BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2304
         (540 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK176727_1818715 Arabidopsis thaliana mRNA, complete cds, clo...    44   0.001   
gb:AY085066_1570148 Arabidopsis thaliana clone 12613 mRNA, compl...    44   0.001   
gb:AB016893_1513263 Arabidopsis thaliana genomic DNA, chromosome...    43   0.003   
gb:CAR275310_1645195 Cicer arietinum partial mRNA for hypothetic...    40   0.017   
gb:AC073556_1541108 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...    38   0.11    
gb:AE016959_1022497 Oryza sativa (japonica cultivar-group) chrom...    37   0.19    
gb:AY087096_1572132 Arabidopsis thaliana clone 31648 mRNA, compl...    37   0.25    
gb:AY086630_1571675 Arabidopsis thaliana clone 264020 mRNA, comp...    34   1.2     
pir|E83276|E83276 hypothetical protein PA2946 [imported] - Pseud...    32   4.7     Pseudomonas aeruginosa
gb:OSJN00174_1696199 Oryza sativa genomic DNA, chromosome 4, BAC...    32   6.1     
gb:AP003857_1834386 Oryza sativa (japonica cultivar-group) genom...    32   8.0     


>gb:AK176727_1818715 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL25-26-P11.
          Length = 112

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +3

Query: 48  DVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSE 194
           D  +E+     SVPQFG WDQK  GG    +Y++ FT+ RE RKQ+K +
Sbjct: 3   DDRKEKNTPWLSVPQFGDWDQK--GGGTMPDYSMDFTKIREMRKQNKRD 49



>gb:AY085066_1570148 Arabidopsis thaliana clone 12613 mRNA, complete
           sequence.
          Length = 112

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 23/49 (46%), Positives = 31/49 (63%)
 Frame = +3

Query: 48  DVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSE 194
           D  +E+     SVPQFG WDQK  GG    +Y++ FT+ RE RKQ+K +
Sbjct: 3   DDRKEKNTPWLSVPQFGDWDQK--GGGTMPDYSMDFTKIREMRKQNKRD 49



>gb:AB016893_1513263 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MYH9.
          Length = 111

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 21/38 (55%), Positives = 27/38 (71%)
 Frame = +3

Query: 81  SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSE 194
           SVPQFG WDQK  GG    +Y++ FT+ RE RKQ+K +
Sbjct: 13  SVPQFGDWDQK--GGGTMPDYSMDFTKIREMRKQNKRD 48



>gb:CAR275310_1645195 Cicer arietinum partial mRNA for hypothetical
           protein (ORF1), clone Can74-2.
          Length = 106

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 22/49 (44%), Positives = 31/49 (63%)
 Frame = +3

Query: 45  MDVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS 191
           MD ++E+     SVPQFG WDQK        +Y+L F++ RE RKQ+K+
Sbjct: 6   MDQNKEKNAPWLSVPQFGEWDQK----GPLPDYSLDFSKIREMRKQNKT 50



>gb:AC073556_1541108 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 113

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +3

Query: 81  SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL 197
           +VP FG WD K G      +Y++ F++ RE RKQ+K EL
Sbjct: 21  TVPAFGDWDMKNGA---LPDYSMDFSKIREMRKQNKKEL 56



>gb:AE016959_1022497 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021893_1538817
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0060A14, from chromosome 10, complete
           sequence.>gb:AC090487_1734356 Genomic Sequence for Oryza
           sativa, Nipponbare strain, clone OSJNBb0044I14, from
           Chromosome 10, complete sequence.>gb:AE017092_1752316
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 46 of 77 of the complete sequence.
          Length = 150

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +3

Query: 81  SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL 197
           +VP FG WD K G      +Y++ F++ RE RKQ+K EL
Sbjct: 20  TVPAFGEWDMKNGA---VPDYSMDFSKIREMRKQNKREL 55



>gb:AY087096_1572132 Arabidopsis thaliana clone 31648 mRNA, complete
           sequence.
          Length = 114

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = +3

Query: 81  SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSE 194
           SVPQFG WDQK G      +Y++ F++ RE RK +K +
Sbjct: 14  SVPQFGDWDQKGGS----IDYSMDFSKIREMRKLNKRD 47



>gb:AY086630_1571675 Arabidopsis thaliana clone 264020 mRNA,
           complete sequence.
          Length = 89

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +3

Query: 72  RRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS 191
           R   +P+FG WD    G  E   +T++F +AR+D+K  K+
Sbjct: 6   RARPLPKFGEWDATNPGSAE--GFTVIFNKARDDKKTMKT 43



>pir|E83276|E83276 hypothetical protein PA2946 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004721_57182
           Pseudomonas aeruginosa PAO1, section 282 of 529 of the
           complete genome.>gb:AE004091_971282 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 364

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 24/75 (32%), Positives = 32/75 (42%), Gaps = 5/75 (6%)
 Frame = +1

Query: 19  ILHLHRTPPWMSIGRRGLGGHQCHNLG-----DGIRRKEAARSVQITH*FLRKPERTGSN 183
           + H H  P      ++  G  Q H+L       G RR+ A R+  +   FL    R G+ 
Sbjct: 53  LCHAHANPEGTHHVQQHPGARQLHHLPVEATEPGHRRRPARRAAGLFRRFLA--HRRGTQ 110

Query: 184 TRANYPLTHPLPLPL 228
            R  YP    LPLPL
Sbjct: 111 RRPRYPAQLRLPLPL 125



>gb:OSJN00174_1696199 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0058K23, complete sequence.
          Length = 92

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 81  SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRK 179
           ++P+FG WD K     E   +T++F +AR+D+K
Sbjct: 9   ALPKFGEWDVKNPASAE--GFTVIFQKARDDKK 39



>gb:AP003857_1834386 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1014_E06.>gb:AP003888_1834889 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1191_A10.
          Length = 449

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +3

Query: 60  EERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRK 179
           E   R S+VP+FG WD      +    YT +F + RE+++
Sbjct: 170 ETPTRGSAVPRFGDWDSNPASAD---GYTHIFNKVREEKQ 206


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 505,464,050
Number of Sequences: 1806583
Number of extensions: 8896841
Number of successful extensions: 20878
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 19503
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20857
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 22973961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)