BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2343
         (606 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF356001_1790740 Craterostigma plantagineum PTP-1 mRNA, compl...    51   1e-05   
gb:AY028427_1559069 Craterostigma plantagineum plastid-targeted ...    51   1e-05   
gb:AY028426_1559068 Craterostigma plantagineum plastid-targeted ...    51   1e-05   
gb:AY028428_1559070 Craterostigma plantagineum plastid-targeted ...    50   2e-05   
gb:AC007197_1535540 Arabidopsis thaliana chromosome 2 clone T22C...    44   0.003   
pir|A84514|A84514 hypothetical protein At2g14090 [imported] - Ar...    37   0.33    Arabidopsis thaliana [mouse-ear cress]
gb:AP004213_1838874 Oryza sativa (japonica cultivar-group) genom...    36   0.43    
gb:AP005399_1851152 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:AE016819_1748778 Ashbya gossypii (= Eremothecium gossypii) AT...    34   2.1     
pir|T25157|T25157 hypothetical protein T23D5.9 - Caenorhabditis ...    33   3.7     Caenorhabditis elegans [roundworm]
gb:SCO939118_177703 Streptomyces coelicolor A3(2) complete genom...    32   6.2     


>gb:AF356001_1790740 Craterostigma plantagineum PTP-1 mRNA, complete
           cds.
          Length = 200

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 5/113 (4%)
 Frame = +2

Query: 278 LPFWPPSDNSWLGWAVGLGVSLPLV-----TAQLIALPKQXXXXXXXXXXXXXXXXXXXH 442
           LP  PP  +    W +G  VS+ +        +L  L  +                    
Sbjct: 71  LPSGPPPSSPPKNWIIGFIVSVIIPFFANKLGRLGFLLNRIENAVQQVEDIAEAVEEVAK 130

Query: 443 DVDKAAEDFKVKLPDGRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
             DK AE+    LP+G+LK++VE++E +AE  AKDA  +++++D+V+E  +++
Sbjct: 131 KADKIAEEIGHDLPEGKLKNLVEAVEDVAERVAKDADTLDNIIDQVQEAADQV 183



>gb:AY028427_1559069 Craterostigma plantagineum plastid-targeted
           protein 3 mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 200

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 5/113 (4%)
 Frame = +2

Query: 278 LPFWPPSDNSWLGWAVGLGVSLPLV-----TAQLIALPKQXXXXXXXXXXXXXXXXXXXH 442
           LP  PP  +    W +G  VS+ +        +L  L  +                    
Sbjct: 71  LPSGPPPSSPPKNWIIGFIVSVIIPFFANKLGRLGFLLNRIENTVQQVEDIAEAVEEVAK 130

Query: 443 DVDKAAEDFKVKLPDGRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
             DK AE+    LP+G+LK++VE++E +AE  AKDA  +++++D+V+E  +++
Sbjct: 131 KADKIAEEIGHDLPEGKLKNLVEAVEDVAERVAKDADTLDNIIDQVQEAADQV 183



>gb:AY028426_1559068 Craterostigma plantagineum plastid-targeted
           protein 2 mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 200

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 5/113 (4%)
 Frame = +2

Query: 278 LPFWPPSDNSWLGWAVGLGVSLPLV-----TAQLIALPKQXXXXXXXXXXXXXXXXXXXH 442
           LP  PP  +    W +G  VS+ +        +L  L  +                    
Sbjct: 71  LPSGPPPSSPPKNWIIGFIVSVIIPFFANKLGRLGFLLNRIENAVQQVEDIAEAVEEVAK 130

Query: 443 DVDKAAEDFKVKLPDGRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
             DK AE+    LP+G+LK++VE++E +AE  AKDA  +++++D+V+E  +++
Sbjct: 131 KADKIAEEIGHDLPEGKLKNLVEAVEDVAERVAKDADTLDNIIDQVQEAADQV 183



>gb:AY028428_1559070 Craterostigma plantagineum plastid-targeted
           protein 4 mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 200

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 5/113 (4%)
 Frame = +2

Query: 278 LPFWPPSDNSWLGWAVGLGVS--LPLVTAQLIA---LPKQXXXXXXXXXXXXXXXXXXXH 442
           LP  PP  +    W +G  VS  +P    +L     L  +                    
Sbjct: 71  LPSGPPPSSPPKNWIIGFIVSVIIPFFANKLGRFGFLLNRIENAVQQVEDIAEAVEEVAK 130

Query: 443 DVDKAAEDFKVKLPDGRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
             DK AE+    LP+G+LK++VE++E +AE  AKDA  +++++D+V+E  +++
Sbjct: 131 KADKIAEEIGHDLPEGKLKNLVEAVEDVAERIAKDADTLDNIIDQVQEAADQV 183



>gb:AC007197_1535540 Arabidopsis thaliana chromosome 2 clone T22C12
           map mi398, complete sequence.
          Length = 234

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 7/106 (6%)
 Frame = +2

Query: 305 SWLGWAVGLGVSLPLV------TAQLIALPKQXXXXXXXXXXXXXXXXXXXHDVDKAAED 466
           SW  W +G  +SL L         +L  +  +                      D+ AE+
Sbjct: 92  SWGRWVIGSAISLVLSFWNNERLQKLKRIEGEAELVVEGVEAVAEMVEKVATATDEMAEE 151

Query: 467 FKVKLPD-GRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
              KLP+  +LK +   +EH++E  A +AH+ +D + KVE+V + +
Sbjct: 152 MAEKLPEKNKLKQVALVLEHISEVAAHEAHLTQDFLHKVEKVTQDI 197



>pir|A84514|A84514 hypothetical protein At2g14090 [imported] -
           Arabidopsis thaliana
          Length = 406

 Score = 36.6 bits (83), Expect = 0.33
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +2

Query: 449 DKAAEDFKVKLPD-GRLKDIVESIEHLAEETAKDAHIVEDLMDK 577
           D+ AE+   KLP+  +LK +   +EH++E  A +AH+ +D + K
Sbjct: 28  DEMAEEMAEKLPEKNKLKQVALVLEHISEVAAHEAHLTQDFLHK 71



>gb:AP004213_1838874 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1111_H02.>gb:AP005918_1860100 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0419H09.
          Length = 191

 Score = 36.2 bits (82), Expect = 0.43
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +2

Query: 449 DKAAEDFKVKLPD-GRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
           +K A +    LP+ G L+ +VE IE++AE   +DA  VE + +K+E   +K+
Sbjct: 112 EKLASNVADHLPENGCLQKVVEKIEYIAEVVDEDAEKVEAITEKIENFSDKI 163



>gb:AP005399_1851152 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0676H02.>gb:AP005574_1854301 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1595_D08.
          Length = 189

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +2

Query: 449 DKAAEDFKVKLPD-GRLKDIVESIEHLAEETAKDAHIVEDLMDKVEEVDEKL 601
           +K A +    LP+ G L  + E +E++AE   KDA  VE ++ K+E+V  ++
Sbjct: 121 EKLAANVANALPENGTLHKLAEEVEYIAEIVDKDAQKVEIIIKKIEDVSNRI 172



>gb:AE016819_1748778 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 896

 Score = 33.9 bits (76), Expect = 2.1
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = -1

Query: 345 GSDTPSPTAQPNQELSEGGQKGRTPERKSPAAAASGVA*MTKALLFEDLWEILRL 181
           G D P+P  + + E++     GR P   SP+A  SGVA      +  D  EI  L
Sbjct: 232 GDDAPTPATEESMEITGQQSVGRIPSSGSPSAKLSGVATARMVSMDGDSMEITGL 286



>pir|T25157|T25157 hypothetical protein T23D5.9 - Caenorhabditis
           elegans>gb:CET23D5_1368027 Caenorhabditis elegans cosmid
           T23D5, complete sequence.
          Length = 354

 Score = 33.1 bits (74), Expect = 3.7
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +3

Query: 69  HSLEQQISNFGF*STFLCNNIFLHTT 146
           H +  Q S FGF S+ +CN++FL+ T
Sbjct: 5   HEISYQFSQFGFVSSLICNSVFLYLT 30



>gb:SCO939118_177703 Streptomyces coelicolor A3(2) complete genome;
           segment 15/29.
          Length = 859

 Score = 32.3 bits (72), Expect = 6.2
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = +2

Query: 191 ISQRSSNKRALVIQAT-PEAAAAGDFLSGVLPFWPPSDNSWLGWAVGLGVSLPLVTAQLI 367
           IS R   + +  + AT   A   G  L GV+     +D SWLGW   L V +P     LI
Sbjct: 149 ISPRERGRYSGYLGATFAVATVGGPLLGGVI-----TDTSWLGWRWCLYVGVPFAIIALI 203

Query: 368 ALPK 379
            L K
Sbjct: 204 VLQK 207


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 557,086,171
Number of Sequences: 1806583
Number of extensions: 10367583
Number of successful extensions: 36831
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 35159
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36795
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 30605518023
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)