46%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG    IV EDAD+DLA    +       G+ CTA    LV ESVAD          
Sbjct: 258 MELGGNAPFIVFEDADLDLAIEGAMGAKMRNIGEACTAANRFLVHESVADEFGRRFAARL 317

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR---EGNLIWPLLL 506
               +G   D+   + P+V E + + +  LV  A  +GAT     K     G    P +L
Sbjct: 318 EEQVLGNGLDEGVTVGPLVEEKARDSVASLVDAAVAEGATVLTGGKAGTGAGYFYEPTVL 377

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  D  I  EE FGPV P++   + EE +   N++ +GL   VFT+D ++   +SD +
Sbjct: 378 TGVSTDAAILNEEIFGPVAPIVTFQTEEEALRLANSTEYGLASYVFTQDTSRIFRVSDGL 437

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           E G V +NS         PF G+K SG+G +G    I   T V+   I  P
Sbjct: 438 EFGLVGVNSGVISNA-AAPFGGVKQSGMGREGGLEGIEEYTSVQYIGIRDP 487



>gb:BX571856_782112 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 496

 Score =  113 bits (282), Expect = 6e-24
 Identities = 75/217 (34%), Positives = 110/217 (50%), Gaps = 8/217 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+  I+ +DAD +LA    + GG+ ++GQ C+A   +LV  S+ D        
Sbjct: 252 IALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALID 311

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 +G   D D ++ PV+S    N IE  +  AK +GAT     KR       +G  
Sbjct: 312 RVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLKDGLF 371

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P ++ +    MRI  EE FGPV+ V    + +E I   N S +GL G VF+KDI KA 
Sbjct: 372 FEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQ 431

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
            +++ ++ GTV IN          P+ G K SGIG +
Sbjct: 432 RVANKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRE 467



>gb:BA000036_717777 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927148_831640 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 1/10.
          Length = 490

 Score =  113 bits (282), Expect = 6e-24
 Identities = 79/231 (34%), Positives = 108/231 (46%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           MELGG    IV EDAD+DLA    +       G+ CTA    LV ESVAD          
Sbjct: 258 MELGGNAPFIVFEDADLDLAIEGAMGAKMRNIGEACTAANRFLVHESVADEFGRRFAARL 317

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR---EGNLIWPLLL 506
               +G   D+   + P+V E + + +  LV  A  +GAT     K     G    P +L
Sbjct: 318 EEQVLGNGLDEGVTVGPLVEEKARDSVASLVDAAVAEGATVLTGGKAGTGAGYFYEPTVL 377

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  D  I  EE FGPV P++   + EE +   N++ +GL   VFT+D ++   +SD +
Sbjct: 378 TGVSTDAAILNEEIFGPVAPIVTFQTEEEALRLANSTEYGLASYVFTQDTSRIFRVSDGL 437

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           E G V +NS         PF G+K SG+G +G    I   T V+   I  P
Sbjct: 438 EFGLVGVNSGVISNA-AAPFGGVKQSGMGREGGLEGIEEYTSVQYIGIRDP 487



>gb:AP006627_565332 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 487

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/232 (32%), Positives = 113/232 (48%), Gaps = 9/232 (3%)
 Frame = -2

Query: 901 TGIAIXKKSGA-WXPLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVL 725
           TG  I K + A     Q+E+GGK+  IV EDAD+ +A    + G F  +GQ+CTA   V+
Sbjct: 235 TGKQIGKAAAARGAKYQLEMGGKNPVIVAEDADLHVAVDATISGAFRSTGQKCTATSRVI 294

Query: 724 VMESVADXXXXXXXXXXXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQ 548
           V E++                +G A +D   + P  SE+    +   +   K++GA    
Sbjct: 295 VAEAILQDFQELLLEKTKQITIGKALDDGVWMGPCASEAQLRTVLDYIEIGKKEGAKLLC 354

Query: 547 PYKR-------EGNLIWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNF 389
             KR        G  + P +  +V   MRIA EE FGPV+ +I   ++EE I   N S +
Sbjct: 355 GGKRVTDGNRAAGYFVEPTIFTNVNRHMRIAQEEIFGPVIALITAKNMEEAIEIANDSRY 414

Query: 388 GLQGCVFTKDINKAILISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
           GL   +FT +I K +L  D M+ G V++N+  A      PF G+K S   S+
Sbjct: 415 GLSASIFTTNIEKMLLFIDEMDAGLVRVNAESAGVELQAPFGGMKASSSHSR 466



>gb:AE016794_334751 Pseudomonas putida KT2440 section 21 of 21 of
           the complete genome.>gb:AE015451_949828 Pseudomonas
           putida KT2440 complete genome.
          Length = 481

 Score =  113 bits (282), Expect = 6e-24
 Identities = 78/233 (33%), Positives = 116/233 (49%), Gaps = 4/233 (1%)
 Frame = -2

Query: 862 PLQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXX 683
           P  MELGGK A +V  DAD +   ++V  G F  +GQ C+A+  +LV  S+ D       
Sbjct: 247 PSVMELGGKSAALVFPDADREQLISSVKSGIFFNAGQVCSAMSRLLVHRSIYDEVVADVV 306

Query: 682 XXXXXXXVGAPEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR----EGNLIWP 515
                  VG  +D+ D TPV+S +    IE L   A+++GA      +      G+ + P
Sbjct: 307 AMAEGLTVGLGQDNPDHTPVISAAQLEGIEALCRRAQQQGAVVATGGEAISGLSGHYMAP 366

Query: 514 LLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILIS 335
            +L  V   M IA  E FGPVL VI  +S EE +   N + FGL   VFT+D+N+A+  +
Sbjct: 367 TVLRDVTAQMEIAQTEVFGPVLAVIPFDSEEEALAIANGTVFGLVAGVFTQDLNRALRCA 426

Query: 334 DAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
             + TG V +N   A G +  PF G+  SG G +    ++    + K   + +
Sbjct: 427 RRLCTGQVFVNEWYAGGIE-TPFGGVGLSGFGREKGQEALYSYVRTKNLAVRI 478



>gb:CP000046_92696 Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:SAU131754_171980 Staphylococcus aureus ORF1
           (partial), ORF2, ORF3, ORF4 and ORF5
           (partial).>gb:BA000033_712824 Staphylococcus aureus
           subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571857_784734 Staphylococcus aureus
           strain MSSA476, complete genome.
          Length = 496

 Score =  113 bits (282), Expect = 6e-24
 Identities = 75/217 (34%), Positives = 110/217 (50%), Gaps = 8/217 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+  I+ +DAD +LA    + GG+ ++GQ C+A   +LV  S+ D        
Sbjct: 252 IALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALID 311

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 +G   D D ++ PV+S    N IE  +  AK +GAT     KR       +G  
Sbjct: 312 RVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLKDGLF 371

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P ++ +    MRI  EE FGPV+ V    + +E I   N S +GL G VF+KDI KA 
Sbjct: 372 FEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQ 431

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
            +++ ++ GTV IN          P+ G K SGIG +
Sbjct: 432 RVANKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRE 467



>pir|E90068|E90068 glycine betaine aldehyde dehydrogenase gbsA
           [imported] - Staphylococcus aureus (strain
           N315)>gb:BA000017_678298 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680892
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.
          Length = 496

 Score =  113 bits (282), Expect = 6e-24
 Identities = 75/217 (34%), Positives = 110/217 (50%), Gaps = 8/217 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK+  I+ +DAD +LA    + GG+ ++GQ C+A   +LV  S+ D        
Sbjct: 252 IALELGGKNPNIIFDDADFELAVDQALNGGYFHAGQVCSAGSRILVQNSIKDKFEQALID 311

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 +G   D D ++ PV+S    N IE  +  AK +GAT     KR       +G  
Sbjct: 312 RVKKIKLGNGFDADTEMGPVISTEHRNKIESYMDVAKAEGATIAVGGKRPDRDDLKDGLF 371

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P ++ +    MRI  EE FGPV+ V    + +E I   N S +GL G VF+KDI KA 
Sbjct: 372 FEPTVITNCDTSMRIVQEEVFGPVVTVEGFETEQEAIQLANDSIYGLAGAVFSKDIGKAQ 431

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQ 233
            +++ ++ GTV IN          P+ G K SGIG +
Sbjct: 432 RVANKLKLGTVWINDFHPYFA-QAPWGGYKQSGIGRE 467



>pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5
           precursor, mitochondrial - human
          Length = 517

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE +   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>sp|P30837|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class
           2).>gb:HUMMTALD_2034921 Human mitochondrial aldehyde
           dehydrogenase x gene, complete cds.
          Length = 517

 Score =  113 bits (282), Expect = 6e-24
 Identities = 76/231 (32%), Positives = 113/231 (48%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IVL DAD++ A     +  F   GQ C A     V ES+ +          
Sbjct: 284 LELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKA 343

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P E D    P V +     + G +   +++GA      + +   G  I P + 
Sbjct: 344 KQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+ DMRIA EE FGPV P+ +   +EE +   N + +GL   VFT+D++KA+  + A+
Sbjct: 404 GGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV +N+       H PF G K+SG G +   + +   T+VKT  I +P
Sbjct: 464 QAGTVWVNTYNI-VTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVP 513



>sp|P42236|DHA1_BACSU Probable aldehyde dehydrogenase ycbD (EC
           1.2.1.3).>pir|G69752|G69752 aldehyde dehydrogenase
           homolog ycbD - Bacillus subtilis>gb:BACYCB20_746721
           Bacillus subtilis DNA around 20 degrees region of
           chromosome containing yckA-T genes.>gb:BSUB0002_752212
           Bacillus subtilis complete genome (section 2 of 21):
           from 213031 to 415798.
          Length = 488

 Score =  113 bits (282), Expect = 6e-24
 Identities = 68/234 (29%), Positives = 122/234 (52%), Gaps = 9/234 (3%)
 Frame = -2

Query: 856 QMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXX 677
           Q+E+GGK+  IV +DAD++ AA  V+ G F  +GQ+CTA   V+V   + +         
Sbjct: 253 QLEMGGKNPVIVADDADLEAAAEAVITGAFRSTGQKCTATSRVIVQSGIYERFKEKLLQR 312

Query: 676 XXXXXVG-APEDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNLI 521
                +G + ++D  + P+ S++  +     +   K++GA+     ++        G  +
Sbjct: 313 TKDITIGDSLKEDVWMGPIASKNQLDNCLSYIEKGKQEGASLLIGGEKLENGKYQNGYYV 372

Query: 520 WPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAIL 341
            P + D+V  +M IA EE FGPV+ +I+++S+EE ++  N   FGL   +FT++I + + 
Sbjct: 373 QPAIFDNVTSEMTIAQEEIFGPVIALIKVDSIEEALNIANDVKFGLSASIFTENIGRMLS 432

Query: 340 ISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSI-NMMTKVKTTVI 182
             D ++ G V+IN+  A      PF G+K S   S+    +  +  T +KT  +
Sbjct: 433 FIDEIDAGLVRINAESAGVELQAPFGGMKQSSSHSREQGEAAKDFFTAIKTVFV 486



>gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c,
           livers, mRNA Partial, 1632 nt].
          Length = 501

 Score =  112 bits (281), Expect = 7e-24
 Identities = 75/230 (32%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D+A      G F + GQ C A   + V ESV D          
Sbjct: 268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   + I  L+   K++GA       R GN    + P + 
Sbjct: 328 KKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  SV++ I   N + +GL   +FTKD++KAI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N          PF G K SG G +   + +   T++KT  + +
Sbjct: 448 QAGVVWVNCYMMLSA-QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496



>gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA,
           complete cds.
          Length = 517

 Score =  112 bits (281), Expect = 7e-24
 Identities = 78/231 (33%), Positives = 109/231 (47%), Gaps = 4/231 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   I++ DAD+D A        F   GQ C A     V E+V D          
Sbjct: 284 LELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVAGA 343

Query: 673 XXXXVGAPEDD-CDITPVVSESSANFIEGLVTDAKEKGATFC---QPYKREGNLIWPLLL 506
               VG P D   +  P V E+  N I G +   +++GA            G  I P + 
Sbjct: 344 KSRVVGNPFDSRTEQGPQVDETQFNKILGYIKMGQQEGAKLLCGGGAAADRGYFIQPTVF 403

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V+  M IA EE FGPV+ +++  ++EE +   N S +GL   VFTKD++KA  +S A+
Sbjct: 404 GDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQAL 463

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLP 173
           + GTV IN     G    PF G K SG G +     +   T+VKT  + +P
Sbjct: 464 QAGTVWINCYVVFGAQS-PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVP 513



>gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone MGC:62611 IMAGE:6477503),
           complete cds.
          Length = 501

 Score =  112 bits (281), Expect = 7e-24
 Identities = 75/230 (32%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D+A      G F + GQ C A   + V ESV D          
Sbjct: 268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   + I  L+   K++GA       R GN    + P + 
Sbjct: 328 KKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  SV++ I   N + +GL   +FTKD++KAI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N          PF G K SG G +   + +   T++KT  + +
Sbjct: 448 QAGVVWVNCYMMLSA-QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496



>gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone IMAGE:5098781), partial
           cds.
          Length = 511

 Score =  112 bits (281), Expect = 7e-24
 Identities = 75/230 (32%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D+A      G F + GQ C A   + V ESV D          
Sbjct: 278 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERA 337

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   + I  L+   K++GA       R GN    + P + 
Sbjct: 338 KKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 397

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  SV++ I   N + +GL   +FTKD++KAI +S A+
Sbjct: 398 SNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSAL 457

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N          PF G K SG G +   + +   T++KT  + +
Sbjct: 458 QAGVVWVNCYMMLSA-QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 506



>gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase
           ALDH15 (aldA) gene, aldA15 allele, complete cds.
          Length = 497

 Score =  112 bits (281), Expect = 7e-24
 Identities = 81/225 (36%), Positives = 113/225 (50%), Gaps = 4/225 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK   IV +DADID A + V  G F   GQ C A   +LV E + D          
Sbjct: 263 LELGGKSPNIVFDDADIDNAISWVNFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERA 322

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               VG P E D    P VS+   + I   +   K+ GAT      R GN    I P + 
Sbjct: 323 QKNKVGNPFEQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVF 382

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
             V  DM+IA EE FGPV+ + +     E I   N++++GL   V TK++N AI +S+A+
Sbjct: 383 TDVTSDMKIAQEEIFGPVVTIQKFKDEAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNAL 442

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKT 191
           + GTV IN+         PF G K SG+G +  + ++   T++KT
Sbjct: 443 KAGTVWINNYNMIS-YQAPFGGFKQSGLGRELGSYALENYTQIKT 486



>gb:CP000009_863696 Gluconobacter oxydans 621H, complete genome.
          Length = 480

 Score =  112 bits (281), Expect = 7e-24
 Identities = 75/235 (31%), Positives = 112/235 (47%), Gaps = 8/235 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           +++ELGGK   +V+EDADID AA   V   F+ +GQ CT  +   + E+V D        
Sbjct: 246 VRLELGGKAPFMVMEDADIDRAADAAVTARFNNAGQVCTCNERTYIHEAVYDRFVQKVRE 305

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 VG P D   D+ P VSE   N +  +V  A  +GA      KR       +G  
Sbjct: 306 KIEALKVGLPTDPSTDMGPKVSEDELNKVHEMVEHAVRQGARLAIGGKRLTGGVYDKGYF 365

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P LL  V  DM I   E FGPV+ +IR+   ++ I   N   +GL   +FT D+++ +
Sbjct: 366 YAPTLLTDVTQDMDIVHNEVFGPVMSLIRVKDFDQAIAWANDCRYGLSAYLFTNDLSRIL 425

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVIN 179
            ++  +E G V +N      P  F   G K+SG+G +   + +    + KT  +N
Sbjct: 426 RMTRDLEFGEVYVNRPGGEAPQGF-HHGYKESGLGGEDGQHGMEAYVQTKTIYLN 479



>gb:AP008226_578453 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 475

 Score =  112 bits (281), Expect = 7e-24
 Identities = 67/211 (31%), Positives = 104/211 (49%), Gaps = 1/211 (0%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGG    +V  DAD+D A    ++  F  +G+ C A   + V   VA+        
Sbjct: 248 VSLELGGGAPVLVFADADLDRAVEETLRAKFRNAGESCVAANRIFVQAEVAEAFAEAYAR 307

Query: 679 XXXXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGNLIWPLLLD 503
                 VG P  ++ DI P+V+E++   +   V DA  KGA      + +G    P +L 
Sbjct: 308 RVQALKVGDPLSEETDIGPLVNEAALRKVRTHVEDALAKGARLVAGGEAKGLFFAPTVLL 367

Query: 502 HVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAME 323
            V+P+  +  EE FGPV P+      EE +   N    GL   VFT+D+++A  +++A+E
Sbjct: 368 DVKPESLLFREETFGPVAPLTVFREEEEAVRWANGFPVGLAAYVFTRDLSRAFRVAEALE 427

Query: 322 TGTVQINSAPARGPDHFPFQGIKDSGIGSQG 230
            G V +N      P   PF G+K SG+G +G
Sbjct: 428 YGIVGVNDGVPSTP-QAPFGGVKRSGLGREG 457



>gb:AF339846_502835 Microscilla sp. PRE1 plasmid pSD15, complete
           sequence.
          Length = 486

 Score =  112 bits (281), Expect = 7e-24
 Identities = 78/235 (33%), Positives = 112/235 (47%), Gaps = 9/235 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           +Q+ELGGK  CIV +DAD++ A        F   GQ CT+ + + V ES+ +        
Sbjct: 250 VQLELGGKAPCIVFDDADLEQAVEGAFHSRFDNCGQVCTSNERLYVHESIYNEFMERFME 309

Query: 679 XXXXXXVGAPEDDCD-ITPVVSESSANFIEGLVTDAKEKGATFCQPYKR-------EGNL 524
                 +G P D    I P V+      +E LVT + E+GAT     K+       +G+ 
Sbjct: 310 KVKGLKLGNPMDAATTIGPKVNAKEVAHMEHLVTKSVEEGATVAIGGKKPQGKAFEKGHW 369

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
             P +L  V+ +M I  EE FGP+LPVI+ +   E I + N   +GL   VFT D+NK +
Sbjct: 370 FEPTILTDVKQNMTIVHEESFGPILPVIKFSEFNEVIGYANDCEYGLAAMVFTNDMNKIM 429

Query: 343 LISDAMETGTVQINSAPARGPDHFPF-QGIKDSGIGSQGITNSINMMTKVKTTVI 182
            ++D +E G + IN     G  H  F  G K SG G +          + KT  I
Sbjct: 430 RLNDELEFGEIYINR--GHGEQHQGFHNGYKLSGTGGEDSKYGFEQYMEKKTFYI 482



>gb:AE017246_415135 Treponema denticola ATCC 35405, section 1 of 10
           of the complete genome.>gb:AE017226_1068731 Treponema
           denticola ATCC 35405, complete genome.
          Length = 494

 Score =  112 bits (281), Expect = 7e-24
 Identities = 76/239 (31%), Positives = 115/239 (48%), Gaps = 8/239 (3%)
 Frame = -2

Query: 859 LQMELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXX 680
           + +ELGGK   I  ED DI+ AA   V G  +++GQ C +   +LV   + +        
Sbjct: 255 IALELGGKSPNIFFEDVDIEQAARFAVYGFTNHAGQICVSGTRILVQRRIYEPFIKAMVE 314

Query: 679 XXXXXXVGAPED-DCDITPVVSESSANFIEGLVTDAKEKGAT-------FCQPYKREGNL 524
                  G   D    I  ++S   AN +   +   K++ A        + +P  ++GN 
Sbjct: 315 TAYKLKPGDGFDPSTTINTLISREHANTVWEYIEKGKKQNARLVCGGNPYSEPLLKKGNF 374

Query: 523 IWPLLLDHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAI 344
           I P +   V P+M I   E FGPV  +   ++ EE I   NA+ +GL G VFTKDI +AI
Sbjct: 375 IPPTIFADVTPEMEIFQNEIFGPVACITPFDTEEEAISLANATKYGLAGGVFTKDIKRAI 434

Query: 343 LISDAMETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINLPTP 167
            ++D + +G + IN+  ++G    P  G K+SGIG  GI   +   T    TV N+  P
Sbjct: 435 RVADRINSGQIYINNYFSKGMIESPGTGWKESGIGIAGIHKYMISKTVFVETVDNVLLP 493



>pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) -
           rat>gb:AF001896_2050051 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001897_2050052 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001898_2050053 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:BC061526_2104509 Rattus norvegicus aldehyde
           dehydrogenase family 1, member A1, mRNA (cDNA clone
           MGC:72648 IMAGE:6921926), complete
           cds.>gb:RNU79118_2137805 Rattus norvegicus aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  112 bits (281), Expect = 7e-24
 Identities = 74/230 (32%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D+A      G F + GQ C A   + V ESV D          
Sbjct: 268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   + I  L+   K++GA       R GN    + P + 
Sbjct: 328 KKYVLGNPLTQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKD+++AI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N          PF G K SG G +   + +   T++KT  + +
Sbjct: 448 QAGVVWVNCYMILSA-QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496



>pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -
           rat>gb:RATALDHA_2131447 Rattus rattus aldehyde
           dehydrogenase (ALDH) mRNA, complete cds.
          Length = 501

 Score =  112 bits (281), Expect = 7e-24
 Identities = 74/230 (32%), Positives = 113/230 (49%), Gaps = 4/230 (1%)
 Frame = -2

Query: 853 MELGGKDACIVLEDADIDLAAANVVKGGFSYSGQRCTAVKVVLVMESVADXXXXXXXXXX 674
           +ELGGK  CIV  DAD+D+A      G F + GQ C A   + V ESV D          
Sbjct: 268 LELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERA 327

Query: 673 XXXXVGAP-EDDCDITPVVSESSANFIEGLVTDAKEKGATFCQPYKREGN---LIWPLLL 506
               +G P     +  P + +   + I  L+   K++GA       R GN    + P + 
Sbjct: 328 KKYVLGNPLTQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVF 387

Query: 505 DHVRPDMRIAWEEPFGPVLPVIRINSVEEGIHHCNASNFGLQGCVFTKDINKAILISDAM 326
            +V  +MRIA EE FGPV  +++  S+++ I   N + +GL   VFTKD+++AI +S A+
Sbjct: 388 SNVTDEMRIAKEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSAL 447

Query: 325 ETGTVQINSAPARGPDHFPFQGIKDSGIGSQGITNSINMMTKVKTTVINL 176
           + G V +N          PF G K SG G +   + +   T++KT  + +
Sbjct: 448 QAGVVWVNCYMILSA-QCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKI 496


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 943,559,722
Number of Sequences: 1806583
Number of extensions: 19726358
Number of successful extensions: 60470
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 55966
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58067
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 62990696208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)