BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2278
         (722 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47845|T47845 hypothetical protein T2O9.190 - Arabidopsis th...   184   2e-45   Arabidopsis thaliana [mouse-ear cress]
pir|T01592|T01592 hypothetical protein At2g44650 [imported] - Ar...   166   5e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AY072530_1567347 Arabidopsis thaliana unknown protein (At2g44...   165   7e-40   
gb:AE016959_1023882 Oryza sativa (japonica cultivar-group) chrom...   159   4e-38   
sp|P22880|CH10_SYNP7|CH10_SYNP7 10 kDa chaperonin (Protein Cpn10) (groES pr...    62   1e-08   Synechococcus sp.
sp|P07889|CH10_SYNP6|CH10_SYNP6 10 kDa chaperonin (Protein Cpn10) (groES pr...    61   2e-08   Synechococcus sp.
gb:BX572093_797063 Prochlorococcus marinus MED4 complete genome;...    60   3e-08   
gb:AE017165_396045 Prochlorococcus marinus subsp. marinus str. C...    60   3e-08   
gb:BX572099_798792 Prochlorococcus marinus MIT9313 complete geno...    60   4e-08   
sp|Q8L373|CH10_SYNP8|CH10_SYNP8 10 kDa chaperonin (Protein Cpn10) (groES pr...    59   9e-08   Synechococcus sp.
sp|Q8YQZ9|CH10_ANASP|CH10_ANASP 10 kDa chaperonin (Protein Cpn10) (groES pr...    59   9e-08   Anabaena sp.
gb:BX569690_775415 Synechococcus sp. WH8102 complete genome; seg...    58   2e-07   
gb:AP004257_1839232 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:CR543861_104666 Acinetobacter sp. ADP1 complete genome.             56   6e-07   
sp|O65282|CH1C_ARATH|CH1C_ARATH 20 kDa chaperonin, chloroplast precursor (P...    56   7e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AE017282_427513 Methylococcus capsulatus str. Bath, complete ...    55   1e-06   
gb:D78139_120320 Synechococcus vulcanus DNA for GroEL1 and GroES...    55   1e-06   
sp|Q60023|CH10_THEBR|CH10_THEBR 10 kDa chaperonin (Protein Cpn10) (groES pr...    55   1e-06   Thermoanaerobacter brockii
sp|O50322|CH10_SYNEL|CH10_SYNEL 10 kDa chaperonin (Protein Cpn10) (groES pr...    55   1e-06   Synechococcus elongatus
gb:AF522274_1808048 Gossypium hirsutum cp10-like protein (CLP) m...    55   2e-06   
gb:AE014296_1136094 Drosophila melanogaster chromosome 3L, compl...    55   2e-06   
gb:SYCGROESL_195462 Synechocystis sp. groES and groEL genes.           54   2e-06   
pir|S77563|S77563 chaperonin groES - Synechocystis sp. (strain P...    54   2e-06   Synechocystis sp. PCC 6803
sp|Q05971|CH10_SYNY3|CH10_SYNY3 10 kDa chaperonin (Protein Cpn10) (groES pr...    54   2e-06   Synechocystis sp.
sp|Q8KJ25|CH10_CLOBO|CH10_CLOBO 10 kDa chaperonin (Protein Cpn10) (groES pr...    53   5e-06   Clostridium botulinum
gb:AY232224_1177517 Drosophila yakuba clone yak-ad_CG9920 mRNA s...    53   6e-06   
gb:AE014297_1139484 Drosophila melanogaster chromosome 3R, compl...    53   6e-06   
gb:AY664491_639470 Bartonella bacilliformis fumarase C (fumC) ge...    53   6e-06   
gb:AY316747_609001 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...    53   6e-06   
sp|Q98II0|CH12_RHILO|CH12_RHILO 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    53   6e-06   Mesorhizobium loti
sp|Q8R5T8|CH10_THETN|CH10_THETN 10 kDa chaperonin (Protein Cpn10) (groES pr...    53   6e-06   
sp|P19422|CH10_COXBU|CH10_COXBU 10 kDa chaperonin (Protein Cpn10) (groES pr...    53   6e-06   Coxiella burnetii
sp|Q8GBD3|CH10_ACEAC|CH10_ACEAC 10 kDa chaperonin (Protein Cpn10) (groES pr...    53   6e-06   Acetobacter aceti
gb:AE017340_458035 Idiomarina loihiensis L2TR, complete genome.        52   8e-06   
gb:AY871850_2150014 Synthetic construct hypothetical protein (FT...    52   1e-05   
gb:AF233745_1779476 Lycopersicon esculentum chaperonin 21 precur...    52   1e-05   
gb:AJ749949_532152 Francisella tularensis subsp. tularensis comp...    52   1e-05   
gb:AF054630_473929 Oscillatoria sp. NKBG091600 GroES gene, compl...    52   1e-05   
sp|O83977|CH10_TREPA|CH10_TREPA 10 kDa chaperonin (Protein Cpn10) (groES pr...    52   1e-05   Treponema pallidum
sp|P42376|CH10_PORGI|CH10_PORGI 10 kDa chaperonin (Protein Cpn10) (groES pr...    52   1e-05   Porphyromonas gingivalis
sp|P30719|CH10_CLOAB|CH10_CLOAB 10 kDa chaperonin (Protein Cpn10) (groES pr...    52   1e-05   Clostridium acetobutylicum
sp|P31295|CH10_CHRVI|CH10_CHRVI 10 kDa chaperonin (Protein Cpn10) (groES pr...    52   1e-05   Allochromatium vinosum
pir|T52122|T52122 chaperonin 10 [imported] - Arabidopsis thalian...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
sp|Q8VV85|CH10_BACTR|CH10_BACTR 10 kDa chaperonin (Protein Cpn10) (groES pr...    52   1e-05   Parageobacillus thermoglucosidasius
gb:CP000009_863883 Gluconobacter oxydans 621H, complete genome.        51   2e-05   
gb:BA000045_741103 Gloeobacter violaceus PCC 7421 DNA, complete ...    51   2e-05   
gb:BA000040_733486 Bradyrhizobium japonicum USDA 110 DNA, comple...    51   2e-05   
gb:AF274871_494651 Bacillus stearothermophilus groESL operon, pa...    51   2e-05   
sp|P77828|CH11_BRAJA|CH11_BRAJA 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    51   2e-05   Bradyrhizobium japonicum
sp|P94819|CH10_HOLOB|CH10_HOLOB 10 kDa chaperonin (Protein Cpn10) (groES pr...    51   2e-05   Holospora obtusa
gb:BA000045_742971 Gloeobacter violaceus PCC 7421 DNA, complete ...    51   2e-05   
gb:AE017333_446527 Bacillus licheniformis DSM 13, complete genom...    51   2e-05   
sp|P94797|CH10_FRATU|CH10_FRATU 10 kDa chaperonin (Protein Cpn10) (groES pr...    51   2e-05   Francisella tularensis
sp|Q37761|CH10_CYAPA|CH10_CYAPA 10 kDa chaperonin (Protein Cpn10) (groES pr...    51   2e-05   Cyanophora paradoxa
gb:AP003510_1830132 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AP003510_1830131 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:BX897700_829283 Bartonella quintana str. Toulouse, complete g...    50   3e-05   
gb:BX248584_763696 Blochmannia floridanus complete genome; segme...    50   3e-05   
gb:BA000043_736825 Geobacillus kaustophilus HTA426 DNA, complete...    50   3e-05   
pir|F75499|F75499 chaperonin - Deinococcus radiodurans (strain R...    50   3e-05   Deinococcus radiodurans
sp|Q981K0|CH15_RHILO|CH15_RHILO 10 kDa chaperonin 5 (Protein Cpn10 5) (groE...    50   3e-05   Mesorhizobium loti
sp|Q983S3|CH14_RHILO|CH14_RHILO 10 kDa chaperonin 4 (Protein Cpn10 4) (groE...    50   3e-05   Mesorhizobium loti
gb:BA000030_703065 Streptomyces avermitilis MA-4680 genomic DNA,...    50   4e-05   
gb:AJ749669_530407 Bartonella henselae groES gene, groEL gene an...    50   4e-05   
gb:TAU29483_197342 Thermus aquaticus GroES-like chaperonin (hsp6...    50   4e-05   
gb:D88802_121176 Bacillus subtilis DNA for phoB-rrnE-groESL regi...    50   4e-05   
pir|JN0513|JN0513 heat shock protein groES (clone Rhz C) - Rhizo...    50   4e-05   Sinorhizobium meliloti
pir|A49855|A49855 heat shock protein GroES - Bacillus stearother...    50   4e-05   Geobacillus stearothermophilus
sp|P35474|CH15_RHIME|CH15_RHIME 10 kDa chaperonin 5 (Protein Cpn10 5) (groE...    50   4e-05   Sinorhizobium meliloti
sp|Q9Z463|CH10_PARDE|CH10_PARDE 10 kDa chaperonin (Protein Cpn10) (groES pr...    50   4e-05   Paracoccus denitrificans
sp|P25968|CH10_BRUME|CH10_BRUME 10 kDa chaperonin (Protein Cpn10) (groES pr...    50   4e-05   
sp|P28599|CH10_BACSU|CH10_BACSU 10 kDa chaperonin (Protein Cpn10) (groES pr...    50   4e-05   Bacillus subtilis
sp|Q07200|CH10_BACST|CH10_BACST 10 kDa chaperonin (Protein Cpn10) (groES pr...    50   4e-05   Geobacillus stearothermophilus
gb:AY680699_1622084 Vitis vinifera chloroplast chaperonin 21 (cp...    50   5e-05   
sp|Q98AX8|CH13_RHILO|CH13_RHILO 10 kDa chaperonin 3 (Protein Cpn10 3) (groE...    50   5e-05   Mesorhizobium loti
sp|P26879|CH10_LEGPN|CH10_LEGPN 10 kDa chaperonin (Protein Cpn10) (groES pr...    50   5e-05   Legionella pneumophila
gb:BX908798_830735 Parachlamydia-related symbiont UWE25, complet...    49   7e-05   
gb:AE016871_353739 Pseudomonas syringae pv. tomato str. DC3000 s...    49   7e-05   
gb:CP000031_84937 Silicibacter pomeroyi DSS-3, complete genome.        49   7e-05   
sp|P35473|CH11_RHIME|CH11_RHIME 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    49   7e-05   Sinorhizobium meliloti
sp|Q8ZIY4|CH10_YERPE|CH10_YERPE 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   7e-05   Yersinia pestis
sp|P26195|CH10_LEGMI|CH10_LEGMI 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   7e-05   Tatlockia micdadei
gb:AP004671_1843084 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
gb:AE016779_330797 Pseudomonas putida KT2440 section 6 of 21 of ...    49   9e-05   
gb:TTH250409_198461 Thermus thermophilus chpS gene for chaperoni...    49   9e-05   
pir|A36917|A36917 heat shock protein GroES - Agrobacterium tumef...    49   9e-05   Agrobacterium fabrum str. C58
pir|T03585|T03585 probable chaperonin 10 - rice>gb:AF009413_1761...    49   9e-05   Oryza sativa [red rice]
sp|P61492|CH10_THET2|CH10_THET2 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   9e-05   Thermus thermophilus
sp|O33499|CH10_PSEST|CH10_PSEST 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   9e-05   Pseudomonas stutzeri
sp|P48226|CH10_PSEPU|CH10_PSEPU 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   9e-05   Pseudomonas putida
sp|Q8CXL4|CH10_OCEIH|CH10_OCEIH 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   9e-05   Oceanobacillus iheyensis
sp|Q9RWR0|CH10_DEIRA|CH10_DEIRA 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   9e-05   Deinococcus radiodurans
gb:AF239163_491597 Rhizobium leguminosarum cpn-2 (groE) operon, ...    49   1e-04   
sp|Q92ZQ3|CH14_RHIME|CH14_RHIME 10 kDa chaperonin 4 (Protein Cpn10 4) (groE...    49   1e-04   Sinorhizobium meliloti
sp|O50304|CH10_BACHD|CH10_BACHD 10 kDa chaperonin (Protein Cpn10) (groES pr...    49   1e-04   Bacillus halodurans
gb:AY316747_609071 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...    48   2e-04   
gb:AE017024_380547 Bacillus anthracis str. Ames section 1 of 18 ...    48   2e-04   
gb:AE016924_358976 Chromobacterium violaceum ATCC 12472 section ...    48   2e-04   
gb:AE008692_241666 Zymomonas mobilis subsp. mobilis ZM4, complet...    48   2e-04   
gb:AB007637_1124 Bacillus subtilis genomic DNA containing groES ...    48   2e-04   
sp|Q9ANS0|CH10_WIGBR|CH10_WIGBR 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
sp|O87887|CH10_LAWIN|CH10_LAWIN 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Lawsonia intracellularis
sp|P48223|CH10_CLOTM|CH10_CLOTM 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Hungateiclostridium thermocellum
sp|Q9KKF1|CH10_CLODI|CH10_CLODI 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Clostridioides difficile
sp|O68308|CH10_AERSA|CH10_AERSA 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Aeromonas salmonicida
gb:AY657160_2146170 Synthetic construct Peudomonas aeruginosa cl...    48   2e-04   
gb:AP003510_1830136 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:AY189823_595974 Ruminococcus flavefaciens strain FD-1 groESL ...    48   2e-04   
gb:AE017315_440226 Desulfovibrio vulgaris subsp. vulgaris str. H...    48   2e-04   
gb:AE017249_415982 Treponema denticola ATCC 35405, section 4 of ...    48   2e-04   
gb:AE016998_375302 Bacillus cereus ATCC 14579 section 1 of 18 of...    48   2e-04   
pir|D70192|D70192 chaperonin (groES) homolog - Lyme disease spir...    48   2e-04   Borreliella burgdorferi
sp|P35863|CH12_BRAJA|CH12_BRAJA 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    48   2e-04   Bradyrhizobium japonicum
sp|P30720|CH10_PSEAE|CH10_PSEAE 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   Pseudomonas aeruginosa
sp|Q9F4E6|CH10_BUCTT|CH10_BUCTT 10 kDa chaperonin (Protein Cpn10) (groES pr...    48   2e-04   
gb:AP006627_563204 Bacillus clausii KSM-K16 DNA, complete genome.      47   3e-04   
gb:ECGROES_125786 E.coli groES gene (mopB) complementing the tsA...    47   3e-04   
gb:CR522870_99036 Desulfotalea psychrophila LSv54 chromosome.          47   3e-04   
sp|P48228|CH10_YEREN|CH10_YEREN 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Yersinia enterocolitica
sp|P05380|CH10_ECOLI|CH10_ECOLI 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Escherichia coli [E. coli]
sp|P30780|CH10_AGRT5|CH10_AGRT5 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Agrobacterium tumefaciens
gb:BX950851_839376 Erwinia carotovora subsp. atroseptica SCRI104...    47   3e-04   
gb:AE017282_428443 Methylococcus capsulatus str. Bath, complete ...    47   3e-04   
gb:AE016933_361198 Bacteroides thetaiotaomicron VPI-5482, sectio...    47   3e-04   
gb:AB087495_11379 Thermus sp. TB1 groES and groEL genes for co-c...    47   3e-04   
sp|P48229|CH10_ZYMMO|CH10_ZYMMO 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Zymomonas mobilis subsp. mobilis
sp|Q9EZV2|CH10_THENE|CH10_THENE 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Thermotoga neapolitana
sp|Q9JXM4|CH10_NEIMB|CH10_NEIMB 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Neisseria meningitidis serogroup B
sp|Q9JWA3|CH10_NEIMA|CH10_NEIMA 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   
sp|P77913|CH10_NEIGO|CH10_NEIGO 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Neisseria gonorrhoeae
sp|P48222|CH10_CAUCR|CH10_CAUCR 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Caulobacter vibrioides
sp|Q8RU01|CH10_BRECH|CH10_BRECH 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   3e-04   Brevibacillus choshinensis
gb:SCO939114_176572 Streptomyces coelicolor A3(2) complete genom...    47   5e-04   
gb:D55630_120195 Bacillus sp. DNA for GroEL, complete cds, GroES...    47   5e-04   
pir|PC4238|PC4238 heat shock protein GroES - Bacillus sp. (fragm...    47   5e-04   Bacillus halodurans
pir|JC5770|JC5770 chaperonin groES-like protein - Weevil               47   5e-04   Sitophilus oryzae
sp|P35864|CH13_BRAJA|CH13_BRAJA 10 kDa chaperonin 3 (Protein Cpn10 3) (groE...    47   5e-04   Bradyrhizobium japonicum
sp|Q9LC51|CH10_SALTY|CH10_SALTY 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   5e-04   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q93FU7|CH10_ENTAE|CH10_ENTAE 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   5e-04   Klebsiella aerogenes
sp|O51683|CH10_BORBU|CH10_BORBU 10 kDa chaperonin (Protein Cpn10) (groES pr...    47   5e-04   Borreliella burgdorferi
gb:AP005424_1851614 Oryza sativa (japonica cultivar-group) genom...    46   6e-04   
gb:CP000013_869968 Borrelia garinii PBi, complete genome.              46   6e-04   
gb:BA000040_735792 Bradyrhizobium japonicum USDA 110 DNA, comple...    46   6e-04   
gb:AY142899_592082 Heliobacillus mobilis 10 kDa chaperonin GroES...    46   6e-04   
gb:AF335323_502473 Listeria monocytogenes groESL operon, complet...    46   6e-04   
gb:AE013207_290218 Thermoanaerobacter tengcongensis MB4, section...    46   6e-04   
gb:RLY12483_164530 R.leguminosarum cpn10-1 gene, cpn60-1 gene, p...    46   6e-04   
gb:CR378673_96650 Photobacterium profundum SS9; segment 11/12.         46   6e-04   
sp|Q87JG7|CH12_VIBPA|CH12_VIBPA 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    46   6e-04   Vibrio parahaemolyticus
sp|Q98IV4|CH11_RHILO|CH11_RHILO 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    46   6e-04   Mesorhizobium loti
sp|Q9AGE7|CH10_LISMO|CH10_LISMO 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   6e-04   
sp|Q8KF03|CH10_CHLTE|CH10_CHLTE 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   6e-04   Chlorobaculum tepidum
sp|Q9F4E4|CH10_BUCTS|CH10_BUCTS 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   6e-04   
sp|Q9F4F0|CH10_BUCPS|CH10_BUCPS 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   6e-04   
sp|P59525|CH10_BUCBP|CH10_BUCBP 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   6e-04   
gb:AP006841_573917 Bacteroides fragilis YCH46 DNA, complete genome.    46   8e-04   
gb:AE017197_402587 Rickettsia typhi str. Wilmington complete gen...    46   8e-04   
gb:AE017180_401626 Geobacter sulfurreducens PCA, complete genome.      46   8e-04   
gb:RLY12485_164534 R.leguminosarum cpn10-3 gene, cpn60-3 gene, p...    46   8e-04   
sp|P60367|CH12_RHOPA|CH12_RHOPA 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    46   8e-04   Rhodopseudomonas palustris
sp|P80469|CH10_RICTY|CH10_RICTY 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   8e-04   Rickettsia typhi
sp|Q9ZCT6|CH10_RICPR|CH10_RICPR 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   8e-04   Rickettsia prowazekii
sp|Q929U9|CH10_LISIN|CH10_LISIN 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   8e-04   
sp|O84113|CH10_CHLTR|CH10_CHLTR 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   8e-04   Chlamydia trachomatis
sp|P56970|CH10_CAMJE|CH10_CAMJE 10 kDa chaperonin (Protein Cpn10) (groES pr...    46   8e-04   
gb:AY052785_586929 Chlamydophila abortus gro operon, complete se...    45   0.001   
sp|P17204|CH10_CHLMU|CH10_CHLMU 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.001   Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q9F4F4|CH10_BUCGU|CH10_BUCGU 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.001   
gb:AY693222_1623269 Saccharomyces cerevisiae clone FLH114953.01X...    45   0.001   
gb:BX571872_788990 Photorhabdus luminescens subsp. laumondii TTO...    45   0.001   
gb:BX294152_770866 Pirellula sp. strain 1 complete genome; segme...    45   0.001   
gb:AP006840_570085 Symbiobacterium thermophilum DNA, complete ge...    45   0.001   
sp|Q9KJ24|CH10_LACJO|CH10_LACJO 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.001   Lactobacillus johnsonii
gb:BX842646_823145 Bdellovibrio bacteriovorus complete genome, s...    45   0.002   
gb:BA000040_733885 Bradyrhizobium japonicum USDA 110 DNA, comple...    45   0.002   
gb:RSU37369_168330 Rhodobacter sphaeroides heat-induced groESL o...    45   0.002   
sp|P25969|CH11_RHOSH|CH11_RHOSH 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    45   0.002   Rhodobacter sphaeroides
sp|P38910|CH10_YEAST|CH10_YEAST 10 kDa heat shock protein, mitochondrial (H...    45   0.002   Saccharomyces cerevisiae [brewer's yeast]
sp|P95801|CH10_XANMA|CH10_XANMA 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.002   Stenotrophomonas maltophilia
sp|Q9WYX5|CH10_THEMA|CH10_THEMA 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.002   Thermotoga maritima
sp|Q59686|CH10_PASMU|CH10_PASMU 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.002   Pasteurella multocida
sp|O51831|CH10_BUCMP|CH10_BUCMP 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.002   
sp|P25749|CH10_BUCAI|CH10_BUCAI 10 kDa chaperonin (Protein Cpn10) (groES pr...    45   0.002   
gb:AB002286_520 Wolbachia sp. DNA for GroES protein homolog, Gro...    44   0.002   
sp|Q9KNR6|CH11_VIBCH|CH11_VIBCH 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    44   0.002   Vibrio cholerae
sp|P60366|CH11_RHOPA|CH11_RHOPA 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    44   0.002   Rhodopseudomonas palustris
sp|P95677|CH10_RHOCA|CH10_RHOCA 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.002   Rhodobacter capsulatus
sp|P26210|CH10_BACP3|CH10_BACP3 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.002   Bacillus sp. (in: Bacteria)
gb:BX842655_826118 Bdellovibrio bacteriovorus complete genome, s...    44   0.003   
sp|Q9KLC7|CH12_VIBCH|CH12_VIBCH 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    44   0.003   Vibrio cholerae
sp|O59804|CH10_SCHPO|CH10_SCHPO 10 kDa heat shock protein, mitochondrial (H...    44   0.003   Schizosaccharomyces pombe
sp|Q93GT9|CH10_COLMA|CH10_COLMA 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.003   
sp|P15598|CH10_CHLCV|CH10_CHLCV 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.003   Chlamydia caviae
sp|Q9F4E8|CH10_BUCTC|CH10_BUCTC 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.003   
sp|Q96539|CH10_BRANA|CH10_BRANA 10 kDa chaperonin (Protein CPN10) (Protein ...    44   0.003   Brassica napus [oilseed rape]
gb:AB002290_528 Wolbachia sp. DNA for GroES protein homolog, Gro...    44   0.004   
sp|Q93MH2|CH10_RHOPA|CH10_RHOPA 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Rhodopseudomonas palustris
sp|Q9AEP8|CH10_LACLC|CH10_LACLC 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Lactococcus lactis subsp. cremoris
sp|P37283|CH10_LACLA|CH10_LACLA 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Lactococcus lactis subsp. lactis
sp|P31296|CH10_HAEDU|CH10_HAEDU 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   [Haemophilus] ducreyi
sp|P26822|CH10_CLOPE|CH10_CLOPE 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Clostridium perfringens
sp|P31682|CH10_CHLPN|CH10_CHLPN 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Chlamydia pneumoniae
sp|Q59176|CH10_BUCAP|CH10_BUCAP 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   
sp|P94165|CH10_ACTPL|CH10_ACTPL 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Actinobacillus pleuropneumoniae
sp|P46399|CH10_ACTAC|CH10_ACTAC 10 kDa chaperonin (Protein Cpn10) (groES pr...    44   0.004   Aggregatibacter actinomycetemcomitans
gb:CP000020_870380 Vibrio fischeri ES114 chromosome I, complete ...    43   0.005   
gb:AF005236_467543 Sitophilus oryzae principal endosymbiont GroE...    43   0.005   
pir|B60273|B60273 heat shock protein groES - Chlamydia trachomat...    43   0.005   Chlamydia trachomatis
pir|A97821|A97821 10K chaperonin [imported] - Rickettsia conorii...    43   0.005   Rickettsia conorii
sp|Q93GT7|CH10_TETHA|CH10_TETHA 10 kDa chaperonin (Protein Cpn10) (groES pr...    43   0.005   Tetragenococcus halophilus
sp|Q92H03|CH10_RICCN|CH10_RICCN 10 kDa chaperonin (Protein Cpn10) (groES pr...    43   0.005   Rickettsia conorii
sp|O68323|CH10_LACHE|CH10_LACHE 10 kDa chaperonin (Protein Cpn10) (groES pr...    43   0.005   Lactobacillus helveticus
sp|P43734|CH10_HAEIN|CH10_HAEIN 10 kDa chaperonin (Protein Cpn10) (groES pr...    43   0.005   Haemophilus influenzae
sp|P34893|CH10_ARATH|CH10_ARATH 10 kDa chaperonin (Protein CPN10) (Protein ...    43   0.005   Arabidopsis thaliana [mouse-ear cress]
sp|Q930X9|CH13_RHIME|CH13_RHIME 10 kDa chaperonin 3 (Protein Cpn10 3) (groE...    43   0.007   Sinorhizobium meliloti
sp|Q83WI9|CH11_VIBHA|CH11_VIBHA 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    43   0.007   Vibrio harveyi
gb:WSP511283_210519 Wolbachia sp. wEum partial groE operon (groE...    42   0.009   
gb:WSP318482_210501 Wolbachia sp. partial groE homologue operon....    42   0.009   
gb:CTU69255_119705 Chlamydia trachomatis heat shock protein/chap...    42   0.009   
gb:AB008153_1213 Erwinia aphidicola gene for GroES protein homol...    42   0.009   
gb:AB008143_1193 Serratia rubidaea gene for GroES protein homolo...    42   0.009   
sp|Q8CWI9|CH12_VIBVU|CH12_VIBVU 10 kDa chaperonin 2 (Protein Cpn10 2) (groE...    42   0.009   Vibrio vulnificus
sp|Q8CWL1|CH11_VIBVU|CH11_VIBVU 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    42   0.009   Vibrio vulnificus
sp|Q87KX3|CH11_VIBPA|CH11_VIBPA 10 kDa chaperonin 1 (Protein Cpn10 1) (groE...    42   0.009   Vibrio parahaemolyticus
gb:AF335185_502468 Enterococcus faecalis ATCC 29212 GroES (groES...    42   0.011   
gb:AB008152_1211 Erwinia carotovora gene for GroES protein homol...    42   0.011   
gb:AB008151_1209 Pantoea ananas gene for GroES protein homologue...    42   0.011   
gb:AB008150_1207 Erwinia herbicola gene for GroES protein homolo...    42   0.011   
gb:AB008146_1199 Klebsiella pneumoniae gene for GroES protein ho...    42   0.011   
sp|Q93EU7|CH10_ENTFA|CH10_ENTFA 10 kDa chaperonin (Protein Cpn10) (groES pr...    42   0.011   Enterococcus faecalis
sp|Q9F4F2|CH10_BUCPP|CH10_BUCPP 10 kDa chaperonin (Protein Cpn10) (groES pr...    42   0.011   
gb:AF542015_1809990 Griffithsia japonica heat shock protein 10 m...    42   0.015   
gb:MAL249748_1685564 Mortierella alpina hsp10 gene for putative ...    42   0.015   
gb:CR382125_1657633 Kluyveromyces lactis strain NRRL Y-1140 chro...    41   0.019   
gb:CR382125_1657632 Kluyveromyces lactis strain NRRL Y-1140 chro...    41   0.019   
gb:AY680700_1622085 Vitis vinifera chloroplast chaperonin 21 (cp...    41   0.019   
gb:AE013598_297990 Xanthomonas oryzae pv. oryzae KACC10331, comp...    41   0.019   
gb:WSP511282_210517 Wolbachia sp. wPseu partial groE operon (gro...    41   0.019   
gb:WSP318481_210499 Wolbachia sp. partial groE homologue operon....    41   0.019   
gb:AB008148_1203 Klebsiella planticola gene for GroES protein ho...    41   0.019   
gb:AB008145_1197 Serratia marcescens gene for GroES protein homo...    41   0.019   
gb:AB008144_1195 Serratia ficaria gene for GroES protein homolog...    41   0.019   
gb:AB008140_1187 Enterobacter amnigenus gene for GroES protein h...    41   0.019   
gb:AB008139_1185 Enterobacter gergoviae gene for GroES protein h...    41   0.019   
gb:AB008137_1181 Enterobacter asburiae gene for GroES protein ho...    41   0.019   
sp|Q8RIT8|CH10_XANAC|CH10_XANAC 10 kDa chaperonin (Protein Cpn10) (groES pr...    41   0.019   Xanthomonas citri
sp|Q8CX49|CH10_SHEON|CH10_SHEON 10 kDa chaperonin (Protein Cpn10) (groES pr...    41   0.019   Shewanella oneidensis
gb:BSP344977_750880 Buchnera sp. N27 groES gene for GroES- relat...    41   0.025   
gb:WSP511281_210515 Wolbachia endosymbiont of Aedes albopictus p...    41   0.025   
gb:AB057417_8380 Pseudoalteromonas sp. PS1M3 gene for GroES, Gro...    41   0.025   
sp|Q8CWN9|CH10_STRR6|CH10_STRR6 10 kDa chaperonin (Protein Cpn10) (groES pr...    41   0.025   Streptococcus pneumoniae
sp|Q9AKT2|CH10_ALTHA|CH10_ALTHA 10 kDa chaperonin (Protein Cpn10) (groES pr...    41   0.025   Pseudoalteromonas haloplanktis
gb:CR380954_1651418 Candida glabrata strain CBS138 chromosome H ...    40   0.032   
gb:AE017321_441982 Wolbachia endosymbiont strain TRS of Brugia m...    40   0.032   
sp|Q93G08|CH10_LACAC|CH10_LACAC 10 kDa chaperonin (Protein Cpn10) (groES pr...    40   0.032   Lactobacillus acidophilus
sp|Q8GJ01|CH10_FUSNP|CH10_FUSNP 10 kDa chaperonin (Protein Cpn10) (groES pr...    40   0.032   Fusobacterium nucleatum subsp. polymorphum
gb:AP004257_1839231 Oryza sativa (japonica cultivar-group) genom...    40   0.042   
gb:BSP344978_750882 Buchnera sp. 150 groES gene for GroES- relat...    40   0.042   
gb:AY328549_609805 Enterococcus flavescens GroES (groES) and Gro...    40   0.042   
gb:AY328532_609785 Enterococcus mundtii GroES (groES) gene, comp...    40   0.042   
gb:AE017257_418095 Wolbachia endosymbiont of Drosophila melanoga...    40   0.042   
gb:HVGA3HOR_1682357 H.vulgare mRNA for gamma 3 hordein, 3' end.        40   0.055   
pir|T05718|T05718 gamma-hordein 3 - barley (fragment)                  40   0.055   Hordeum vulgare [barley]
sp|P80198|HOG3_HORVU|HOG3_HORVU Gamma-hordein 3.                                  40   0.055   Hordeum vulgare [barley]
sp|Q97NV3|CH10_STRPN|CH10_STRPN 10 kDa chaperonin (Protein Cpn10) (groES pr...    40   0.055   
sp|Q8R5X6|CH10_FUSNN|CH10_FUSNN 10 kDa chaperonin (Protein Cpn10) (groES pr...    40   0.055   Fusobacterium nucleatum subsp. nucleatum
sp|O67942|CH10_AQUAE|CH10_AQUAE 10 kDa chaperonin (Protein Cpn10) (groES pr...    40   0.055   Aquifex aeolicus
gb:AF421539_1798871 Crypthecodinium cohnii Hsp10 (Hsp10) mRNA, c...    39   0.072   
gb:AY222993_1176458 Schistosoma japonicum clone ZZD1055 mRNA seq...    39   0.072   
gb:BX294148_769985 Pirellula sp. strain 1 complete genome; segme...    39   0.072   
gb:AB126865_15557 Ralstonia pickettii groESLa operon genes for m...    39   0.072   
sp|Q9PFP1|CH10_XYLFA|CH10_XYLFA 10 kDa chaperonin (Protein Cpn10) (groES pr...    39   0.072   Xylella fastidiosa
sp|Q8KM31|CH10_OLEAN|CH10_OLEAN 10 kDa chaperonin (Protein Cpn10) (groES pr...    39   0.072   Oleispira antarctica
gb:AE016818_1747914 Ashbya gossypii (= Eremothecium gossypii) AT...    39   0.094   
gb:AY086077_1571135 Arabidopsis thaliana clone 21053 mRNA, compl...    39   0.094   
gb:BX908798_829587 Parachlamydia-related symbiont UWE25, complet...    39   0.094   
gb:BX571657_777715 Wolinella succinogenes, complete genome; segm...    39   0.094   
gb:SMA297249_183830 Serratia marcescens partial groES gene for G...    39   0.094   
gb:ESP302158_135861 Enterobacteriaceae sp. JM983 partial groES g...    39   0.094   
gb:ESP302157_135859 Enterobacteriaceae sp. JM965 partial groES g...    39   0.094   
gb:AB002291_530 Wolbachia sp. DNA for GroES protein homolog, Gro...    39   0.094   
gb:AB002289_526 Wolbachia sp. DNA for GroES protein homolog, Gro...    39   0.094   
sp|Q8TGX8|CH10_METAC|CH10_METAC 10 kDa chaperonin (Protein Cpn10) (groES pr...    39   0.094   
pir|S70668|S70668 chaperonin groES - Caulobacter crescentus>gb:C...    39   0.12    
sp|Q8VT59|CH10_STRGN|CH10_STRGN 10 kDa chaperonin (Protein Cpn10) (groES pr...    39   0.12    
gb:AY674253_1179851 Ixodes pacificus clone IP_clu406 heat shock ...    38   0.16    
gb:AY346210_611693 Streptococcus bovis strain ATCC 33317 GroES (...    38   0.16    
gb:AE017147_390953 Helicobacter hepaticus ATCC 51449 section 4 o...    38   0.16    
gb:AY491442_621592 Enterococcus faecium strain NTUH 5704 GroES (...    38   0.21    
gb:AF389516_506650 Streptococcus mutans GroES gene, complete cds...    38   0.21    
gb:WSP511288_210529 Wolbachia sp. wNiv partial groE operon (groE...    38   0.21    
gb:AB002287_522 Wolbachia sp. DNA for GroES protein homolog, Gro...    38   0.21    
sp|Q9AME8|CH10_STRAG|CH10_STRAG 10 kDa chaperonin (Protein Cpn10) (groES pr...    38   0.21    
sp|Q8CX21|CH10_STRA3|CH10_STRA3 10 kDa chaperonin (Protein Cpn10) (groES pr...    38   0.21    
gb:AP006628_566555 Onion yellows phytoplasma OY-M DNA, complete ...    37   0.27    
gb:WSP511290_210533 Wolbachia sp. wBre partial groE operon (groE...    37   0.27    
gb:WSP511289_210531 Wolbachia sp. wSub partial groE operon (groE...    37   0.27    
pir|C86365|C86365 probable 10kd chaperonin [imported] - Arabidop...    37   0.27    
sp|Q8KIY4|CH10_STROR|CH10_STROR 10 kDa chaperonin (Protein Cpn10) (groES pr...    37   0.27    
gb:BC077653_2560348 Xenopus tropicalis heat shock 10kDa protein ...    37   0.47    
gb:AF031309_2469527 Gallus gallus heat shock protein 10 mRNA, co...    37   0.47    
gb:AX588259_1470902 Sequence 134 from Patent WO02083898.               37   0.47    
gb:AY295084_606807 Helicobacter pylori heat shock protein A (hsp...    37   0.47    
gb:CP000027_80396 Dehalococcoides ethenogenes 195, complete genome.    37   0.47    
sp|Q8CWW5|CH10_STRMU|CH10_STRMU 10 kDa chaperonin (Protein Cpn10) (groES pr...    37   0.47    
sp|Q8PW07|CH10_METMA|CH10_METMA 10 kDa chaperonin (Protein Cpn10) (groES pr...    37   0.47    
gb:AF109872_1884204 Homo sapiens chaperonin 10-related protein (...    36   0.61    
gb:AX588555_1471026 Sequence 430 from Patent WO02083898.               36   0.61    
gb:AY315820_608526 Enterococcus faecium strain ATCC 35667 GroES ...    36   0.61    
gb:AJ809977_532952 Helicobacter pylori partial hspA gene for hea...    36   0.61    
gb:AJ809972_532947 Helicobacter pylori partial hspA gene for hea...    36   0.61    
pir|S47532|S47532 chaperonin groES - human>pir|A56682|A56682 hea...    36   0.61    
sp|Q02073|CH1C_SPIOL|CH1C_SPIOL 20 kDa chaperonin, chloroplast precursor (P...    36   0.61    
sp|P61603|CH10_BOVIN|CH10_BOVIN 10 kDa heat shock protein, mitochondrial (H...    36   0.61    
gb:AJ809983_532958 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809981_532956 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809980_532955 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809979_532954 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809973_532948 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809969_532944 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809967_532942 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809966_532941 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809964_532939 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809962_532937 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809957_532932 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809954_532929 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809929_532904 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809900_532875 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809898_532873 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809897_532872 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809894_532869 Helicobacter pylori partial hspA gene for hea...    36   0.80    
gb:AJ809893_532868 Helicobacter pylori partial hspA gene for hea...    36   0.80    
pir|S41750|S41750 chaperonin groES - rat>gb:BC058492_2103272 Rat...    36   0.80    
sp|P26772|CH10_RAT|CH10_RAT 10 kDa heat shock protein, mitochondrial (Hsp...    36   0.80    
sp|P48225|CH10_HELPY|CH10_HELPY 10 kDa chaperonin (Protein Cpn10) (groES pr...    36   0.80    
gb:AC084153_1205269 Caenorhabditis elegans cosmid Y22D7AL, compl...    35   1.0     
gb:AJ809976_532951 Helicobacter pylori partial hspA gene for hea...    35   1.0     
gb:AJ809953_532928 Helicobacter pylori partial hspA gene for hea...    35   1.0     
gb:AJ809952_532927 Helicobacter pylori partial hspA gene for hea...    35   1.0     
gb:AJ809930_532905 Helicobacter pylori partial hspA gene for hea...    35   1.0     
gb:AJ809914_532889 Helicobacter pylori partial hspA gene for hea...    35   1.0     
gb:AF479029_514297 Helicobacter pylori strain CH-CTX1 heat shock...    35   1.0     
pir|S61396|S61396 chaperonin groES - Helicobacter pylori (strain...    35   1.0     
gb:RNU68562_2137643 Rattus norvegicus chaperonin 60 (Hsp60) and ...    35   1.4     
gb:AB028964_1865820 Homo sapiens mRNA for KIAA1041 protein, part...    35   1.4     
gb:AJ809932_532907 Helicobacter pylori partial hspA gene for hea...    35   1.4     
gb:AJ809931_532906 Helicobacter pylori partial hspA gene for hea...    35   1.4     
gb:AJ809895_532870 Helicobacter pylori partial hspA gene for hea...    35   1.4     
sp|Q9UPW0|FXJ3_HUMAN|FXJ3_HUMAN Forkhead box protein J3.                          35   1.4     
gb:BX294133_765156 Pirellula sp. strain 1 complete genome; segme...    35   1.8     
gb:AJ809899_532874 Helicobacter pylori partial hspA gene for hea...    35   1.8     
sp|Q8KJ15|CH10_STRBO|CH10_STRBO 10 kDa chaperonin (Protein Cpn10) (groES pr...    35   1.8     
gb:BC078219_2560804 Danio rerio zgc:100974, mRNA (cDNA clone MGC...    34   2.3     
gb:BC071419_2556159 Danio rerio heat shock 10kD protein 1 (chape...    34   3.0     
sp|O32846|CH10_LACZE|CH10_LACZE 10 kDa chaperonin (Protein Cpn10) (groES pr...    34   3.0     
gb:BC068628_2555136 Xenopus laevis hypothetical protein MGC79030...    33   4.0     
gb:HSCTEN2_2011694 Homo sapiens chaperonin 10 gene, exons 3 and ...    33   4.0     
pir|A55075|A55075 chaperonin-10 - mouse>gb:AK088121_1175210 Mus ...    33   4.0     
sp|Q64433|CH10_MOUSE|CH10_MOUSE 10 kDa heat shock protein, mitochondrial (H...    33   4.0     
gb:AY631040_638071 Lactobacillus paracasei subsp. paracasei stra...    33   5.2     
gb:AC084767_1733790 Oryza sativa chromosome 3 BAC OSJNBb0057P11 ...    33   6.8     
gb:AC016781_1538262 Genomic Sequence For Oryza sativa, Nipponbar...    33   6.8     
gb:CP000003_861686 Streptococcus pyogenes MGAS10394, complete ge...    33   6.8     
gb:AY346211_611695 Streptococcus bovis isolate ntuh195 GroES (gr...    33   6.8     
sp|Q9ERS5|PLA2_MOUSE|PLA2_MOUSE Pleckstrin homology domain-containing prote...    33   6.8     
sp|Q99XS0|CH10_STRPY|CH10_STRPY 10 kDa chaperonin (Protein Cpn10) (groES pr...    33   6.8     
sp|Q8KJ21|CH10_STRAP|CH10_STRAP 10 kDa chaperonin (Protein Cpn10) (groES pr...    33   6.8     
sp|Q88YM6|CH10_LACPL|CH10_LACPL 10 kDa chaperonin (Protein Cpn10) (groES pr...    33   6.8     
gb:AF102865_2473728 Danio rerio calymmin mRNA, complete cds.           32   8.8     
gb:MTR297721_1687622 Medicago truncatula enod11 gene for putativ...    32   8.8     
gb:AY585251_630264 Bifidobacterium magnum GroES gene, partial cds.     32   8.8     
gb:AY046926_586640 Lactococcus lactis subsp. cremoris YdjD (ydjD...    32   8.8     
pir|S20790|S20790 extensin - almond>gb:PAEXTS_1698692 P.amygdalu...    32   8.8     


>pir|T47845|T47845 hypothetical protein T2O9.190 - Arabidopsis
           thaliana>gb:ATT2O9_1555771 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T2O9.>gb:AY087462_1572493
           Arabidopsis thaliana clone 35721 mRNA, complete
           sequence.>gb:BT005842_1638764 Arabidopsis thaliana
           At3g60210 gene, complete cds.
          Length = 138

 Score =  184 bits (466), Expect = 2e-45
 Identities = 94/141 (66%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +3

Query: 54  MASGFLSLAKPFTSQPI--NIPSLSPAPRPVGIGLRRNSLRVNALSQKWEPTKVVPQADR 227
           MAS F+++ KPF S PI  N P+L   P+   +G+RRNS R+NA+S KWEP KVVPQADR
Sbjct: 1   MASSFITVPKPFLSFPIKTNAPTL---PQQTLLGIRRNSFRINAVSTKWEPAKVVPQADR 57

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNAYEVN 407
           VL+RLE LPEKS+GG+LLPKSAVKFERYL GE++SVG+ V EVE GKKVLFSD++AYEV+
Sbjct: 58  VLVRLEVLPEKSSGGVLLPKSAVKFERYLTGEVVSVGSEVGEVEPGKKVLFSDMSAYEVD 117

Query: 408 LGTEE-RHVFCKEGDLLAVVE 467
            GTE+ +H FCKE DLLA+V+
Sbjct: 118 FGTEDAKHCFCKESDLLAIVQ 138



>pir|T01592|T01592 hypothetical protein At2g44650 [imported] -
           Arabidopsis thaliana>gb:AB051163_1521073 Arabidopsis
           thaliana cpn10 mRNA for chloroplast chaperonin 10,
           complete cds.>gb:AC003672_1531131 Arabidopsis thaliana
           chromosome 2 clone F16B22 map m336, complete sequence.
          Length = 139

 Score =  166 bits (419), Expect = 5e-40
 Identities = 89/140 (63%), Positives = 110/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query: 54  MASGFL-SLAKPFTSQPINIPSLSPAPRPVGIGLRRNSLRVNALSQKWEPTKVVPQADRV 230
           MAS F+ SL  PF + P+   + S A   + +G RR  LR+ A+S KWEPTKVVPQADRV
Sbjct: 1   MASTFVCSLPNPFFAFPVKATTPSTANHTL-LGSRRGCLRIKAISTKWEPTKVVPQADRV 59

Query: 231 LIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETGKKVLFSDVNAYEVN 407
           L+RLE+LP KS+GG+LLPK+AVKFERYL GEI+SVG+ V  +V  GK+VLFSDV+AYEV+
Sbjct: 60  LVRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPGKRVLFSDVSAYEVD 119

Query: 408 LGTEERHVFCKEGDLLAVVE 467
           LGT+ RH FCKE DLLA+VE
Sbjct: 120 LGTDARHCFCKESDLLALVE 139



>gb:AY072530_1567347 Arabidopsis thaliana unknown protein
           (At2g44650; F16B22.14) mRNA, complete
           cds.>gb:AF386970_1794775 Arabidopsis thaliana Unknown
           protein (At2g44650; F16B22.14) mRNA, complete cds.
          Length = 139

 Score =  165 bits (418), Expect = 7e-40
 Identities = 89/140 (63%), Positives = 110/140 (78%), Gaps = 2/140 (1%)
 Frame = +3

Query: 54  MASGFL-SLAKPFTSQPINIPSLSPAPRPVGIGLRRNSLRVNALSQKWEPTKVVPQADRV 230
           MAS F+ SL  PF + P+   + S A   + +G RR  LR+ A+S KWEPTKVVPQADRV
Sbjct: 1   MASTFVCSLPDPFFAFPVKATTPSTANHTL-LGSRRGCLRIKAISTKWEPTKVVPQADRV 59

Query: 231 LIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV-SEVETGKKVLFSDVNAYEVN 407
           L+RLE+LP KS+GG+LLPK+AVKFERYL GEI+SVG+ V  +V  GK+VLFSDV+AYEV+
Sbjct: 60  LVRLEDLPIKSSGGVLLPKAAVKFERYLTGEIISVGSEVGQQVGPGKRVLFSDVSAYEVD 119

Query: 408 LGTEERHVFCKEGDLLAVVE 467
           LGT+ RH FCKE DLLA+VE
Sbjct: 120 LGTDARHCFCKESDLLALVE 139



>gb:AE016959_1023882 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087599_1734137
           Oryza sativa chromosome 10 BAC OSJNBa0057L21 genomic
           sequence, complete sequence.>gb:AE017120_1753701 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           74 of 77 of the complete sequence.
          Length = 140

 Score =  159 bits (403), Expect = 4e-38
 Identities = 90/146 (61%), Positives = 106/146 (72%), Gaps = 3/146 (2%)
 Frame = +3

Query: 39  APSLSMASGFLSLAKPFTSQPINIPSLSPAPRPVGIGLRR---NSLRVNALSQKWEPTKV 209
           APSL  A+     A PF        S S  P        R   +SLRV AL  K++P+KV
Sbjct: 2   APSLLAAA-----ASPFLLHGAAAASGSRRPLVAAAATGRRAASSLRVAAL--KYDPSKV 54

Query: 210 VPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDV 389
            PQ+DRVL+RLE++PEKS GG+LLPKSAVKFERYLMGEILSVG  V+EVE GKKVLFSD+
Sbjct: 55  APQSDRVLVRLEQIPEKSVGGVLLPKSAVKFERYLMGEILSVGADVNEVEAGKKVLFSDI 114

Query: 390 NAYEVNLGTEERHVFCKEGDLLAVVE 467
           NAYEV+LGT+E+H FC+E DLLAVVE
Sbjct: 115 NAYEVDLGTDEKHCFCRESDLLAVVE 140



>sp|P22880|CH10_SYNP7 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A36721|A36721 groES protein -
           Synechococcus sp. (strain PCC 7942)>gb:SYOGROESL_195610
           Synechococcus sp. groESL operon encoding chaperonin
           (groES and groEL) genes, complete cds.
          Length = 103

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P  DRV +++ E  EK+AGGI+LP +A   E+  +GEI++VG G S         EV+
Sbjct: 11  VTPLGDRVFVKVAEAEEKTAGGIILPDNAK--EKPQVGEIVAVGPGKSNDDGSRQAPEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct: 69  IGDKVLYSKYAGTDIKLGNDD-YVLLSEKDILAVV 102



>sp|P07889|CH10_SYNP6 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S10836|BVYCGS chaperonin groES -
           Synechococcus sp. (strain PCC 6301)>gb:SYATPSBE_195417
           Cyanobacterium Synechococcus 6301 DNA for ATP synthase
           subunits (EC 3.6.1.34).>gb:AP008231_581483 Synechococcus
           elongatus PCC 6301 DNA, complete genome.
          Length = 103

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV +++ E  EK+AGGI+LP +A   E+  +GEI++VG G           EV+
Sbjct: 11  VTPLGDRVFVKVAEAEEKTAGGIILPDNAK--EKPQVGEIVAVGPGKRNDDGSRQAPEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG ++ +V   E D+LAVV
Sbjct: 69  IGDKVLYSKYAGTDIKLGNDD-YVLLSEKDILAVV 102



>gb:BX572093_797063 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 103

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DR+ I++ E  EK+AGGILLP SA   E+  +GE+  VG G           EV 
Sbjct: 11  VKPLGDRIFIKVSESEEKTAGGILLPDSAK--EKPQVGEVAQVGPGKLNDDGSRQTPEVS 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG +E +V   E D+LAVV
Sbjct: 69  IGDKVLYSKYAGTDIKLGGDE-YVLLSEKDILAVV 102



>gb:AE017165_396045 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031714 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 103

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 40/95 (42%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV I++ E  EK+AGGILLP +A   E+  +GE+  VG G           EV 
Sbjct: 11  VKPLGDRVFIKVSESEEKTAGGILLPDTAK--EKPQVGEVAQVGPGKRNDDGSRQAPEVG 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG++E +V   E D+LAVV
Sbjct: 69  VGDKVLYSKYAGTDIKLGSDE-YVLLSEKDILAVV 102



>gb:BX572099_798792 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 103

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 39/95 (41%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV +++ E  EK+AGGILLP +A   E+  +GE++ VG G           EV 
Sbjct: 11  VKPLGDRVFVKVSESEEKTAGGILLPDTAK--EKPQVGEVVQVGPGKRNDDGSRQAPEVG 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ L T+E +V   E D+LAVV
Sbjct: 69  VGDKVLYSKYAGTDIKLSTDE-YVLLSEKDILAVV 102



>sp|Q8L373|CH10_SYNP8 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF373777_505543 Cyanothece sp. PCC 8801
           putative chaperonin protein gene, complete cds.
          Length = 103

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 38/96 (39%), Positives = 56/96 (58%), Gaps = 9/96 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV +++    EK+AGGILLP +A   E+  +GEI++VG G           EV+
Sbjct: 11  VKPLGDRVFVKVSASEEKTAGGILLPDTAK--EKPQIGEIVTVGPGKRNDDGSRSEPEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G KVL+S     ++ LG E+ +V   E D+LA+V+
Sbjct: 69  VGDKVLYSKYAGTDIKLGGED-YVLLSEKDILAIVD 103



>sp|Q8YQZ9|CH10_ANASP 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|AF2263|AF2263 chaperonin GroES [imported]
           - Nostoc sp. (strain PCC 7120)>gb:BA000019_684650 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 103

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 38/95 (40%), Positives = 55/95 (57%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P  DRV +++    EK+AGG+ LP +A   E+  +GE++++G G           EV+
Sbjct: 11  VKPLGDRVFVKVSASEEKTAGGLYLPDTAK--EKPQVGEVVALGAGKRNDDGSRQELEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     +V LGTEE +V   E D+LAVV
Sbjct: 69  VGDKVLYSKYAGTDVKLGTEE-YVLLSEKDILAVV 102



>gb:BX569690_775415 Synechococcus sp. WH8102 complete genome;
           segment 2/7.
          Length = 103

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 39/95 (41%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV I++ E  EK+AGGILLP +A   E+  +GE++ VG G           EV 
Sbjct: 11  VKPLGDRVFIKVSESEEKTAGGILLPDTAK--EKPQVGEVVQVGPGKRNDDGSRQAPEVG 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG +E  V   E D+LA+V
Sbjct: 69  VGDKVLYSKYAGTDIKLGGDE-FVLLTEKDILAIV 102



>gb:AP004257_1839232 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1369_G08.
          Length = 255

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 40/131 (30%), Positives = 68/131 (51%), Gaps = 8/131 (6%)
 Frame = +3

Query: 99  PINIPSLSPAPRPVGIGLRRNSLRVNALSQKWEPTKVVPQADRVLIRLEELPEKSAGGIL 278
           P  +  L  APRP     R   +R  A S   + T + P ADRVL++++   +K+ GGIL
Sbjct: 32  PAAVRVLRQAPRPS----RGLVVRAAAASVAPKYTTLKPLADRVLVKIKSAEQKTTGGIL 87

Query: 279 LPKSAVKFERYLMGEILSVGTGVS--------EVETGKKVLFSDVNAYEVNLGTEERHVF 434
           LP +A    +   GE++++G G +         ++ G +V++S     EV L  +  H+ 
Sbjct: 88  LPSAAQ--SKPQGGEVVAIGEGRTVGDNKVEVSIQVGSQVVYSKYAGTEVEL-NDSNHLI 144

Query: 435 CKEGDLLAVVE 467
            KE D++ ++E
Sbjct: 145 LKEDDIIGILE 155



 Score = 40.0 bits (92), Expect = 0.042
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P +DRVLI++ E  +K+ GG+LL ++    E+  +G +++VG G  +         V  G
Sbjct: 164 PLSDRVLIKVAEAEDKTPGGLLLTETTK--EKPSIGTVVAVGPGPLDEEGKRIPLSVSAG 221

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     E        ++  +  DL+AV+
Sbjct: 222 STVLYSKYAGSEFKGSDGTSYIVLRVSDLMAVL 254



>gb:CR543861_104666 Acinetobacter sp. ADP1 complete genome.
          Length = 96

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 8/97 (8%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEV 356
           + + P  DRV+IR  E   K+AGGILLP SA   E+   GE+++VG G          +V
Sbjct: 2   SNIRPLHDRVVIRRVEEETKTAGGILLPGSAA--EKPAQGEVIAVGNGQITENGVRALDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KVLF       V +  EE  +  KE D+LAV+E
Sbjct: 60  KAGDKVLFGTYAGTTVKVNGEE-FLIMKESDILAVLE 95



>sp|O65282|CH1C_ARATH 20 kDa chaperonin, chloroplast precursor
           (Protein Cpn21) (Chloroplast protein Cpn10) (Chloroplast
           chaperonin 10) (Ch-CPN10) (Chaperonin
           20).>pir|T52613|T52613 chaperonin 21 precursor,
           chloroplast [imported] - Arabidopsis
           thaliana>gb:AB007130_1510091 Arabidopsis thaliana mRNA
           for chaperonin 20, complete cds.>gb:ATH010818_1551915
           Arabidopsis thaliana mRNA for chloroplast Cpn21
           protein.>gb:AY034979_1559759 Arabidopsis thaliana
           putative chloroplast Cpn21 protein (At5g20720) mRNA,
           complete cds.>gb:AY062971_1565560 Arabidopsis thaliana
           putative chloroplast Cpn21 protein (At5g20720) mRNA,
           complete cds.>gb:AF268068_1782027 Arabidopsis thaliana
           chaperonin 10 (CHCPN10) mRNA, complete cds; chloroplast
           gene for chloroplast product.>gb:AF428339_1799269
           Arabidopsis thaliana AT5g20720/T1M15_120 mRNA, complete
           cds.>gb:AF428366_1799296 Arabidopsis thaliana
           AT5g20720/T1M15_120 mRNA, complete cds.
          Length = 253

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 43/159 (27%), Positives = 80/159 (50%), Gaps = 14/159 (8%)
 Frame = +3

Query: 33  LSAPSLSMASGFLSLAKPFTSQPINIPSLSPAPRPVGIGLRRNSLR------VNALSQKW 194
           L+A  ++M++  L+      +  +   SL P        LR++  R       + ++ K+
Sbjct: 6   LTASPVTMSARSLASLDGLRASSVKFSSLKPGT------LRQSQFRRLVVKAASVVAPKY 59

Query: 195 EPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS-------- 350
             T + P  DRVL++++E  EK+ GGILLP +A    +   GE+++VG G +        
Sbjct: 60  --TSIKPLGDRVLVKIKEAEEKTLGGILLPSTAQ--SKPQGGEVVAVGEGRTIGKNKIDI 115

Query: 351 EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            V TG ++++S     EV    + +H+  KE D++ ++E
Sbjct: 116 TVPTGAQIIYSKYAGTEVEF-NDVKHLILKEDDIVGILE 153



 Score = 40.0 bits (92), Expect = 0.042
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRV I++ E  EK+AGG+LL ++    E+  +G +++VG G  +         V TG
Sbjct: 162 PLNDRVFIKVAEAEEKTAGGLLLTETTK--EKPSIGTVIAVGPGSLDEEGKITPLPVSTG 219

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     +        ++  +  D++A++
Sbjct: 220 STVLYSKYAGNDFKGKDGSNYIALRASDVMAIL 252



>gb:AE017282_427513 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 96

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 39/97 (40%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+I+  E    SAGGI++P SA   E+ + GEIL+VG G           +V
Sbjct: 2   KIRPLHDRVIIKRLEEERTSAGGIVIPDSAA--EKPMRGEILAVGNGKVLDNGEVRALQV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KVLF      EV +  E+  V  +E D+LAV+E
Sbjct: 60  KVGDKVLFGKYAGTEVKVDGED-VVVMREDDILAVLE 95



>gb:D78139_120320 Synechococcus vulcanus DNA for GroEL1 and GroES,
           complete cds.>gb:BA000039_725971 Thermosynechococcus
           elongatus BP-1 DNA, complete genome.
          Length = 103

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DR+ +++ E  E++AGGILLP +A   E+  +GE+ +VG G           +V+
Sbjct: 11  VKPLGDRIFVKVAESEERTAGGILLPDNA--REKPQVGEVTAVGPGKLTEDGKRQPMDVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     EV L  E+ +V   E D+LA+V
Sbjct: 69  VGDKVLYSKYAGTEVKLAGED-YVLLSEKDILAIV 102



>sp|Q60023|CH10_THEBR 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S72613|S72613 chaperonin groES -
           Thermoanaerobacter brockii>gb:TBU56021_197396
           Thermoanaerobacter brockii groESL operon, chaperonin 10
           (groES) and chaperonin 60 (groEL) genes, complete cds.
          Length = 94

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/96 (34%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE 359
           ++ P  DRV++++ +  E + GG++LP +A   E+   GE+++VGTG          EV+
Sbjct: 2   RLKPLGDRVVVKVIQAEEVTKGGVILPGTAK--EKPQQGEVVAVGTGEYIDGKKVELEVK 59

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G +V+FS     EV L  EE ++  +E D+LA++E
Sbjct: 60  VGDRVIFSKYAGTEVKLDGEE-YLLLRESDILAIIE 94



>sp|O50322|CH10_SYNEL 10 kDa chaperonin (Protein Cpn10) (groES
           protein).
          Length = 102

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/95 (37%), Positives = 54/95 (56%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DR+ +++ E  E++AGGILLP +A   E+  +GE+ +VG G           +V+
Sbjct: 10  VKPLGDRIFVKVAESEERTAGGILLPDNA--REKPQVGEVTAVGPGKLTEDGKRQPMDVK 67

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     EV L  E+ +V   E D+LA+V
Sbjct: 68  VGDKVLYSKYAGTEVKLAGED-YVLLSEKDILAIV 101



>gb:AF522274_1808048 Gossypium hirsutum cp10-like protein (CLP)
           mRNA, complete cds.
          Length = 256

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 35/97 (36%), Positives = 54/97 (55%), Gaps = 8/97 (8%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEV 356
           T V P  DRVL++++E  EK+ GGILLP +A    +   GE+++VG G         S V
Sbjct: 63  TSVKPLGDRVLVKIKETEEKTEGGILLPTTAQ--SKPQGGEVVAVGEGKTIGNTKSESSV 120

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +TG +V++S     EV       H+  KE D++ ++E
Sbjct: 121 KTGAQVIYSKYAGTEVEF-NGANHLLLKEDDIVGLLE 156



 Score = 40.4 bits (93), Expect = 0.032
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRV I++ E  EK+AGG+LL +++   E+  +G +++VG G  +         V  G
Sbjct: 165 PLNDRVFIKVSEAEEKTAGGLLLTEASK--EKPSIGTVIAVGPGTLDEEGNLKPLSVSPG 222

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     +        ++  +  D++AV+
Sbjct: 223 NTVLYSKYAGNDFKGNDGSNYIALRASDVMAVL 255



>gb:AE014296_1136094 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003539_1214590 Drosophila melanogaster
           chromosome 3L, section 46 of 83 of the complete
           sequence.>gb:AY070696_1294841 Drosophila melanogaster
           RH34413 full length cDNA.
          Length = 103

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 34/99 (34%), Positives = 54/99 (54%), Gaps = 11/99 (11%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK----- 368
           K++P  DR+LI+  E   K+ GGI+LP+ AV   + L G +L+VG G     TG      
Sbjct: 7   KIIPMLDRILIQRAEALTKTKGGIVLPEKAV--GKVLEGTVLAVGPGTRNASTGNHIPIG 64

Query: 369 -----KVLFSDVNAYEVNLGTEERHVFC-KEGDLLAVVE 467
                +VL  +    +VNL  +++ +F  +E D+LA +E
Sbjct: 65  VKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103



>gb:SYCGROESL_195462 Synechocystis sp. groES and groEL genes.
          Length = 103

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P  DRV +++    EK+AGGILLP +A   E+  +GE++ VG G           EV+
Sbjct: 11  VKPLGDRVFVKVSPAEEKTAGGILLPDNAK--EKPQIGEVVQVGPGKRNDDGTYSPVEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG ++ +V   E D+LA V
Sbjct: 69  VGDKVLYSKYAGTDIKLGGDD-YVLLTEKDILASV 102



>pir|S77563|S77563 chaperonin groES - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_688189 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 106

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P  DRV +++    EK+AGGILLP +A   E+  +GE++ VG G           EV+
Sbjct: 14  VKPLGDRVFVKVSPAEEKTAGGILLPDNAK--EKPQIGEVVQVGPGKRNDDGTYSPVEVK 71

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG ++ +V   E D+LA V
Sbjct: 72  VGDKVLYSKYAGTDIKLGGDD-YVLLTEKDILASV 105



>sp|Q05971|CH10_SYNY3 10 kDa chaperonin (Protein Cpn10) (groES
           protein).
          Length = 102

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P  DRV +++    EK+AGGILLP +A   E+  +GE++ VG G           EV+
Sbjct: 10  VKPLGDRVFVKVSPAEEKTAGGILLPDNAK--EKPQIGEVVQVGPGKRNDDGTYSPVEVK 67

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ LG ++ +V   E D+LA V
Sbjct: 68  VGDKVLYSKYAGTDIKLGGDD-YVLLTEKDILASV 101



>sp|Q8KJ25|CH10_CLOBO 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB086955_11348 Clostridium botulinum genes
           for GroES homolog, GroEL homolog, complete cds.
          Length = 94

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 36/96 (37%), Positives = 54/96 (56%), Gaps = 8/96 (8%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE 359
           ++ P  DRV+I+  E  EK+  GI+LP SA   E+    EI++VG G          EV+
Sbjct: 2   RIKPLGDRVVIKRLEAEEKTKSGIVLPGSAK--EKPQEAEIVAVGPGGLVDGKEVNMEVK 59

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G +VLFS     EV +  EE ++  ++ D+LA+VE
Sbjct: 60  VGDRVLFSQYAGNEVKIDGEE-YIILRQNDILAIVE 94



>gb:AY232224_1177517 Drosophila yakuba clone yak-ad_CG9920 mRNA
           sequence.
          Length = 102

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------- 353
           KV+P  DR+LI+  E+   +AGGILLP+ +V  E  + G +++VG G             
Sbjct: 7   KVIPMLDRILIQRFEVKTTTAGGILLPEESVPKE--MQGVVVAVGPGARNPAGAGHLSVG 64

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G +VL       +V++  +  +V  +E D+LA +E
Sbjct: 65  VKEGDRVLLPKYGGTKVDMDDKREYVLFRESDILAKLE 102



>gb:AE014297_1139484 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003703_1221477 Drosophila melanogaster
           chromosome 3R, section 41 of 118 of the complete
           sequence.>gb:AY075297_1296145 Drosophila melanogaster
           AT30951 full insert cDNA.
          Length = 102

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------- 353
           KV+P  DR+LI+  E+   +AGGILLP+ +V  E  + G +++VG G             
Sbjct: 7   KVIPMLDRILIQRFEVKTTTAGGILLPEESVPKE--MQGVVVAVGPGARNPAGAGHLSVG 64

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G +VL       +V++  +  +V  +E D+LA +E
Sbjct: 65  VKEGDRVLLPKYGGTKVDMDDKREYVLFRESDILAKLE 102



>gb:AY664491_639470 Bartonella bacilliformis fumarase C (fumC) gene,
           partial cds; hypothetical protein gene, complete cds;
           and groE operon, complete sequence.
          Length = 98

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 34/97 (35%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SE 353
           TK  P  DRV++R  E   K+AGGI++P +A   E+   GE+++VG GV          E
Sbjct: 4   TKFRPLHDRVVVRRVESENKTAGGIIIPDTAQ--EKPQEGEVIAVGNGVLNDNGQRVSLE 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G ++LF   +  EV +  EE  +  KE D++ ++
Sbjct: 62  VKEGDRILFGKWSGTEVKINGEEL-LIMKESDIMGIL 97



>gb:AY316747_609001 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 104

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L+R  E  EK+AGGI++P +A   E+   GE+++VG G           +V+ G
Sbjct: 5   PLHDRILVRRIEAEEKTAGGIIIPDTAK--EKPQEGEVIAVGPGARDDGGKLVELDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            ++LF   +  E+ L  E+  +  KE D++ V+E
Sbjct: 63  DRILFGKWSGTEIKLNGEDL-LIMKESDVMGVIE 95



>sp|Q98II0|CH12_RHILO 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>gb:BA000012_667823 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 104

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 32/101 (31%), Positives = 57/101 (56%), Gaps = 9/101 (8%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L+R  E  EK+AGGI++P +A   E+   GE++++G G           +V+ G
Sbjct: 5   PLHDRILVRRIEAEEKTAGGIIIPDTAK--EKPQEGEVIAIGPGARDESGKLTPLDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE*IAHLQR 488
            ++LF   +  E+ L  E+  +  KE D++ V+E  A +++
Sbjct: 63  DRILFGKWSGTEIKLNGEDL-LIMKESDVMGVIEQTATVKK 102



>sp|Q8R5T8|CH10_THETN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE013027_288275 Thermoanaerobacter
           tengcongensis MB4, section 54 of 244 of the complete
           genome.>gb:AE008691_1110340 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 94

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 32/96 (33%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE 359
           ++ P  DRV++++ +  E + GG++LP +A   E+   GE+++VG G          EV+
Sbjct: 2   RLKPLGDRVVVKVIQSEEVTKGGVILPGTAK--EKPQQGEVVAVGPGQYIDGKRVEPEVK 59

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G +V+FS     EV L  EE ++  +E D+LA++E
Sbjct: 60  VGDRVIFSKYAGTEVKLDGEE-YLLLRESDILAIIE 94



>sp|P19422|CH10_COXBU 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock protein A).>pir|S39764|S39764
           chaperonin groES - Coxiella burnetii>gb:AE016965_368904
           Coxiella burnetii strain RSA 493, section 6 of 7 of the
           complete genome.>gb:COXHSPAB_850626 C.burnetii heat
           shock operon encoding two heat shock proteins (htpA and
           htpB), complete cds.>gb:AE016828_1009640 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 96

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV 356
           K+ P  DRV++R  E    SAGGI++P SA   E+   GE++SVG G           +V
Sbjct: 2   KIRPLHDRVVVRRLEEERTSAGGIVIPDSAA--EKPSRGEVISVGPGKPLDNGEVRSLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G ++LF      EV L  +E ++  +E D++ V+E
Sbjct: 60  KVGDQILFGKYAGTEVKLAGDE-YIVMREDDIMGVIE 95



>sp|Q8GBD3|CH10_ACEAC 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB081586_10380 Acetobacter aceti groESL
           operon (groES, groEL), complete cds.
          Length = 97

 Score = 52.8 bits (125), Expect = 6e-06
 Identities = 35/97 (36%), Positives = 55/97 (56%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           TK  P  DRV++R  E  +K+AGGI++P +A   E+ + GE+++VG G           +
Sbjct: 2   TKFRPLHDRVVVRRLEGEQKTAGGIIIPDTAQ--EKPMEGEVVAVGPGARNEQGQIVALD 59

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G +VLF   +  EV +  EE  +  KE D++ VV
Sbjct: 60  VKAGDRVLFGKWSGTEVKIDGEEL-LIMKESDIMGVV 95



>gb:AE017340_458035 Idiomarina loihiensis L2TR, complete genome.
          Length = 96

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+I+  E+  KSAGGI+L  SA   E+   GEI++VG G           +V
Sbjct: 2   KLRPLHDRVIIKRTEVEAKSAGGIVLTGSAA--EKSTRGEIVAVGKGRILDNGEVRALDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KVLF++    +      E ++   E D+LAV E
Sbjct: 60  KAGDKVLFNEGYGVKTEKIDGEEYLIMSESDILAVEE 96



>gb:AY871850_2150014 Synthetic construct hypothetical protein
           (FTT1695) gene, complete cds.
          Length = 130

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRVL+R  E  +KSAGGI+L  SA   E+   GE+++VG G           +V+ G
Sbjct: 31  PLQDRVLVRRAEEEKKSAGGIILTGSAQ--EKPSQGEVVAVGNGKKLDNGTTLPMDVKVG 88

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVLF   +  EV +G +E  +  +E D++ ++
Sbjct: 89  DKVLFGKYSGSEVKVG-DETLLMMREEDIMGII 120



>gb:AF233745_1779476 Lycopersicon esculentum chaperonin 21
           precursor, mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 253

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 10/127 (7%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--------EV 356
           T + P  DRVL++++   EK+ GGILLP S     +   GE+++VG G S         V
Sbjct: 60  TTLKPLGDRVLVKIKTAEEKTVGGILLPVSVQ--SKPNGGEVVAVGEGHSAGKTKVDISV 117

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE--*IAHLQRQCRHAIFRVVSVSS 530
           +TG +V++S     EV      +H+  KE D++ ++E   +  LQ      + +V     
Sbjct: 118 KTGAQVIYSKYAGTEVEF-DGSKHLILKEDDIVGILETDDVKDLQPLNDRVLIKVAEAEE 176

Query: 531 CTCAGSL 551
            T  G L
Sbjct: 177 KTAGGLL 183



 Score = 42.4 bits (98), Expect = 0.009
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVLI++ E  EK+AGG+LL ++A   E+  +G I++VG G  +         V  G
Sbjct: 162 PLNDRVLIKVAEAEEKTAGGLLLTEAAK--EKPSIGTIIAVGPGPLDEEGNRKPLSVSPG 219

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     E        ++  +  D++AV+
Sbjct: 220 NTVLYSKYAGSEFKGADGSDYITLRVSDVMAVL 252



>gb:AJ749949_532152 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774931_2149644 Synthetic construct
           Francisella tularensis clone FLH151456.01X NT02FT1539
           gene, complete cds.
          Length = 95

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRVL+R  E  +KSAGGI+L  SA   E+   GE+++VG G           +V+ G
Sbjct: 5   PLQDRVLVRRAEEEKKSAGGIILTGSAQ--EKPSQGEVVAVGNGKKLDNGTTLPMDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVLF   +  EV +G +E  +  +E D++ ++
Sbjct: 63  DKVLFGKYSGSEVKVG-DETLLMMREEDIMGII 94



>gb:AF054630_473929 Oscillatoria sp. NKBG091600 GroES gene, complete
           cds; and GroEL gene, partial cds.
          Length = 103

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 37/95 (38%), Positives = 51/95 (53%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DRV +++    EK+AGGILLP +A    +  +GEI +VG G           EV+
Sbjct: 11  VKPLGDRVFVKVNASEEKTAGGILLPDTAK--XKPQVGEIAAVGPGRRNDDGSRQEVEVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KVL+S     ++ L  EE +V     D+LAVV
Sbjct: 69  VGDKVLYSKYAGTDIKLSGEE-YVLLSXXDILAVV 102



>sp|O83977|CH10_TREPA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A71253|A71253 probable chaperonin (groES)
           - syphilis spirochete>gb:AE001269_33834 Treponema
           pallidum subsp. pallidum str. Nichols section 85 of 87
           of the complete genome.>gb:AE000520_1050062 Treponema
           pallidum subsp. pallidum str. Nichols complete genome.
          Length = 88

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 30/90 (33%), Positives = 53/90 (58%), Gaps = 2/90 (2%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--EVETGKKVL 377
           K++P ADRVL++ ++   K+A GI++P +A   E+   G +++VG+     +V  G++V+
Sbjct: 2   KIIPLADRVLVKTDKSETKTASGIIIPDTAQ--EKMQSGTVIAVGSDSEKIKVSVGQRVM 59

Query: 378 FSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                   V +  EE H+  K  D+LAV+E
Sbjct: 60  HDKYAGNPVKIDGEE-HLLLKGADILAVIE 88



>sp|P42376|CH10_PORGI 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:POYPGGROE_159130 Porphyromonas gingivalis
           PggroES and PggroEL genes for heat shock protein 60
           (GroEL) like protein.>gb:AE017173_396855 Porphyromonas
           gingivalis W83 section 2 of 8 of the complete
           genome.>gb:BNRGROES_749328 Bacteroides gingivalis genes
           for GroES and GroEL, complete cds.>gb:AE015924_1032466
           Porphyromonas gingivalis W83 complete genome.
          Length = 89

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 4/90 (4%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVE----TGKKV 374
           + P ADRVL++     EK+  GI++P SA   E+ L GE+++VG G  + E     G  V
Sbjct: 3   IKPLADRVLVKPAAAEEKTVSGIIIPDSAK--EKPLKGEVIAVGNGTKDEEMVLKAGDTV 60

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           L+      E+ L   E+++  ++ D+LA++
Sbjct: 61  LYGKYAGTEIEL-EGEKYIIMRQNDVLAII 89



>sp|P30719|CH10_CLOAB 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A41872|A41872 heat shock protein groES -
           Clostridium acetobutylicum>pir|G97232|G97232
           co-chaperonin GroES, HSP10 family [imported] -
           Clostridium acetobutylicum>gb:AE007768_230011
           Clostridium acetobutylicum ATCC 824 section 256 of 356
           of the complete genome.>gb:CLOGROESLA_848609 Clostridium
           acetobutylicum groES gene, complete cds; groEL gene,
           complete cds; and ORFZ.>gb:AE001437_1092966 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 95

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 8/96 (8%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVE 359
           K+ P  DRV+I+  E  E +  GI+LP SA   E+  M E+++VG G          +V+
Sbjct: 2   KIRPLGDRVVIKRLEAEETTKSGIVLPSSAK--EKPQMAEVVAVGPGGVVDGKEIQMQVK 59

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           TG KV FS  +  E+ +  EE  +  ++ D+L +VE
Sbjct: 60  TGDKVFFSKYSGTEIKVDNEEL-LILRQDDILGIVE 94



>sp|P31295|CH10_CHRVI 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A47073|A47073 chaperonin GroES -
           Chromatium vinosum>gb:CVNGROESLA_119768 GROESL;
           Chromatium vinosum; groEL; 2253 base-pairs.
          Length = 96

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++R  E    SAGGI++P SA   E+ + GEI++VG G           +V+ G
Sbjct: 5   PLHDRVVVRRMEEERLSAGGIVIPDSAT--EKPIQGEIIAVGHGKILDNGSVRALDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             VLF   +  EV L  +E  +  +E D++AVVE
Sbjct: 63  DSVLFGKYSGTEVKLDGKE-FLVMREEDIMAVVE 95



>pir|T52122|T52122 chaperonin 10 [imported] - Arabidopsis
           thaliana>gb:AF059037_1764897 Arabidopsis thaliana
           chaperonin 10 (CPN10) mRNA, complete cds.
          Length = 254

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 41/159 (25%), Positives = 79/159 (49%), Gaps = 14/159 (8%)
 Frame = +3

Query: 33  LSAPSLSMASGFLSLAKPFTSQPINIPSLSPAPRPVGIGLRRNSLR------VNALSQKW 194
           L+A  ++M++  L+      +  + + SL P        LR++  R       + ++ K+
Sbjct: 6   LTASPVTMSARSLASLDGLRASSVKVSSLKPGT------LRQSQFRRLVVKAASVVAPKY 59

Query: 195 EPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS-------- 350
             T + P  DRVL++++E  EK+ GGIL   S  +  +   GE+++VG G +        
Sbjct: 60  --TSIKPLGDRVLVKIKEAEEKTLGGILTFHSTAQ-SKPQGGEVVAVGEGRTIGKNKIDI 116

Query: 351 EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            V TG ++++S     EV    + +H+  KE D++ ++E
Sbjct: 117 TVPTGAQIIYSKYAGTEVEF-NDVKHLILKEDDIVGILE 154



 Score = 40.0 bits (92), Expect = 0.042
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRV I++ E  EK+AGG+LL ++    E+  +G +++VG G  +         V TG
Sbjct: 163 PLNDRVFIKVAEAEEKTAGGLLLTETTK--EKPSIGTVIAVGPGSLDEEGKITPLPVSTG 220

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     +        ++  +  D++A++
Sbjct: 221 STVLYSKYAGNDFKGKDGSNYIALRASDVMAIL 253



>sp|Q8VV85|CH10_BACTR 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB025944_4344 Bacillus thermoglucosidasius
           genes for GroES and GroEL, complete cds.
          Length = 94

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           + P  DRV+I + E  EK+A GI+LP +A   E+   G++++VG G           EVE
Sbjct: 2   IKPLGDRVVIEIVETEEKTASGIVLPDTAK--EKPQEGKVVAVGKGRVLDNGQRVAPEVE 59

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G +++FS     EV    +E ++  +E D+LAV+
Sbjct: 60  VGDRIIFSKYAGTEVKYDGKE-YLILRESDILAVI 93



>gb:CP000009_863883 Gluconobacter oxydans 621H, complete genome.
          Length = 100

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           TK  P  DRV++R     EK+AGGI++P +A   ++   GE++SVG G           +
Sbjct: 6   TKFRPLHDRVVVRRLTGEEKTAGGIIIPDTAK--DKPTEGEVVSVGPGARNEQGQVVALD 63

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G KVLF   +  EV +  EE  +  KE D++ V+
Sbjct: 64  VKAGDKVLFGKWSGTEVKIDGEEL-LIMKESDIMGVI 99



>gb:BA000045_741103 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 103

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/97 (35%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE 353
           T + P  DRVL+++ E  E++AGGI LP +A   E+   GE+++VG G           E
Sbjct: 9   TTLRPLGDRVLVKVVEQEERTAGGIFLPDTAK--EKPQTGEVVAVGPGRLKDDGTRVDPE 66

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G  VL+   +  ++ LG  E ++   E D+LA+V
Sbjct: 67  VKVGDTVLYGKYSGTDLKLGDAE-YMLVAEKDILAIV 102



>gb:BA000040_733486 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 106

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL+R  +  EK+AGGI++P +A   E+   GEI++ G+G           +V+ G
Sbjct: 7   PLHDRVLVRRIDAEEKTAGGIIIPDTAK--EKPQEGEIIAAGSGGRNEQGQLIPIDVKPG 64

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +VLF   +  EV +  ++ ++  KE DLL VV+
Sbjct: 65  DRVLFGKWSGTEVKIDGQD-YLIMKESDLLGVVD 97



>gb:AF274871_494651 Bacillus stearothermophilus groESL operon,
           partial sequence.
          Length = 94

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP +A   E+   G++++VG G           EVE G
Sbjct: 4   PLGDRVVIEIVETEEKTASGIVLPDTAK--EKPQEGKVVAVGKGRVLDNGQRVAPEVEVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +++FS     EV    +E ++  +E D+LAV+
Sbjct: 62  DRIIFSKYAGTEVKYDGKE-YLILRESDILAVI 93



>sp|P77828|CH11_BRAJA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:BJU55047_748935 Bradyrhizobium japonicum
           heat shock protein GroES1 (groES1), heat shock protein
           GroEL1 (groEL1), small heat shock protein HspA (hspA),
           sigma32-like factor RpoH1 (rpoH1), small heat shock
           protein HspB (hspB), and small heat shock protein HspC
           (hspC) genes, complete cds.
          Length = 104

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL+R  +  EK+AGGI++P +A   E+   GEI++ G+G           +V+ G
Sbjct: 5   PLHDRVLVRRIDAEEKTAGGIIIPDTAK--EKPQEGEIIAAGSGGRNEQGQLIPIDVKPG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +VLF   +  EV +  ++ ++  KE DLL VV+
Sbjct: 63  DRVLFGKWSGTEVKIDGQD-YLIMKESDLLGVVD 95



>sp|P94819|CH10_HOLOB 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:D89970_121242 Holospora obtusa DNA for
           GroES, GroEL, complete cds.
          Length = 96

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           TK  P  DR+L++  E  E+++GGI++P +A   E+ + G +++VG G           E
Sbjct: 2   TKFKPLGDRILVKRVEAEERTSGGIVIPDTAK--EKPIEGTVIAVGPGARDPQGNLIALE 59

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G +VLF   +  EV L  E+ ++  KE D+   +
Sbjct: 60  VKQGDRVLFGKWSGTEVKLSGED-YIVMKESDVFGTI 95



>gb:BA000045_742971 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 103

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/92 (36%), Positives = 52/92 (56%), Gaps = 9/92 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL+++    EK+AGGILLP +A   E+  +GE+ +VG G           EV+ G
Sbjct: 13  PLGDRVLVKVLAQEEKTAGGILLPDTAK--EKPQVGEVTAVGEGRITDKGDRLPLEVKVG 70

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAV 461
            KVL++     E+ +  EE ++   E D+LA+
Sbjct: 71  DKVLYAKYAGTELKVAGEE-YILLAEKDILAI 101



>gb:AE017333_446527 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_856341 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 94

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I L E  EK+A GI+LP SA   E+   G++++ G+G           EV+TG
Sbjct: 4   PLGDRVVIELVESEEKTASGIVLPDSAK--EKPQEGKVVAAGSGRVLESGERVALEVKTG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
            +++FS     EV   GT+  ++  +E D+LAV+
Sbjct: 62  DRIIFSKYAGTEVKYEGTD--YLILRESDILAVI 93



>sp|P94797|CH10_FRATU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:FTGRO_136305 F.tularensis groES and groEL
           genes.
          Length = 95

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRVL+R  E  +KSAGGI+L  +A   E+   GE+++VG G           +V+ G
Sbjct: 5   PLQDRVLVRRAEEEKKSAGGIILTGNAQ--EKPSQGEVVAVGNGKKLDNGTTLPMDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVLF   +  EV +G +E  +  +E D++ ++
Sbjct: 63  DKVLFGKYSGSEVKVG-DETLLMMREEDIMGII 94



>sp|Q37761|CH10_CYAPA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|T06830|T06830 chaperonin groES -
           Cyanophora paradoxa cyanelle>gb:CPU30821_1648741
           Cyanophora paradoxa cyanelle, complete
           genome.>gb:CPU30821_1648861 Cyanophora paradoxa
           cyanelle, complete genome.
          Length = 103

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  +RVL+++ +  EK+AGGILLP +    E+  +GEI++ G G           EV 
Sbjct: 11  VRPLGERVLVKVSQSEEKTAGGILLPDTVK--EKPQIGEIIAEGPGRRNDDGSFQPLEVT 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
              KVL+S     ++ L  EE +V   E D+LA++
Sbjct: 69  VNSKVLYSKYAGTDIKLENEE-YVLLSEKDILAII 102



>gb:AP003510_1830132 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0528E04.
          Length = 252

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 8/97 (8%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--------EV 356
           T + P  DRVL++L    EK+ GGILLP +A    +   GE+++VG G +         +
Sbjct: 59  TSLKPLGDRVLVKLGAAEEKTVGGILLPSTAQ--SKPQGGEVVAVGEGRTIGDKKVEVSL 116

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G +V++S     EV    + +H+  KE D++ V+E
Sbjct: 117 QIGAEVVYSKYAGTEVQF-NDTKHLILKEDDIIGVLE 152



 Score = 38.5 bits (88), Expect = 0.12
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVLI++ E  +K+AGG++L ++    E+  +G +++VG G  +         V  G
Sbjct: 161 PLNDRVLIKVAEAEDKTAGGLILTETTK--EKPSIGTVVAVGPGPLDDEGKRQPLSVSAG 218

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             V++S     E        ++  +  D++AV+
Sbjct: 219 STVMYSKYAGSEFKGADGTNYIVLRVSDVMAVL 251



>gb:AP003510_1830131 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0528E04.
          Length = 235

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 8/97 (8%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--------EV 356
           T + P  DRVL++L    EK+ GGILLP +A    +   GE+++VG G +         +
Sbjct: 59  TSLKPLGDRVLVKLGAAEEKTVGGILLPSTAQ--SKPQGGEVVAVGEGRTIGDKKVEVSL 116

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G +V++S     EV    + +H+  KE D++ V+E
Sbjct: 117 QIGAEVVYSKYAGTEVQF-NDTKHLILKEDDIIGVLE 152



 Score = 34.7 bits (78), Expect = 1.8
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKK 371
           P  DRVLI++ E  +K+AGG++L ++    E+  +G +++VG G  + E GK+
Sbjct: 161 PLNDRVLIKVAEAEDKTAGGLILTETTK--EKPSIGTVVAVGPGPLDDE-GKR 210



>gb:BX897700_829283 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 98

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/93 (34%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DRV++R  E   K+AGGI++P +A   E+   GEI++VG G           EV+TG
Sbjct: 8   PLHDRVVVRRVESENKTAGGIIIPDTAK--EKPQEGEIIAVGNGALDDNGKRVPLEVKTG 65

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            ++LF   +  EV +  E+  +  KE D++ ++
Sbjct: 66  DRILFGKWSGTEVKINGEDL-LIMKESDIMGIL 97



>gb:BX248584_763696 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 97

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+++ +E+  KS+GGI+L  SA    +   GE+L+VG G           +V
Sbjct: 2   KIRPLHDRVIVKRKEVESKSSGGIVLTGSAA--GKSTRGEVLAVGHGRVLENGGIKALDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             G  ++F+D    +V     E  +   E D+LA+VE
Sbjct: 60  RVGDTIIFNDGYGVKVEKIDNEEVLIMSENDILAIVE 96



>gb:BA000043_736825 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 93

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DR++I + E  EK+A GI+LP +A   E+   G +++VG G           EVE G
Sbjct: 3   PLGDRIVIEVVETEEKTASGIVLPDTAK--EKPQEGRVVAVGAGRVLDNGQRIAPEVEVG 60

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +++FS     EV    +E ++  +E D+LAV+
Sbjct: 61  DRIIFSKYAGTEVKYDGKE-YLILRESDILAVI 92



>pir|F75499|F75499 chaperonin - Deinococcus radiodurans (strain
           R1)>gb:AE001918_40883 Deinococcus radiodurans R1 section
           55 of 229 of the complete chromosome
           1.>gb:AE000513_881778 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 120

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 37/108 (34%), Positives = 58/108 (53%), Gaps = 10/108 (9%)
 Frame = +3

Query: 174 NALSQKWEPTKVVPQADRVLIRL-EELPEKSAGGILLPKSAVKFERYLMGEILSVGTG-- 344
           +++S    P  + P  DRVL+ + EE  +K+AGG+ +P SA   E+   G++++VGTG  
Sbjct: 16  HSISLTGGPHMLKPLGDRVLVEIIEEAEQKTAGGLYVPDSAK--EKSQRGKVVAVGTGKT 73

Query: 345 -------VSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                    EV+ G  V F+     EV+L   + +    E DLLA+VE
Sbjct: 74  LDNGTKVAMEVKEGDTVYFAKYGGTEVSL-EGKNYSLLSERDLLAIVE 120



>sp|Q981K0|CH15_RHILO 10 kDa chaperonin 5 (Protein Cpn10 5) (groES
           protein 5).>gb:MLO672115_148733 Mesorhizobium loti R7A
           symbiosis island; segment 4/4.>gb:BA000013_672998
           Mesorhizobium loti MAFF303099 pMLa DNA, cpmplete genome.
          Length = 98

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           +K  P  DRV++R  E   K+AGGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   SKFRPLHDRVVVRRVESESKTAGGIIIPDTAK--EKPQEGEIIAVGSGARDEAGKLVPLD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G ++LF   +  EV L  E+  +  KE D++ ++
Sbjct: 62  VKAGDRILFGKWSGTEVKLNGEDL-LIMKESDIMGII 97



>sp|Q983S3|CH14_RHILO 10 kDa chaperonin 4 (Protein Cpn10 4) (groES
           protein 4).>gb:BA000012_672419 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 98

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           +K  P  DRV++R  E   K+AGGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   SKFRPLHDRVVVRRVESESKTAGGIIIPDTAK--EKPQEGEIIAVGSGARDESGKLVPLD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G ++LF   +  EV L  E+  +  KE D++ ++
Sbjct: 62  VKAGDRILFGKWSGTEVKLNGEDL-LIMKESDIMGII 97



>gb:BA000030_703065 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 118

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 34/83 (40%), Positives = 48/83 (57%), Gaps = 3/83 (3%)
 Frame = +3

Query: 222 DRVLIRLE--ELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA 395
           DRVL+R +  E   +S GGIL+P +A    R    E+++VG  V  VETG +VL+   + 
Sbjct: 22  DRVLVRQDTSEGERRSGGGILIPATAAVGRRLAWAEVVAVGQNVRTVETGDRVLYDPEDR 81

Query: 396 YEVNL-GTEERHVFCKEGDLLAV 461
            EV + GT   +V  +E DL AV
Sbjct: 82  AEVEVRGT--AYVLMRERDLHAV 102



>gb:AJ749669_530407 Bartonella henselae groES gene, groEL gene and
           phnA gene.>gb:BX897699_827944 Bartonella henselae strain
           Houston-1, complete genome.
          Length = 98

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 31/93 (33%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DRV++R  E   K+AGGI++P +A   E+   GE+++VG G           EV+TG
Sbjct: 8   PLHDRVVVRRVESENKTAGGIIIPDTAK--EKPQEGEVIAVGNGALDDNGKRVPLEVKTG 65

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            ++LF   +  EV +  E+  +  KE D++ ++
Sbjct: 66  DRILFGKWSGTEVKINGEDL-LIMKESDIMGIL 97



>gb:TAU29483_197342 Thermus aquaticus GroES-like chaperonin (hsp60)
           and GroEL-like chaperonin (hsp10) genes, complete cds.
          Length = 102

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 32/98 (32%), Positives = 52/98 (53%), Gaps = 9/98 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE 353
           T + P  DRV+++  E   K+ GGI+LP +A   E+   G++++VGTG           E
Sbjct: 7   TVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAK--EKPQKGKVIAVGTGRVLENGQRVPLE 64

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G  V+F+     E+ +     +V   E DLLAV++
Sbjct: 65  VKEGDIVVFAKYGGTEIEIAPRRTYVILSERDLLAVLQ 102



>gb:D88802_121176 Bacillus subtilis DNA for phoB-rrnE-groESL region,
           complete cds.
          Length = 108

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I L E  EK+A GI+LP SA   E+   G+I++ G+G           EV+ G
Sbjct: 18  PLGDRVVIELVESEEKTASGIVLPDSAK--EKPQEGKIVAAGSGRVLESGERVALEVKEG 75

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
            +++FS     EV   GTE  ++  +E D+LAV+
Sbjct: 76  DRIIFSKYAGTEVKYEGTE--YLILRESDILAVI 107



>pir|JN0513|JN0513 heat shock protein groES (clone Rhz C) -
           Rhizobium meliloti>gb:RHMGROESLC_163837 Rhizobium
           meliloti (strain RM 1021, clones pGEM-RhzC1, RhzC2 and
           RhzC3) GroEL and GroES proteins (groESL operon C)
           complete cds's.
          Length = 101

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L+R  E  EK+ GGI++P +A   E+   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRILVRRVESEEKTKGGIIIPDTAK--EKPQEGEVLAVGPGARGEQGQIQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            ++LF   +  E+ +  E+  +  KE D++ ++E
Sbjct: 63  DRILFGKWSGTEIKIDGEDL-LIMKESDVMGIIE 95



>pir|A49855|A49855 heat shock protein GroES - Bacillus
           stearothermophilus
          Length = 94

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 33/93 (35%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP +A   E+   G +++VG G           EVE G
Sbjct: 4   PLGDRVVIEVIETEEKTASGIVLPDTAK--EKPQEGRVVAVGKGRVLDSGERVAPEVEVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +++FS     EV    +E ++  +E D+LAV+
Sbjct: 62  DRIIFSKYAGTEVKYDGKE-YLILRESDILAVI 93



>sp|P35474|CH15_RHIME 10 kDa chaperonin 5 (Protein Cpn10 5) (groES
           protein 5).
          Length = 104

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L+R  E  EK+ GGI++P +A   E+   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRILVRRVESEEKTKGGIIIPDTAK--EKPQEGEVLAVGPGARGEQGQIQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            ++LF   +  E+ +  E+  +  KE D++ ++E
Sbjct: 63  DRILFGKWSGTEIKIDGEDL-LIMKESDVMGIIE 95



>sp|Q9Z463|CH10_PARDE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB015985_2670 Paracoccus denitrificans
           genes for chaperonin 10 and chaperonin 60, complete cds.
          Length = 95

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL+R  +  EK+ GG+++P SA   E+   GEI SVG G  +         V+ G
Sbjct: 5   PLHDRVLVRRVQSDEKTKGGLIIPDSAK--EKPAEGEITSVGEGARKDSGELIAPAVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +  EE  +  KE D+L ++
Sbjct: 63  DRVLFGKWSGTEVTVDGEEL-LIMKESDILGII 94



>sp|P25968|CH10_BRUME 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A43827|A43827 chaperonin groES - Brucella
           abortus>pir|AF3640|AF3640 10K chaperonin groES
           [imported] - Brucella melitensis  (strain
           16M)>gb:AE009737_255026 Brucella melitensis 16M
           chromosome II, section 99 of 107 of the complete
           sequence.>gb:AE014292_309778 Brucella suis 1330
           chromosome II, complete sequence.>gb:BRUGRO_749969
           Brucella abortus heat shock protein (groES and groEL)
           genes, complete cds.>gb:BRUGROE_749971 Brucella abortus
           groEL and groES genes, complete cds.>gb:AE008918_980938
           Brucella melitensis 16M chromosome II, complete
           sequence.
          Length = 98

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV 356
           K  P  DRV++R  E   K+AGGI++P +A   E+   GE+++ G G           +V
Sbjct: 5   KFRPLHDRVVVRRVESEAKTAGGIIIPDTAK--EKPQEGEVVAAGAGARDEAGKLVPLDV 62

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G +VLF   +  EV +G E+  +  KE D+L +V
Sbjct: 63  KAGDRVLFGKWSGTEVKIGGEDL-LIMKESDILGIV 97



>sp|P28599|CH10_BACSU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A41884|A41884 heat shock protein
           (chaperonin) groES - Bacillus
           subtilis>gb:BACGROEL_745397 Bacillus subtilis groES and
           groEL genes, complete cds.>gb:BACGROESL_745399 Bacillus
           subtilis heat shock protein (groEL and groES) genes,
           complete cds.>gb:BACHSPA_745447 B.subtilis groES and
           groEL genes, complete cds's.>gb:BSUB0004_752567 Bacillus
           subtilis complete genome (section 4 of 21): from 611631
           to 813719.
          Length = 94

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I L E  EK+A GI+LP SA   E+   G+I++ G+G           EV+ G
Sbjct: 4   PLGDRVVIELVESEEKTASGIVLPDSAK--EKPQEGKIVAAGSGRVLESGERVALEVKEG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
            +++FS     EV   GTE  ++  +E D+LAV+
Sbjct: 62  DRIIFSKYAGTEVKYEGTE--YLILRESDILAVI 93



>sp|Q07200|CH10_BACST 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB028452_4598 Bacillus sp. MS gene for
           Cpn10 and Cpn60, complete cds.>gb:BACSGROESL_746333
           Bacillus stearothermophilus GroES (groES) and GroEL
           (groEL) genes, complete cds.
          Length = 94

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 33/93 (35%), Positives = 51/93 (54%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP +A   E+   G +++VG G           EVE G
Sbjct: 4   PLGDRVVIEVIETEEKTASGIVLPDTAK--EKPQEGRVVAVGKGRVLDSGERVAPEVEVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +++FS     EV    +E ++  +E D+LAV+
Sbjct: 62  DRIIFSKYAGTEVKYDGKE-YLILRESDILAVI 93



>gb:AY680699_1622084 Vitis vinifera chloroplast chaperonin 21
           (cpn21) gene, complete cds; nuclear gene for chloroplast
           product.
          Length = 251

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 8/97 (8%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE--------V 356
           T + P  DRVL++++   EK+ GGILLP +A    +   GE+++VG G +         V
Sbjct: 58  TSLKPLGDRVLVKIKTAEEKTVGGILLPTTAQ--TKPQGGEVVAVGEGKTIGKNKLDICV 115

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +TG +V++S     EV       H+  KE D++ ++E
Sbjct: 116 KTGAQVVYSKYAGTEVEF-NGSNHLILKEDDIVGILE 151



 Score = 41.2 bits (95), Expect = 0.019
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVLI++ E  EK+AGG+LL +++   E+  +G +++VG G  +         V  G
Sbjct: 160 PLNDRVLIKVAEAEEKTAGGLLLTEASK--EKPSIGTVVAVGPGPLDEDGKRKPLSVSPG 217

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     +        ++  K  D++AV+
Sbjct: 218 NTVLYSKYAGNDFKGSDGSDYIALKASDIMAVL 250



>sp|Q98AX8|CH13_RHILO 10 kDa chaperonin 3 (Protein Cpn10 3) (groES
           protein 3).>gb:BA000012_670481 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 98

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 31/93 (33%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRV++R  E   K+AGGI++P +A   E+   GEI++VG+G           +V+ G
Sbjct: 8   PLHDRVVVRRVESESKTAGGIIIPDTAK--EKPQEGEIIAVGSGARDEAGKLVPLDVKAG 65

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            ++LF   +  EV L  E+  +  KE D++ ++
Sbjct: 66  DRILFGKWSGTEVKLNGEDL-LIMKEADIMGII 97



>sp|P26879|CH10_LEGPN 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock protein A).>pir|B41468|B41468 heat
           shock protein groES - Legionella
           pneumophila>gb:CR628336_110854 Legionella pneumophila
           str. Paris complete genome.>gb:CR628337_113921
           Legionella pneumophila str. Lens complete
           genome.>gb:LPNHTPAH_142014 Legionella pneumophila htp
           heat shock operon HtpA (htpA), complete
           cds.>gb:AE017354_459062 Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1, complete genome.
          Length = 96

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV++R  E    +AGGI++P SA   E+ + GEI++VG G            V
Sbjct: 2   KIRPLHDRVVVRRMEEERTTAGGIVIPDSAT--EKPMRGEIIAVGAGKVLENGDVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  VLF   +  EV +  +E  V  +E D++ V+E
Sbjct: 60  KVGDVVLFGKYSGTEVKVDGKEL-VVMREDDIMGVIE 95



>gb:BX908798_830735 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 106

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 9/98 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE--------- 353
           TK+ P  +RVL+R     EK  GGI+LP +A K +     E++++GTG  +         
Sbjct: 11  TKLKPLGNRVLVRRLAAEEKLKGGIILPDTAKKKQE--QAEVIAIGTGKKDKNGTLVPMP 68

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G  +L    +  E+ L  EE  V  +  D++A+VE
Sbjct: 69  VKIGDVILMEKYSGQEITLNDEEL-VILRADDIIAIVE 105



>gb:AE016871_353739 Pseudomonas syringae pv. tomato str. DC3000
           section 16 of 21 of the complete
           genome.>gb:AE016853_1038914 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 97

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 37/97 (38%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GEI++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEETKTAGGIVLPGSAA--EKPNRGEIVAVGTGRVLDNGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAVVE
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVVE 96



>gb:CP000031_84937 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 95

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL+R  E  EK+AGG+++P SA   E+   G +++ G G  +         V++G
Sbjct: 5   PLHDRVLVRRTESEEKTAGGLIIPDSAK--EKPSEGVVVACGEGARKDSGELIAMAVKSG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +VLF   +  EV +  EE  +  KE D++ ++E
Sbjct: 63  DRVLFGKWSGTEVTVDGEEL-LMMKESDIMGIIE 95



>sp|P35473|CH11_RHIME 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>pir|JN0510|JN0510 heat shock protein groES
           (clone Rhz A) - Rhizobium meliloti>gb:RHMGROESLA_163835
           Rhizobium meliloti (strain RM 1021, clone pGEM-RhzA)
           GroEL and GroES (groESL operon A) genes, complete
           cds's.>gb:RLY12484_164532 R.leguminosarum cpn10-2 gene,
           cpn60-2 gene, partial.>gb:RMU19726_166484 Rhizobium
           meliloti GroES (groES) and GroEL (groEL) genes, complete
           cds.>gb:SME591785_184811 Sinorhizobium meliloti 1021
           complete chromosome; segment 4/12.
          Length = 98

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           T   P  DRV++R  E  EK+ GGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   TNFRPLHDRVVVRRVESEEKTKGGIIIPDTAK--EKPQEGEIVAVGSGARDESGKVVPLD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G ++LF   +  EV +  E+  +  KE D++ V+
Sbjct: 62  VKAGDRILFGKWSGTEVKINGEDL-LIMKEADIMGVI 97



>sp|Q8ZIY4|CH10_YERPE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|AF0043|AF0043 10 kDa chaperonin [imported]
           - Yersinia pestis (strain CO92)>gb:AE013663_298938
           Yersinia pestis KIM section 63 of 415 of the complete
           genome.>gb:AE017128_386352 Yersinia pestis biovar
           Medievalis str. 91001 section 2 of 16 of the complete
           genome.>gb:AJ414142_522202 Yersinia pestis strain CO92
           complete genome; segment 2/20.>gb:BX936398_835049
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_929121 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142918 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 97

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+++ +E+  KSAGGI+L  +A    +   GE+L+VG G           +V
Sbjct: 2   KIRPLHDRVIVKRKEVESKSAGGIVLTGTAA--GKSTRGEVLAVGNGRILDNGEIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F+D    +      E  +   E D+LA+VE
Sbjct: 60  KVGDVVIFNDGYGVKAEKIDNEEVLIMSESDILAIVE 96



>sp|P26195|CH10_LEGMI 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock protein A).>pir|A54539|A54539 heat
           shock protein groES - Legionella micdadei
          Length = 96

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV++R  E    +AGGI++P SA   E+   GEI++VG G            V
Sbjct: 2   KIRPLHDRVVVRRMEEERTTAGGIVIPDSAT--EKPTRGEIIAVGPGKVLENGDVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  VLF   +  EV +  +E  V  +E D++ V+E
Sbjct: 60  KVGDVVLFGKYSGTEVKISGQEL-VVMREDDIMGVIE 95



>gb:AP004671_1843084 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0524G08.
          Length = 98

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V 356
           +++P  +RVL+     P+KSAGGILLP+++ +      G++++VG G  +         +
Sbjct: 4   RLIPSLNRVLVEKLVQPKKSAGGILLPETSKQLN---SGKVVAVGPGERDKDGKLIPVAL 60

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G  VL  +    EV L  E+ ++  +E D+L  +
Sbjct: 61  KEGDTVLLPEYGGLEVKLAAEKEYLLFREHDILGTL 96



>gb:AE016779_330797 Pseudomonas putida KT2440 section 6 of 21 of the
           complete genome.>gb:AE015451_945874 Pseudomonas putida
           KT2440 complete genome.
          Length = 97

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 36/97 (37%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GE+++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEESKTAGGIVLPGSAA--EKPNRGEVVAVGTGRVLDNGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAVVE
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVVE 96



>gb:TTH250409_198461 Thermus thermophilus chpS gene for
           chaperonin-10 and cpnL gene for
           chaperonin-60.>gb:TTHCA_198508 Thermus thermophilus gene
           for chaperonin-10 and chaperonin-60, complete
           cds.>gb:AE017306_437347 Thermus thermophilus HB27
           section 6 of 7 of the complete
           genome.>gb:AP008226_577729 Thermus thermophilus HB8
           genomic DNA, complete genome.>gb:AE017221_1079325
           Thermus thermophilus HB27 complete genome.
          Length = 101

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE 353
           T + P  DRV+++  E   K+ GGI+LP +A   E+   G++++VGTG           E
Sbjct: 7   TVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAK--EKPQKGKVIAVGTGRVLENGQRVPLE 64

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G  V+F+     E+ +  EE +V   E DLLAV++
Sbjct: 65  VKEGDIVVFAKYGGTEIEIDGEE-YVILSERDLLAVLQ 101



>pir|A36917|A36917 heat shock protein GroES - Agrobacterium
           tumefaciens>gb:ATGROEOP_583186 A.tumefaciens groE operon
           DNA.
          Length = 98

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           T   P  DRV++R  E   K+ GGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   TNFRPLHDRVVVRRVESEAKTKGGIIIPDTAK--EKPQEGEIVAVGSGARDEAGKVVALD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G +VLF   +  EV L  E+  +  KE D++ ++
Sbjct: 62  VKVGDRVLFGQWSGTEVKLDGEDSSIM-KEADIMGII 97



>pir|T03585|T03585 probable chaperonin 10 - rice>gb:AF009413_1761104
           Oryza sativa 10 kDa chaperonin mRNA, complete cds.
          Length = 98

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V 356
           +++P  +RVL+     P+KSAGGILLP+++ +      G++++VG G  +         +
Sbjct: 4   RLIPSLNRVLVEKLVQPKKSAGGILLPETSKQLN---SGKVVAVGPGERDKDGKLIPVAL 60

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G  VL  +    EV L  E+ ++  +E D+L  +
Sbjct: 61  KEGDTVLLPEYGGLEVKLAAEKEYLLFREHDILGTL 96



>sp|P61492|CH10_THET2 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>sp|P61493|CH10_THETH 10 kDa chaperonin
           (Protein Cpn10) (groES protein).
          Length = 100

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 34/98 (34%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE 353
           T + P  DRV+++  E   K+ GGI+LP +A   E+   G++++VGTG           E
Sbjct: 6   TVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAK--EKPQKGKVIAVGTGRVLENGQRVPLE 63

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G  V+F+     E+ +  EE +V   E DLLAV++
Sbjct: 64  VKEGDIVVFAKYGGTEIEIDGEE-YVILSERDLLAVLQ 100



>sp|O33499|CH10_PSEST 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock protein 10).>gb:PSY13828_161953
           Pseudomonas stutzeri hsp60 gene.
          Length = 97

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 36/97 (37%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GE+++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEETKTAGGIVLPGSAA--EKPNRGEVVAVGTGRVLDNGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAVVE
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMSENEILAVVE 96



>sp|P48226|CH10_PSEPU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S51562|S51562 heat shock protein groES -
           Pseudomonas putida>gb:PPGROESL_159284 P.putida (WCS358)
           GroES and GroEL genes of the GroESL operon.
          Length = 97

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 36/97 (37%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GEI++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEESKTAGGIVLPGSAA--EKPNRGEIVAVGTGRILENGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAV+E
Sbjct: 60  KVGDKVVFGPYSGSNTVKVDGEDLLVMAENEILAVIE 96



>sp|Q8CXL4|CH10_OCEIH 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BA000028_695042 Oceanobacillus iheyensis
           HTE831 DNA, complete genome.
          Length = 93

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVET 362
           + P  DRV+I L E  E +A GI+LP SA   E+   G++++VG+G          EV  
Sbjct: 2   IKPLGDRVVIELVEQEETTASGIVLPDSAK--EKPQEGKVVAVGSGRVENGEKIALEVSE 59

Query: 363 GKKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
           G +++FS     EV   GTE  ++  +E D+LA++
Sbjct: 60  GDRIIFSKFAGTEVKYEGTE--YLILRENDILAII 92



>sp|Q9RWR0|CH10_DEIRA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).
          Length = 95

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 35/95 (36%), Positives = 52/95 (54%), Gaps = 10/95 (10%)
 Frame = +3

Query: 213 PQADRVLIRL-EELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVET 362
           P  DRVL+ + EE  +K+AGG+ +P SA   E+   G++++VGTG           EV+ 
Sbjct: 4   PLGDRVLVEIIEEAEQKTAGGLYVPDSAK--EKSQRGKVVAVGTGKTLDNGTKVAMEVKE 61

Query: 363 GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           G  V F+     EV+L   + +    E DLLA+VE
Sbjct: 62  GDTVYFAKYGGTEVSL-EGKNYSLLSERDLLAIVE 95



>gb:AF239163_491597 Rhizobium leguminosarum cpn-2 (groE) operon,
           complete sequence.
          Length = 104

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 28/94 (29%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L+R  +  EK+ GGI++P +A   E+   GE+++VG G           +V+ G
Sbjct: 5   PLHDRILVRRVDSEEKTKGGIIIPDTAK--EKPQEGEVIAVGPGARNDAGQIQALDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            ++LF   +  E+ +  E+  +  KE D++ ++E
Sbjct: 63  DRILFGKWSGTEIKINGEDL-LIMKESDVMGIIE 95



>sp|Q92ZQ3|CH14_RHIME 10 kDa chaperonin 4 (Protein Cpn10 4) (groES
           protein 4).>pir|D95311|D95311 groES2 chaperonin
           [imported] - Sinorhizobium meliloti  (strain 1021)
           magaplasmid pSymA>gb:AE007230_224356 Sinorhizobium
           meliloti 1021 plasmid pSymA section 36 of 121 of the
           complete plasmid sequence.>gb:AE006469_1102124
           Sinorhizobium meliloti 1021 plasmid pSymA, complete
           sequence.
          Length = 98

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRV++R  E  EK+ GG+++P +A   E+   GEI++VG+G           +V+ G
Sbjct: 8   PLHDRVVVRRVESEEKTKGGVIIPDTAK--EKPQEGEIVAVGSGARDESGKVVPLDVKAG 65

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            ++LF   +  EV +  E+  +  KE D++ V+
Sbjct: 66  DRILFGKWSGTEVKINGEDL-LIMKEADIMGVI 97



>sp|O50304|CH10_BACHD 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A83720|A83720 class I heat-shock protein
           (chaperonin) groES [imported] - Bacillus halodurans
           (strain C-125)>gb:BA000004_654507 Bacillus halodurans
           C-125 DNA, complete genome.
          Length = 94

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/93 (35%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I   E  EK+A GI+LP +A   E+   G +++VGTG           EV+ G
Sbjct: 4   PLGDRVVIEQVETEEKTASGIVLPDTAK--EKPQEGRVVAVGTGRVTENGEKIALEVKEG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             V+FS     EV    +E ++  +E D+LA++
Sbjct: 62  DSVIFSKYAGTEVKYDGKE-YLILRESDILAII 93



>gb:AY316747_609071 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 104

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DR+L+R  E  EK+AGGI++P +A   E+   GE+++ G G           +V+  
Sbjct: 5   PLHDRILVRRIEAEEKTAGGIIIPDTAK--EKPQEGEVVATGPGARDDSGQLRPPDVKVA 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            ++LF   +  E+ L  E+  +  KE D++ V+E
Sbjct: 63  DRILFGKWSGTEIKLDGEDL-LIMKESDVMGVIE 95



>gb:AE017024_380547 Bacillus anthracis str. Ames section 1 of 18 of
           the complete genome.>gb:AE017225_405663 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017265_421523 Bacillus cereus ATCC 10987,
           section 2 of 18 of the complete
           genome.>gb:AE017334_450396 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_461568 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_850873 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1010252 Bacillus anthracis str. Ames
           complete genome.>gb:AE017194_1059942 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 94

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I L +  EK+A GI+LP +A   E+   G++++VGTG           EV  G
Sbjct: 4   PLGDRVVIELVQAEEKTASGIVLPDTAK--EKPQEGKVIAVGTGRVLENGERVALEVAAG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
             ++FS     EV   GT+  ++  +E D+LAV+
Sbjct: 62  DLIIFSKYAGTEVKYEGTD--YLILRESDILAVI 93



>gb:AE016924_358976 Chromobacterium violaceum ATCC 12472 section 15
           of 16 of the complete genome.>gb:AE016825_1044130
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 95

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I+  E  EK+A GI+LP +A   E+  MG++L+VG G           E++ G
Sbjct: 5   PLHDRVVIKRLEAEEKTASGIVLPGAAA--EKPDMGQVLAVGNGKILENGERRPLELKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            KV+F   +   V +  EE  V  +E D++ +VE
Sbjct: 63  DKVIFGKYSGQTVKVDGEEVLVM-REEDVMGIVE 95



>gb:AE008692_241666 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 95

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRVL+R     EK+AGGI++P +A   E+   GE+++ G G           +V+ G
Sbjct: 5   PLHDRVLVRRVAAEEKTAGGIIIPDTAK--EKPQEGEVIAAGNGTHSEDGKVVPLDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +  E+  +  KE D+L ++
Sbjct: 63  DRVLFGKWSGTEVRVDGEDL-LIMKESDILGII 94



>gb:AB007637_1124 Bacillus subtilis genomic DNA containing groES to
           gutR region, 48 degree.
          Length = 90

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 10/91 (10%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           DRV+I L E  EK+A GI+LP SA   E+   G+I++ G+G           EV+ G ++
Sbjct: 3   DRVVIELVESEEKTASGIVLPDSAK--EKPQEGKIVAAGSGRVLESGERVALEVKEGDRI 60

Query: 375 LFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
           +FS     EV   GTE  ++  +E D+LAV+
Sbjct: 61  IFSKYAGTEVKYEGTE--YLILRESDILAVI 89



>sp|Q9ANS0|CH10_WIGBR 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF321516_499744 Wigglesworthia glossinidia
           groES (mopA) and groEL (mopB) genes, complete
           cds.>gb:BA000021_687005 Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis DNA, complete
           genome.
          Length = 97

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+I+ +E   KSAGGI+L  SA    +   G++L+VG G           +V
Sbjct: 2   KIRPLHDRVIIKRKEAESKSAGGIVLTGSAA--GKSTRGKVLAVGNGRILDNGETKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F+D    +V     +  +   E D+LA+VE
Sbjct: 60  KIGDIVIFNDGYGVKVEKIDNDEVLIMSESDILAIVE 96



>sp|O87887|CH10_LAWIN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:LIU45241_140674 Lawsonia intracellularis
           plasmid pISI-2 GTP-binding protein homolog gene, partial
           cds, L27 50S ribosomal binding protein homolog, L21 50S
           ribosomal binding protein homolog, GroES/HSP10 homolog,
           and GroEL/HSP60 homolog genes, complete cds.
          Length = 101

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 34/93 (36%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL++  E  EK+AGG+ +P +A   E+   GE+++VG G            V+ G
Sbjct: 5   PLNDRVLVKRLESEEKTAGGLYIPDTAK--EKPSRGEVVAVGPGKHTDDGKLIPMAVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VLF+     EV L   E H+  +E D+LAV+
Sbjct: 63  DTVLFNKYAGTEVKLDGVE-HLVMREDDILAVI 94



>sp|P48223|CH10_CLOTM 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S68248|S68248 chaperonin groES -
           Clostridium thermocellum>gb:CTGROESEL_119527
           C.thermocellum groES and groEL genes.
          Length = 94

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV--------SEVETGK 368
           P  DRV++++ E  E +  GI+LP SA   E+  + E+++VG G          EV+ G 
Sbjct: 5   PLGDRVVVKMVETEETTKSGIVLPGSAK--EKPQVAEVVAVGPGTVVDGKEVKMEVKVGD 62

Query: 369 KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           KV+ S     EV    +E +   ++ D+LAVVE
Sbjct: 63  KVIISKYAGTEVKFDGQE-YTILRQNDILAVVE 94



>sp|Q9KKF1|CH10_CLODI 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF080547_477482 Clostridium difficile
           groESL operon, complete sequence.
          Length = 94

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 8/95 (8%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG--------VSEVET 362
           + P  DRV+I+  E  EK+A GI+LP +A   E+  + E++ VG G          E+  
Sbjct: 3   IKPFGDRVVIKKVEAEEKTASGIVLPGAAK--EQPQIAEVVEVGPGGIVEGKEIKMELTV 60

Query: 363 GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           G KV+F   +  EV +  +E +   ++ D+LAV+E
Sbjct: 61  GDKVIFQKYSGTEVKIEGQE-YTILRQSDVLAVIE 94



>sp|O68308|CH10_AERSA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF030975_470914 Aeromonas salmonicida
           chaperonin GroES and chaperonin GroEL genes, complete
           cds.
          Length = 97

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+I+  E   KSAGGI+L  +A   ++   GE+L+VGTG            V
Sbjct: 2   KIRPLHDRVIIKRIEAEAKSAGGIILAGTAA--QKSTRGEVLAVGTGRILDNGDVKALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F++    +      +  +   E D+LA+VE
Sbjct: 60  KVGDKVIFNEGYGVKTEKLDGQDVLILSETDILAIVE 96



>gb:AY657160_2146170 Synthetic construct Peudomonas aeruginosa clone
           FLH032426.01F PA4386 gene, partial cds.
          Length = 98

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GE+++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEETKTAGGIVLPGSAA--EKPNRGEVVAVGTGRVLDNGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAV+E
Sbjct: 60  KVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLE 96



>gb:AP003510_1830136 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0528E04.>gb:AP006056_1860577 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1172G12.
          Length = 216

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 8/94 (8%)
 Frame = +3

Query: 210 VPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--------EVETG 365
           + + DRVL++L    EK+ GGILLP +A    +   GE+++VG G +         ++ G
Sbjct: 26  IVERDRVLVKLGAAEEKTVGGILLPSTAQ--SKPQGGEVVAVGEGRTIGDKKVEVSLQIG 83

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +V++S     EV    + +H+  KE D++ V+E
Sbjct: 84  AEVVYSKYAGTEVQF-NDTKHLILKEDDIIGVLE 116



 Score = 38.5 bits (88), Expect = 0.12
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVLI++ E  +K+AGG++L ++    E+  +G +++VG G  +         V  G
Sbjct: 125 PLNDRVLIKVAEAEDKTAGGLILTETTK--EKPSIGTVVAVGPGPLDDEGKRQPLSVSAG 182

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             V++S     E        ++  +  D++AV+
Sbjct: 183 STVMYSKYAGSEFKGADGTNYIVLRVSDVMAVL 215



>gb:AY189823_595974 Ruminococcus flavefaciens strain FD-1 groESL
           operon, complete sequence.
          Length = 90

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 4/91 (4%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS----EVETGKKV 374
           + P  DRV++++ E  E +  GI+L  SA   E+    E++ VG G S    EV+ G KV
Sbjct: 3   IKPLQDRVVVKMAEAEETTQSGIILTGSAK--EKPEFAEVIEVGPGTSDVKMEVKKGDKV 60

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           L S  +   V L  EE ++  +  D+LA+V+
Sbjct: 61  LISKYSGTNVKLDGEE-YIIVRMEDILAIVK 90



>gb:AE017315_440226 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 7 of 12 of the complete
           genome.>gb:AE017285_1073387 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 95

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL++  E  EK+AGG+ +P +A   E+   GE+++ G G            V+ G
Sbjct: 5   PLNDRVLVKRLESEEKTAGGLYIPDTAK--EKPSRGEVVAAGPGKTADDGKLVAMTVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             VLF+     E+ +   E H+  +E D+LA++E
Sbjct: 63  DMVLFNKYAGTEIKIDGVE-HLVMREDDILAIIE 95



>gb:AE017249_415982 Treponema denticola ATCC 35405, section 4 of 10
           of the complete genome.>gb:AE017226_1069578 Treponema
           denticola ATCC 35405, complete genome.
          Length = 88

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 30/90 (33%), Positives = 51/90 (56%), Gaps = 2/90 (2%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--EVETGKKVL 377
           KV P  DRVL++ + +  K+AGGI++P +A   E+   G +++VG      +V  G+KV+
Sbjct: 2   KVKPLGDRVLVKPDAVETKTAGGIIIPDTAQ--EKTQRGVVVAVGDDKEKIKVSVGQKVI 59

Query: 378 FSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                  ++ +   + H+  K  DL+AVVE
Sbjct: 60  HDKYAGTQIQIDGVD-HLILKSNDLVAVVE 88



>gb:AE016998_375302 Bacillus cereus ATCC 14579 section 1 of 18 of
           the complete genome.>gb:AE016877_1015552 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 96

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I L +  EK+A GI+LP +A   E+   G++++VGTG           EV  G
Sbjct: 6   PLGDRVVIELVQAEEKTASGIVLPDTAK--EKPQEGKVVAVGTGRVLENGERVALEVAAG 63

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
             ++FS     EV   GT+  ++  +E D+LAV+
Sbjct: 64  DLIIFSKYAGTEVKYEGTD--YLILRESDILAVI 95



>pir|D70192|D70192 chaperonin (groES) homolog - Lyme disease
           spirochete>gb:AE001174_32721 Borrelia burgdorferi B31
           (section 60 of 70) of the complete
           genome.>gb:AE000783_1120372 Borrelia burgdorferi B31
           complete genome.
          Length = 93

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 28/94 (29%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +3

Query: 192 WEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE--VETG 365
           +E   + P ADRVLI+++E   K+  G+ +P++A   E+  +G +++VG+   E  V+ G
Sbjct: 2   FEMKNIKPLADRVLIKIKEAESKTISGLYIPENAK--EKTNIGTVIAVGSNKEEITVKVG 59

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             VL+       V +  +E H+  K  +++A++E
Sbjct: 60  DTVLYEKYAGAAVKIENKE-HLILKAKEIVAIIE 92



>sp|P35863|CH12_BRAJA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>pir|S35308|S35308 heat shock protein groES2
           - Bradyrhizobium japonicum>gb:BA000040_735238
           Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.>gb:BJGROES3B_748856 B.japonicum groES2 and
           groEL2 genes.
          Length = 104

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K  P  DRV+++  +  EK+AGGI++P +    E+   GE+++VG G           +V
Sbjct: 2   KFRPLHDRVVVKRIDAEEKTAGGIIIPDTVK--EKPSQGEVIAVGPGGRDESGKLIPIDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             G +VLF   +  EV + T+E  +  KE D++ V+
Sbjct: 60  RVGDRVLFGKWSGTEVKIDTQEL-LIMKESDIMGVL 94



>sp|P30720|CH10_PSEAE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A43606|A43606 heat shock protein groES -
           Pseudomonas aeruginosa>gb:AE004854_58621 Pseudomonas
           aeruginosa PAO1, section 415 of 529 of the complete
           genome.>gb:PSEGROESL_160616 Pseudomonas aeruginosa heat
           shock protein (groES and groEL) genes, complete
           cds.>gb:S77424_169109 groES=10 kda heat shock protein,
           groEL=57 kda heat shock protein [Pseudomonas aeruginosa,
           P1118, O:3, Genomic, 2047 nt].>gb:AE004091_972721
           Pseudomonas aeruginosa PAO1, complete genome.
          Length = 97

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 35/97 (36%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+IR  E   K+AGGI+LP SA   E+   GE+++VGTG            V
Sbjct: 2   KLRPLHDRVVIRRSEEETKTAGGIVLPGSAA--EKPNRGEVVAVGTGRVLDNGEVRALAV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G KV+F   +         E  +   E ++LAV+E
Sbjct: 60  KVGDKVVFGPYSGSNAIKVDGEELLVMGESEILAVLE 96



>sp|Q9F4E6|CH10_BUCTT 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401309_747019 Buchnera aphidicola
           (Tuberolachnus salignus) groES gene and partial groEL
           gene.
          Length = 97

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVESKSAGGIVLTGSAA--GKSTRGEIIAVGKGRVLENGNTQPLDVKIG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +V     +  +   E D+LA+VE
Sbjct: 63  DTVIFNDGYGVKVEKIDNQDMLIMSESDILAIVE 96



>gb:AP006627_563204 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 94

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DR++I   +  EK+A GI+LP SA   E+   G++++VGTG           EV+ G
Sbjct: 4   PLGDRIIIEQIQSEEKTASGIVLPDSAK--EKPQEGKVVAVGTGRVTDNGEKVALEVKEG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
             ++FS     EV   GTE  ++  +E D+LA++
Sbjct: 62  DSIIFSKYAGTEVKYEGTE--YLILRESDVLAII 93



>gb:ECGROES_125786 E.coli groES gene (mopB) complementing the tsA6
           mutation.
          Length = 97

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVETKSAGGIVLTGSAA--AKSTRGEVLAVGNGRILENGEVKPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSENDILAIVE 96



>gb:CR522870_99036 Desulfotalea psychrophila LSv54 chromosome.
          Length = 95

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 32/97 (32%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DR+L++     EK+AGGI++P SA   E+   G++++VG G           +V
Sbjct: 2   KIRPLNDRLLVKRLAEEEKTAGGIIIPDSAK--EKPAEGQVVAVGPGKVSDSGERVALQV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  VLFS     +V L  E+  +  +E D+L ++E
Sbjct: 60  KEGDLVLFSKYGGTDVKLDGED-FLIMREDDILGIME 95



>sp|P48228|CH10_YEREN 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock protein 10).>gb:YEPHSPCRP_211210 Y.
           enterocolitica crpA and crpB gene for hsp10, hsp60
           cross-reaciting protein antigen.
          Length = 97

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+++ +E+  KSAGGI+L  +A    +   GE+L VG G           +V
Sbjct: 2   KIRPLHDRVIVKRKEVESKSAGGIVLTGTAA--GKSTRGEVLPVGNGRILDNGEIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F+D    +      E  +   E D+LA+VE
Sbjct: 60  KVGDIVIFNDGYGVKSEKIDHEEVLIMSESDILAIVE 96



>sp|P05380|CH10_ECOLI 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S03931|BVECGS chaperonin groES -
           Escherichia coli (strain K-12)>pir|C91269|C91269
           chaperonin GroES [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>pir|A86110|A86110
           chaperonin mopB [similarity] - Escherichia coli (strain
           O157:H7, substrain EDL933)>gb:AE005174_69340 Escherichia
           coli O157:H7 EDL933, complete genome.>gb:AE005674_73880
           Shigella flexneri 2a str. 301, complete
           genome.>gb:ECGROESL_125788 E. coli groE
           operon.>gb:ECOUW93_131675 Escherichia coli K-12
           chromosomal region from 92.8 to 00.1
           minutes.>gb:U00096_203105 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016771_329186 Escherichia coli
           CFT073 section 17 of 18 of the complete
           genome.>gb:AE016993_373946 Shigella flexneri 2a str.
           2457T section 16 of 16 of the complete
           genome.>gb:AF325448_500735 Escherichia coli strain
           C175-94 GroES and GroEL mRNAs, complete
           cds.>gb:AF325453_500744 Escherichia coli strain
           ATCC700336 GroES and GroEL mRNAs, complete
           cds.>gb:BA000007_663135 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_959770 Escherichia coli
           CFT073 complete genome.>gb:AE014073_998696 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 97

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVETKSAGGIVLTGSAA--AKSTRGEVLAVGNGRILENGEVKPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96



>sp|P30780|CH10_AGRT5 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|C97442|C97442 10K chaperonin (protein
           cpn10) (protein groES) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>pir|AE2660|AE2660 10 KD
           chaperonin (protein CPN10) [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>gb:AE008002_232432
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 60 of 254 of the complete
           sequence.>gb:AE009036_247726 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 62 of 256 of the
           complete sequence.>gb:AE007869_1082101 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1085569 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 98

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           T   P  DRV++R  E   K+ GGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   TNFRPLHDRVVVRRVESEAKTKGGIIIPDTAK--EKPQEGEIVAVGSGARDEAGKVVALD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G +VLF   +  EV L  E+  +  KE D++ ++
Sbjct: 62  VKVGDRVLFGKWSGTEVKLDGEDL-LIMKEADIMGII 97



>gb:BX950851_839376 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 97

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GE+L++G G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVESKSAGGIVLTGSAA--GKSTRGEVLAIGHGRILENGEVKPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVE 96



>gb:AE017282_428443 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 96

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 10/98 (10%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV++   E  + S GGI++P +A   E+ + GEI++VGTG            V
Sbjct: 2   KIRPLHDRVVVIRREEEKTSPGGIVIPDTAK--EKPIKGEIVAVGTGKVLDNGQVRPLAV 59

Query: 357 ETGKKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVVE 467
           + G  VLF   +  E+ + GTE  ++  +E D++ V+E
Sbjct: 60  KAGDTVLFGKYSGTEIKIDGTE--YLMLREDDIMGVIE 95



>gb:AE016933_361198 Bacteroides thetaiotaomicron VPI-5482, section 8
           of 21 of the complete genome.>gb:AE015928_987686
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 90

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/91 (35%), Positives = 50/91 (54%), Gaps = 5/91 (5%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSD 386
           + P ADRVLI      EK+ GGI++P +A   E+ L GE+++VG G  + E   KV   D
Sbjct: 3   IKPLADRVLILPAPAEEKTIGGIIIPDTAK--EKPLKGEVVAVGHGTKDEEMVLKV--GD 58

Query: 387 VNAYEVNLGTE-----ERHVFCKEGDLLAVV 464
              Y    GTE      +++  ++ D+LA++
Sbjct: 59  TVLYGKYAGTELEVEGTKYLIMRQSDVLAIL 89



>gb:AB087495_11379 Thermus sp. TB1 groES and groEL genes for
           co-chaperonin and chaperonin, complete cds.
          Length = 101

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 9/98 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSE 353
           T + P  DRV+++  E   K+ GGI+LP +A   E+   G++++VG+G           E
Sbjct: 7   TVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAK--EKPQKGKVIAVGSGRILDNGQKVPLE 64

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+ G  V+F+     E+ +  EE +V   E DLLAV++
Sbjct: 65  VKEGGIVVFAKYGGTEIEIDGEE-YVILSERDLLAVLQ 101



>sp|P48229|CH10_ZYMMO 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|JC2563|JC2563 heat shock protein groES -
           Zymomonas mobilis>gb:ZMOGROESLA_212002 Zymomonas mobilis
           groESL operon: groES and groEL genes, complete cds.
          Length = 95

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRVL+R     EK+AGGI++P +A +  +   GE+++ G G           +V+ G
Sbjct: 5   PLHDRVLVRRVAAEEKTAGGIIIPDTAKR--KPQEGEVIAAGNGTHSEDGKVVPLDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +  E+  +  KE D+L ++
Sbjct: 63  DRVLFGKWSGTEVRVDGEDL-LIMKESDILGII 94



>sp|Q9EZV2|CH10_THENE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF275319_494668 Thermotoga neapolitana groE
           operon, complete sequence.
          Length = 92

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 30/92 (32%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE----VETGKK 371
           KV+P  +R+LI+  +  +K+ GGI+LP SA   E+ +  E+++VG    E    ++ G K
Sbjct: 3   KVIPLGERLLIKPIKEEKKTEGGIVLPDSAK--EKPMKAEVVAVGKIEDEEKFDIKVGDK 60

Query: 372 VLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V+FS     E+ +  E+ ++     D+LA +E
Sbjct: 61  VIFSKYAGTEIKIDDED-YIIIDVNDILAKIE 91



>sp|Q9JXM4|CH10_NEIMB 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|G81019|G81019 chaperonin, 10 kDa NMB1973
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002546_47357 Neisseria meningitidis
           serogroup B strain MC58 section 188 of 206 of the
           complete genome.>gb:AE002098_897470 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 96

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  E  EK+A GI+LP +A   E+  MGE+++VG G           +V+ G
Sbjct: 5   PLHDRVVVKRLEAEEKTASGIVLPGAAA--EKPDMGEVIAVGAGKIGKDGSRRPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            K++F   +   V    EE  V  +E D+  +VE
Sbjct: 63  DKIIFGKYSGQTVKADGEELLVM-REEDIFGIVE 95



>sp|Q9JWA3|CH10_NEIMA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|G81964|G81964 chaperonin 10 Kd subunit
           NMA0472 [imported] - Neisseria meningitidis (strain
           Z2491 serogroup A)>gb:NMA2Z2491_153421 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 2/7.
          Length = 96

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  E  EK+A GI+LP +A   E+  MGE+++VG G           +V+ G
Sbjct: 5   PLHDRVVVKRLEAEEKTASGIVLPGAAA--EKPDMGEVIAVGAGKIGKDGARRPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            K++F   +   V    EE  V  +E D+  +VE
Sbjct: 63  DKIIFGKYSGQTVKADGEELLVM-REEDIFGIVE 95



>sp|P77913|CH10_NEIGO 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE004969_61724 Neisseria gonorrhoeae FA
           1090, complete genome.>gb:NGU64996_152789 Neisseria
           gonorrhoeae iron-regulated outer membrane protein (frpB)
           and GroEL (groEL) genes, partial cds, and GroES (groES)
           gene, complete cds.
          Length = 96

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  E  EK+A GI+LP +A   E+  MGE+++VG G           +V+ G
Sbjct: 5   PLHDRVVVKRLEAEEKTASGIVLPGAAA--EKPDMGEVIAVGAGKIGKDGARRPLDVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            K++F   +   V    EE  V  +E D+  +VE
Sbjct: 63  DKIIFGKYSGQTVKADGEELLVM-REEDIFGIVE 95



>sp|P48222|CH10_CAUCR 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|C87334|C87334 chaperonin, 10 kDa
           [imported] - Caulobacter crescentus>gb:AE005744_74701
           Caulobacter crescentus CB15 section 70 of 359 of the
           complete genome.>gb:AE005673_921733 Caulobacter
           crescentus CB15 complete genome.
          Length = 96

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/97 (32%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV 356
           K  P  DRVL++  E   K+ GGI++P +A   E+   GE+++VG G           +V
Sbjct: 2   KFRPLGDRVLVKRVEEETKTKGGIIIPDTAK--EKPQEGEVVAVGPGARNDKGDVVALDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G ++LF   +  EV +  ++  +  KE D+L VVE
Sbjct: 60  KAGDRILFGKWSGTEVKVDGQDL-LIMKESDVLGVVE 95



>sp|Q8RU01|CH10_BRECH 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB038650_6049 Brevibacillus choshinensis
           genes for GroES, GroEL, complete cds.
          Length = 94

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I      E +A GI+LP SA   E+   G +++VG+G           EV+ G
Sbjct: 4   PLGDRVVIEAISKDEMTASGIVLPDSAK--EKPQEGRVIAVGSGRVADNGERIALEVKDG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KV+FS     EV +  +E ++  +E D+LA++
Sbjct: 62  DKVIFSKYAGTEVKVDNKE-YLVLRESDILAII 93



>gb:SCO939114_176572 Streptomyces coelicolor A3(2) complete genome;
           segment 11/29.
          Length = 118

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 31/82 (37%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = +3

Query: 222 DRVLIRLE--ELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVNA 395
           DRVL+R +  E   +S GGIL+P +A   +R    E+++VG  V  VE G +VL+   + 
Sbjct: 22  DRVLVRQDTGEGERRSGGGILIPATAAVGKRLAWAEVVAVGQNVRTVEPGDRVLYDPEDR 81

Query: 396 YEVNLGTEERHVFCKEGDLLAV 461
            EV +     +V  +E DL AV
Sbjct: 82  AEVEV-RGVGYVLMRERDLHAV 102



>gb:D55630_120195 Bacillus sp. DNA for GroEL, complete cds, GroES,
           partial cds.
          Length = 88

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 9/90 (10%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           DRV+I   E  EK+A GI+LP +A   E+   G +++VGTG           EV+ G  V
Sbjct: 1   DRVVIEQVETEEKTASGIVLPDTAK--EKPQEGRVVAVGTGRVTENGEKIALEVKEGDSV 58

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           +FS     EV    +E ++  +E D+LA++
Sbjct: 59  IFSKYAGTEVKYDGKE-YLILRESDILAII 87



>pir|PC4238|PC4238 heat shock protein GroES - Bacillus sp.
           (fragment)
          Length = 88

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 9/90 (10%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           DRV+I   E  EK+A GI+LP +A   E+   G +++VGTG           EV+ G  V
Sbjct: 1   DRVVIEQVETEEKTASGIVLPDTAK--EKPQEGRVVAVGTGRVTENGEKIALEVKEGDSV 58

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           +FS     EV    +E ++  +E D+LA++
Sbjct: 59  IFSKYAGTEVKYDGKE-YLILRESDILAII 87



>pir|JC5770|JC5770 chaperonin groES-like protein - Weevil
          Length = 97

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVEAKSAGGIVLTGSAA--GKSTRGEVLAVGHGRILENGEVKALDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      +  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKAEKIDNDEVLIMSESDILAIVE 96



>sp|P35864|CH13_BRAJA 10 kDa chaperonin 3 (Protein Cpn10 3) (groES
           protein 3).>pir|S35310|S35310 heat shock cognate protein
           groES3 - Bradyrhizobium japonicum>gb:AF322012S2_500136
           Bradyrhizobium japonicum symbiotic gene region, part 2
           of 2.>gb:BA000040_730320 Bradyrhizobium japonicum USDA
           110 DNA, complete genome.>gb:BJGROES3A_748854
           B.japonicum groES3 and groEL3 genes.
          Length = 104

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K  P  DRV+++  +  EK+AGGI++P +A   E+   GE+++VG G           ++
Sbjct: 2   KFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK--EKPSQGEVIAVGPGGHDDSGKLIPIDI 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           E G +VLF   +  EV +  ++  +  KE D++ V+
Sbjct: 60  EVGDRVLFGKWSGTEVKIDGQDL-LIMKESDVMGVL 94



>sp|Q9LC51|CH10_SALTY 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|AD1045|AD1045 GroES protein [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AB033231_5194 Salmonella typhimurium
           groES and groEL genes, complete cds.>gb:CP000026_78771
           Salmonella enterica subsp. enterica serovar Paratypi A
           str. ATCC 9150.>gb:AE008903_245925 Salmonella
           typhimurium LT2, section 207 of 220 of the complete
           genome.>gb:AE016849_348288 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 16 of 16 of the
           complete genome.>gb:AL627283_544676 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 19/20.>gb:AE014613_985620 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1003007 Salmonella typhimurium LT2,
           complete genome.
          Length = 97

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVESKSAGGIVLTGSAA--GKSTRGEIIAVGKGRILDNGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96



>sp|Q93FU7|CH10_ENTAE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF306522_498115 Enterobacter aerogenes
           GroES-like protein (groES) gene, complete cds.
          Length = 97

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKEVETKSAGGIVLTGSAA--AKSTRGEIIAVGKGHILEKGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96



>sp|O51683|CH10_BORBU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).
          Length = 90

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 27/89 (30%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE--VETGKKVLF 380
           + P ADRVLI+++E   K+  G+ +P++A   E+  +G +++VG+   E  V+ G  VL+
Sbjct: 4   IKPLADRVLIKIKEAESKTISGLYIPENAK--EKTNIGTVIAVGSNKEEITVKVGDTVLY 61

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                  V +  +E H+  K  +++A++E
Sbjct: 62  EKYAGAAVKIENKE-HLILKAKEIVAIIE 89



>gb:AP005424_1851614 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0556H01.
          Length = 245

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/151 (27%), Positives = 73/151 (48%), Gaps = 13/151 (8%)
 Frame = +3

Query: 54  MASGFLSLAKPFTSQP----INIPSLSPAPRPVGIGLRRNSLRV-NALSQKWEPTKVVPQ 218
           MAS  LS     +  P    + +PS++ A      G R   +R    +S K+  T + P 
Sbjct: 1   MASVQLSAGPRVSVSPAAALVAMPSVAAAASRGRRGYRGLVVRAATVVSPKY--TSIKPL 58

Query: 219 ADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--------EVETGKKV 374
            DRVL++++   +K+ GGILLP S     +   G++++VG G S         V  G +V
Sbjct: 59  GDRVLVKIKTSDDKTVGGILLPTSVQ--SKPQGGQVVAVGEGRSMGSDSIEISVPVGAQV 116

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           ++S     E+     + H+  KE D++ +++
Sbjct: 117 VYSKYAGTELEFDGSD-HLILKEDDIIGILD 146



 Score = 38.1 bits (87), Expect = 0.16
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVLI++ E  EK+AGG+LL ++    E+  +G + +VG G            +  G
Sbjct: 155 PLNDRVLIKVAEAEEKTAGGLLLTQATK--EKPSIGTVTAVGPGPLVEDGSRKPLSITPG 212

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             V++S     E   G +  ++  +  D++AV+
Sbjct: 213 NTVMYSKYAGSEFK-GEDGEYIVLRVSDVMAVL 244



>gb:CP000013_869968 Borrelia garinii PBi, complete genome.
          Length = 90

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 26/89 (29%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE--VETGKKVLF 380
           + P ADRVLI+++E   K+  G+ +P++A   E+  +G ++++G+   E  V+ G  VL+
Sbjct: 4   IKPLADRVLIKIKEAESKTISGLYIPENAK--EKTNIGTVIAIGSNKEEITVKVGDTVLY 61

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                  V +  +E H+  K  +++A++E
Sbjct: 62  EKYAGAAVKIENKE-HLILKAKEIVAIIE 89



>gb:BA000040_735792 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 98

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 33/98 (33%), Positives = 54/98 (55%), Gaps = 10/98 (10%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGK---- 368
           +K  P  DRV+++  +  EK+ GGI++P +A   E+   GE+++VG G  + ETGK    
Sbjct: 4   SKFRPLHDRVVVKRIDAEEKTKGGIIIPDTAK--EKPSQGEVVAVGPGGRD-ETGKLIPI 60

Query: 369 ------KVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
                 +VLF   +  EV +  EE  +  KE D++ V+
Sbjct: 61  DLKVGDRVLFGKWSGTEVKIDNEEL-LIMKESDIMGVM 97



>gb:AY142899_592082 Heliobacillus mobilis 10 kDa chaperonin GroES
           gene, partial cds.
          Length = 116

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 34/112 (30%), Positives = 56/112 (50%), Gaps = 9/112 (8%)
 Frame = +3

Query: 150 LRRNSLRVNALSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEIL 329
           LRR   R+N          + P ADR++++  E   K+A GI++P +A   E+   GE++
Sbjct: 16  LRRVPFRMN----------IKPLADRIVVKPIEAEAKTASGIIVPDTAK--EKPQQGEVV 63

Query: 330 SVGTG---------VSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLA 458
           +VG G           EV  G K+++S  +  E+ L   E ++   E D+LA
Sbjct: 64  AVGIGRLLDNGERAAMEVAVGDKIIYSKYSGTEIKLDGSE-YLILNERDILA 114



>gb:AF335323_502473 Listeria monocytogenes groESL operon, complete
           sequence.
          Length = 94

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 10/95 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP SA   E+   G+I++VG+G           EV  G
Sbjct: 4   PLGDRVVIEVLEAEEKTASGIVLPDSAK--EKPQSGKIVAVGSGRVPDNGTKEPLEVAEG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVVE 467
             V+F+  +  EV   GT+  ++  +E D+LA+ +
Sbjct: 62  DTVIFAKYSGTEVTYEGTD--YLILRESDILAITK 94



>gb:AE013207_290218 Thermoanaerobacter tengcongensis MB4, section
           234 of 244 of the complete genome.>gb:AE008691_1112283
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 93

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS-EVETGKKVL 377
           TK+ P     LI+LE+ PEK  GG+++PKSA   E+   G I ++  G + E+  G +V+
Sbjct: 2   TKIQPVNGHALIKLEKEPEKKVGGVIIPKSAE--EKLNQGVIEAIAAGATEELAVGDRVI 59

Query: 378 FSDVNAYEVNLGTEERHVFCKEGDLLA 458
           + + +  ++    EE ++     D+LA
Sbjct: 60  YKEFSGTKIKHEGEE-YLIIPVDDILA 85



>gb:RLY12483_164530 R.leguminosarum cpn10-1 gene, cpn60-1 gene,
           partial.
          Length = 98

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 9/97 (9%)
 Frame = +3

Query: 201 TKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------E 353
           T   P  DRV++R  E   K+ GGI++P +A   E+   GEI++VG+G           +
Sbjct: 4   TNFRPLHDRVVVRRVESEAKTKGGIIIPDTAK--EKPQEGEIVAVGSGARDESGKVVALD 61

Query: 354 VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           V+ G ++LF   +  EV +  E+  +  KE D++ ++
Sbjct: 62  VKAGDRILFGKWSGTEVKIDGEDL-LIMKEADIMGII 97



>gb:CR378673_96650 Photobacterium profundum SS9; segment 11/12.
          Length = 117

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 9/104 (8%)
 Frame = +3

Query: 183 SQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG------ 344
           +Q+  P  + P  DRV++  +E+  KSAGGI+L  SA   E+   G +L+VG G      
Sbjct: 16  NQERRPMNIRPLHDRVIVERQEVESKSAGGIVLTGSAA--EKSTRGVVLAVGKGRILENG 73

Query: 345 ---VSEVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                +V+ G  V+F++    +      +  +   E D++A+VE
Sbjct: 74  TVQELDVKVGDTVIFAEGYGTKSEKIDGKEVLIMSENDIMAIVE 117



>sp|Q87JG7|CH12_VIBPA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>gb:BA000032_708826 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 2, complete sequence.
          Length = 96

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  D++++  +E+  KS GGI+L   +VK      G++++VG G           EV
Sbjct: 2   KIRPLNDKLIVERQEVENKSEGGIVLTSQSVKKSN--RGKVIAVGLGKRFENGERAAMEV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G +++F+D    +        ++   E D+LA+VE
Sbjct: 60  KVGDQIIFNDGYGVKTEKIDGAEYLILSESDVLAIVE 96



>sp|Q98IV4|CH11_RHILO 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:BA000012_667699 Mesorhizobium loti
           MAFF303099 DNA, complete genome.
          Length = 104

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 32/97 (32%), Positives = 51/97 (52%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EV 356
           K  P  DRV+IR  E   KS GGI++P +A   E+   GE+++VG G           +V
Sbjct: 2   KFRPLHDRVVIRRAEGDTKSKGGIIIPDNAK--EKPQEGEVIAVGPGARDENGALVPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  +LF   +  EV +  E+  +  KE D++ V++
Sbjct: 60  KAGDLILFGKWSGTEVKIDGEDL-LIMKEADIMGVID 95



>sp|Q9AGE7|CH10_LISMO 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|AE1333|AE1333 class I heat-shock protein
           (chaperonin) GroES [imported] - Listeria monocytogenes
           (strain EGD-e)>gb:AE017329_444521 Listeria monocytogenes
           str. 4b F2365, section 8 of 10 of the complete
           genome.>gb:AL591982_536560 Listeria monocytogenes strain
           EGD, complete genome, segment 10/12.>gb:AE017262_1076877
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 94

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 34/95 (35%), Positives = 53/95 (55%), Gaps = 10/95 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP SA   E+   G+I++VG+G           EV  G
Sbjct: 4   PLGDRVVIEVLEAEEKTASGIVLPDSAK--EKPQSGKIVAVGSGRVLDNGTKEPLEVAEG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVVE 467
             V+F+  +  EV   GT+  ++  +E D+LA+ +
Sbjct: 62  DTVIFAKYSGTEVTYEGTD--YLILRESDILAITK 94



>sp|Q8KF03|CH10_CHLTE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE012828_286013 Chlorobium tepidum TLS
           section 49 of 194 of the complete
           genome.>gb:AE006470_933181 Chlorobium tepidum TLS
           complete genome.
          Length = 95

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 27/93 (29%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P ADRV+++     EK+ GG+ +P +    E+ + GE+++VG G           +V+ G
Sbjct: 5   PLADRVIVKPAPAEEKTKGGLYIPDTGK--EKPMYGEVVAVGPGKVSDAGQVVAMQVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVL+   +  EV++  E+ ++  +E D+ A++
Sbjct: 63  DKVLYGKYSGTEVHVEGED-YLIMRESDIFAIL 94



>sp|Q9F4E4|CH10_BUCTS 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401310_747021 Buchnera aphidicola
           (Thelaxes suberi) groES gene and partial groEL gene.
          Length = 97

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 9/91 (9%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           DRV+++ +E+  KSAGGI+L  SA    +   GE+++VG G           +V+ G  +
Sbjct: 8   DRVIVKRKEMESKSAGGIVLTGSAA--GKSTRGEVIAVGKGRVLENGNIQPLDVKIGDTI 65

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +F+D  + +V     +  +   E D+LA+VE
Sbjct: 66  IFNDGYSVKVEKIDNQDVLIMSESDILAIVE 96



>sp|Q9F4F0|CH10_BUCPS 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401307_747015 Buchnera aphidicola
           (Pemphigus spyrothecae) groES gene and partial groEL
           gene.
          Length = 97

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I+ +E+  KSAGGI+L  SA    +   G + +VG G           +V+ G
Sbjct: 5   PLHDRVIIKRQEVESKSAGGIVLTGSAA--GKSTRGIVTAVGNGRVLDNGELKALDVKIG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+FS+    ++     E  +   E D+LAVVE
Sbjct: 63  DTVIFSEGYGAKIEKIDNEEFLILTESDILAVVE 96



>sp|P59525|CH10_BUCBP 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE014016_302447 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 1 of 2 of the complete
           genome.>gb:AE016826_981048 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 97

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+++ +E   KSAGGI+L  SA    +   G +++VG G           +V
Sbjct: 2   KIRPLHDRVIVKRKEAESKSAGGIVLTGSAA--GKSTRGTVIAVGNGRILDNGNLKSLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F++    +V     E  +   E D+LA+VE
Sbjct: 60  KVGDTVIFNEGYGAKVEKIDNEELLILTESDILAIVE 96



>gb:AP006841_573917 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 90

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 5/91 (5%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSD 386
           + P ADRVLI      EK+ GGI++P +A   E+ L GE+++VG G  + E   K    D
Sbjct: 3   IKPLADRVLILPAPAEEKTIGGIIIPDTAK--EKPLKGEVVAVGHGTKDEEMVLKA--GD 58

Query: 387 VNAYEVNLGTE-----ERHVFCKEGDLLAVV 464
              Y    GTE      +++  ++ D+LAV+
Sbjct: 59  TVLYGKYAGTELEVEGTKYLIMRQSDVLAVL 89



>gb:AE017197_402587 Rickettsia typhi str. Wilmington complete
           genome.>gb:AF462073_513625 Rickettsia typhi isolate
           Ethiopian AZ322 groESL operon, complete sequence.
          Length = 95

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DR+ I+  E  EK+ GGI++P +A   E+ + GEI++VG GV          E++ G
Sbjct: 5   PLHDRIAIKPIENEEKTKGGIIIPDTAK--EKPMQGEIVAVGNGVLNKNGEIYPLELKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVL+      E+ +   E+ +  KE D+  ++
Sbjct: 63  DKVLYGKWAGTEIEI-KGEKLIVMKESDVFGII 94



>gb:AE017180_401626 Geobacter sulfurreducens PCA, complete genome.
          Length = 95

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+L++  E   K+AGGI +P +A   E+   GEI++VG G           +++ G
Sbjct: 5   PLQDRILVKRIEEETKTAGGIFIPDTAK--EKPQRGEIVAVGNGKKTEDGKVIPVDLKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            KVLF      ++ +  +E  +  +E D+L V+E
Sbjct: 63  DKVLFGKYAGTDIKIEGQE-FLIMREDDILGVIE 95



>gb:RLY12485_164534 R.leguminosarum cpn10-3 gene, cpn60-3 gene,
           partial.>gb:AF239164_491599 Rhizobium leguminosarum
           cpn-3 (groE) operon, complete sequence.
          Length = 105

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 9/91 (9%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETGKKV 374
           DRV+IR  E   KS GGI++P +A   E+   GE+++VG G+          +VE G  +
Sbjct: 8   DRVVIRRAEGDVKSKGGIIIPDTAK--EKPQQGEVVAVGPGLRDKSGNLVPLDVEVGDLI 65

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           LF   +  EV +  E   +  KE D++ +VE
Sbjct: 66  LFGKWSGTEVTIDGETL-LIMKETDIMGIVE 95



>sp|P60367|CH12_RHOPA 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>gb:BX572599_801778 Rhodopseudomonas
           palustris CGA009 complete genome; segment 7/16.
          Length = 104

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  +  EK+AGGI++P +A   E+   GEI++VG G           +++ G
Sbjct: 5   PLHDRVVVKRIDAEEKTAGGIIIPDTAK--EKPSQGEIVAVGPGGRDEAGKLIPIDLKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +  +E  +  KE D++ V+
Sbjct: 63  DRVLFGKWSGTEVKIDGKEL-LIMKESDIMGVI 94



>sp|P80469|CH10_RICTY 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (10 kDa heat shock protein) (HSP10).
          Length = 94

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DR+ I+  E  EK+ GGI++P +A   E+ + GEI++VG GV          E++ G
Sbjct: 4   PLHDRIAIKPIENEEKTKGGIIIPDTAK--EKPMQGEIVAVGNGVLNKNGEIYPLELKVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVL+      E+ +   E+ +  KE D+  ++
Sbjct: 62  DKVLYGKWAGTEIEI-KGEKLIVMKESDVFGII 93



>sp|Q9ZCT6|CH10_RICPR 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|B71668|B71668 10 kd chaperonin (groES)
           RP627 - Rickettsia prowazekii>gb:RPXX03_167402
           Rickettsia prowazekii strain Madrid E, complete genome;
           segment 3/4.>gb:RPY15783_167643 Rickettsia prowazekii
           groESL gene.
          Length = 95

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  DR+ I+  E  EK+ GGI++P +A   E+ + GEI++VG GV          E++ G
Sbjct: 5   PLHDRIAIKPIENEEKTKGGIIIPDTAK--EKPMQGEIVAVGNGVLNKNGEIHPLELKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            KVL+      E+ +   E+ +  KE D+  ++
Sbjct: 63  DKVLYGKWAGTEIEI-KGEKLIVMKESDVFGII 94



>sp|Q929U9|CH10_LISIN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|AD1704|AD1704 class I heat-shock protein
           (chaperonin) GroES [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596171_539518 Listeria innocua Clip11262
           complete genome, segment 9/12.
          Length = 94

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 10/93 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I + E  EK+A GI+LP SA   E+   G+I++VG+G           EV  G
Sbjct: 4   PLGDRVVIEVLEAEEKTASGIVLPDSAK--EKPQSGKIVAVGSGRVLDNGTKEPLEVAEG 61

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAV 461
             V+F+  +  EV   GT+  ++  +E D+LA+
Sbjct: 62  DTVIFAKYSGTEVTYEGTD--YLILRESDILAI 92



>sp|O84113|CH10_CHLTR 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (11.2 kDa stress response protein) (Heat shock
           protein 10) (HSP10).>pir|B71555|B71555 probable 10kda
           chaperonin - Chlamydia trachomatis (serotype D, strain
           UW3/Cx)>gb:AE001285_34037 Chlamydia trachomatis
           D/UW-3/CX section 12 of 87 of the complete
           genome.>gb:AE001273_1098063 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 102

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    K+ P  DR+L++ EE    + GGI+LP +A K  +    E+L++GTG     
Sbjct: 1   MSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKK--KQDRAEVLALGTGKKDDK 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                 EV+ G  VL    +  E+ +  EE +V  +  +++AV++
Sbjct: 59  GQQLPFEVQVGNIVLIDKYSGQELTVEGEE-YVIVQMSEVIAVLQ 102



>sp|P56970|CH10_CAMJE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|F81328|F81328 10 kD chaperonin (cpn10)
           Cj1220 [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X4_847593 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           4/6.>gb:CJY13334_848435 Campylobacter jejuni groES,
           groEL genes.>gb:CP000025_879095 Campylobacter jejuni
           RM1221, complete genome.
          Length = 86

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 24/85 (28%), Positives = 49/85 (57%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFSDVN 392
           P   RVL++  E  + +A GI++P +A   E+ LMGE+++V   ++++  G K++F+   
Sbjct: 5   PLGKRVLVKRVEETKTTASGIIIPDNAK--EKPLMGEVVAVSKEITDIANGDKIVFAKYG 62

Query: 393 AYEVNLGTEERHVFCKEGDLLAVVE 467
             E+ L   E ++     D+L +++
Sbjct: 63  GTEIKLDNNE-YLVLNLDDILGILK 86



>gb:AY052785_586929 Chlamydophila abortus gro operon, complete
           sequence.
          Length = 102

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    ++ P  DR+L++ EE      GGI+LP +A K  +    E+L++GTG     
Sbjct: 1   MSDQATTLRIKPLGDRILVKREEEDSTPRGGIILPDTAKK--KQDRAEVLALGTGKRDKD 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                 EV+ G  VL       E+ +  EE +V  +E +++AV++
Sbjct: 59  GQVLPFEVKVGDTVLIDKYAGQELTIDGEE-YVIVQESEVMAVLK 102



>sp|P17204|CH10_CHLMU 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (11.2 kDa stress response protein) (Heat shock
           protein 10) (HSP10).>pir|E81709|E81709 10 kDa chaperonin
           TC0387 [imported] - Chlamydia muridarum  (strain
           Nigg)>gb:AE002305_44975 Chlamydia muridarum Nigg section
           36 of 85 of the complete genome.>gb:CTU52049_119684
           Chlamydia muridarum GroES (GroES) and GroEL (GroEL)
           genes, complete cds.>gb:CHTGROESL_846275 Chlamydia
           muridarum heat shock protein (groES) and heat shock
           protein (groEL) genes, complete cds.>gb:CHTHYPAB_846289
           C.trachomatis hypA and hypB protein genes, complete
           cds.>gb:AE002160_1149115 Chlamydia muridarum Nigg,
           complete genome.
          Length = 102

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    K+ P  DR+L++ EE    + GGI+LP +A K  +    E+L++GTG     
Sbjct: 1   MSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKK--KQDRAEVLALGTGKKDDK 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                 EV+ G  VL    +  E+ +  EE +V  +  +++AV++
Sbjct: 59  GQQLPFEVQVGDIVLIDKYSGQELTVEGEE-YVIVQMSEVIAVLQ 102



>sp|Q9F4F4|CH10_BUCGU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401305_747011 Buchnera aphidicola
           (Geoica urticularia) groES gene and partial groEL gene.
          Length = 97

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRV+++ +E   KSAGGI+L  SA    +   G + +VG G           +V
Sbjct: 2   KIRPLHDRVIVKRKEAESKSAGGIVLTGSAA--GKSTRGTVTAVGNGRILDNGSIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G+ V+F++    ++     E  +   E D+LA+VE
Sbjct: 60  KVGETVIFNEGYGAKIEKIDNEELLILTESDILAIVE 96



>gb:AY693222_1623269 Saccharomyces cerevisiae clone FLH114953.01X
           YOR020C gene, complete cds.
          Length = 106

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           +VP  DRVL++  +   K+A G+ LP+  V  E+    E+++VG G         V +V+
Sbjct: 11  IVPLMDRVLVQRIKAQAKTASGLYLPEKNV--EKLNQAEVVAVGPGFTDANGNKVVPQVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G +VL        + LG ++  +  ++ ++LA +
Sbjct: 69  VGDQVLIPQFGGSSIKLGNDDEVILFRDAEILAKI 103



>gb:BX571872_788990 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 14/17.
          Length = 97

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG-VSE--------VETG 365
           P  DRV+++ +E+  KSAGGI+L  +A    +   GE+L+VG G + E        V+ G
Sbjct: 5   PLHDRVIVKRKEVESKSAGGIVLTGTAA--GKSTRGEVLAVGNGRILESGDVKALCVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVE 96



>gb:BX294152_770866 Pirellula sp. strain 1 complete genome; segment
           20/24.
          Length = 93

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVETG 365
           P  +R++++ EE    +AGGI+LP SA   E+   G ++++GTG           ++  G
Sbjct: 3   PLGERIVVQREESETTTAGGIVLPDSAK--EKPARGTVVALGTGKLLDDGSRADFQLAAG 60

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +VLFS      V +   E ++  +E D+LAV+E
Sbjct: 61  DRVLFSSYAGETVEVDDTE-YLLMREDDVLAVIE 93



>gb:AP006840_570085 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 97

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 9/96 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVE 359
           V P   RV+I+  E  E++  GI+LP +A   E+   G++++VG G +         EV+
Sbjct: 3   VKPLGARVVIKPLEKEERTKSGIVLPDTAK--EKPQQGKVIAVGPGRTLESGTKVELEVK 60

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G  V+FS     EV +  EE  +   E D+LA+V+
Sbjct: 61  EGDTVIFSKYAGTEVKIDGEEYIILDGERDILAIVQ 96



>sp|Q9KJ24|CH10_LACJO 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE017201_403841 Lactobacillus johnsonii NCC
           533, section 2 of 7 of the complete
           genome.>gb:AF214488_488925 Lactobacillus johnsonii
           groESL operon, complete sequence; and unknown
           gene.>gb:AE017198_1122328 Lactobacillus johnsonii NCC
           533, complete genome.
          Length = 94

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 33/95 (34%), Positives = 52/95 (54%), Gaps = 10/95 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++++++  E+  GGI+L  +A   E+  MGEI++VG G            V  G
Sbjct: 4   PIGDRVIVKVKDEEEEKVGGIVLASNAK--EKPQMGEIIAVGNGKRNANGDLIPMSVAKG 61

Query: 366 KKVLFSDVNAYEVNLGTE-ERHVFCKEGDLLAVVE 467
           + V F   +    NL  E E+++  +E DLLAVV+
Sbjct: 62  ETVFFDKYSG--TNLKYEGEKYLVLRESDLLAVVK 94



>gb:BX842646_823145 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 100

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DR+L+R     EK+AGG+ +P +A   E+   GEI++ G G           EV+
Sbjct: 8   VRPLHDRILVRRMAEEEKTAGGLFIPDTAK--EKPQKGEIIATGKGRVTEDGKILPLEVK 65

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAV 461
            G KVLF      E+ L   E ++  +E D+L V
Sbjct: 66  VGDKVLFGKYAGTELKLDGAE-YLMMREEDILGV 98



>gb:BA000040_733885 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 104

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 29/97 (29%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K  P  DRV+++  +  EK+AGGI++P +A   E+   GE+++VG G           ++
Sbjct: 2   KFRPLHDRVVVKRIDAEEKTAGGIIIPDTAK--EKPSQGEVVAVGPGGRDEAGKLIPIDL 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G +VLF   +  EV + + +  +  KE D++ V++
Sbjct: 60  KVGDRVLFGKWSGTEVKIDSVDL-LIMKESDIMGVLD 95



>gb:RSU37369_168330 Rhodobacter sphaeroides heat-induced groESL
           operon, chaperonin 10 (groES1) and chaperonin 60
           (groEL1) genes, complete cds.
          Length = 95

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL+R  +  EK+ GG+++P +A   E+   GE++S G G  +         V+ G
Sbjct: 5   PLHDRVLVRRVQSDEKTKGGLIIPDTAK--EKPAEGEVVSCGEGARKDSGELIAMSVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +   E  +  KE D+L ++
Sbjct: 63  DRVLFGKWSGTEVTIDGAEL-LIMKESDILGIL 94



>sp|P25969|CH11_RHOSH 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).
          Length = 94

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL+R  +  EK+ GG+++P +A   E+   GE++S G G  +         V+ G
Sbjct: 4   PLHDRVLVRRVQSDEKTKGGLIIPDTAK--EKPAEGEVVSCGEGARKDSGELIAMSVKAG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +   E  +  KE D+L ++
Sbjct: 62  DRVLFGKWSGTEVTIDGAEL-LIMKESDILGIL 93



>sp|P38910|CH10_YEAST 10 kDa heat shock protein, mitochondrial
           (HSP10) (10 kDa chaperonin).>pir|S39463|S39463
           chaperonin CPN10 - yeast (Saccharomyces
           cerevisiae)>gb:SCCPN10_1707379 S. cerevisiae CPN10
           gene.>gb:SCHSP10_1708501 S.cerevisiae HSP10
           gene.>gb:SCXV58KB_1711012 S.cerevisiae genomic DNA
           (chromosome XV; strain FY1679).>gb:SCYOR020C_1714244
           S.cerevisiae chromosome XV reading frame ORF YOR020c.
          Length = 106

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           +VP  DRVL++  +   K+A G+ LP+  V  E+    E+++VG G         V +V+
Sbjct: 11  IVPLMDRVLVQRIKAQAKTASGLYLPEKNV--EKLNQAEVVAVGPGFTDANGNKVVPQVK 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G +VL        + LG ++  +  ++ ++LA +
Sbjct: 69  VGDQVLIPQFGGSTIKLGNDDEVILFRDAEILAKI 103



>sp|P95801|CH10_XANMA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:SMU68778_187640 Stenotrophomonas
           maltophilia GroEL and GroES genes, complete
           cds.>gb:SMU68780_187641 Stenotrophomonas maltophilia
           GroES (groES) gene, complete cds.
          Length = 97

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/91 (32%), Positives = 47/91 (51%), Gaps = 9/91 (9%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           DRV+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V
Sbjct: 8   DRVIVKRKEVETKSAGGIVLTGSAA--AKSTRGEVLAVGNGRILENGEVKPLDVKVGDIV 65

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +F+D    +      E  +   + D LA+VE
Sbjct: 66  IFNDGYGVKSEKIDNEEXLIMSDSDXLAIVE 96



>sp|Q9WYX5|CH10_THEMA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|G72367|G72367 groES protein - Thermotoga
           maritima (strain MSB8)>gb:AE001727_38418 Thermotoga
           maritima MSB8 section 39 of 136 of the complete
           genome.>gb:AE000512_1112891 Thermotoga maritima MSB8,
           complete genome.
          Length = 92

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 28/92 (30%), Positives = 53/92 (57%), Gaps = 4/92 (4%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVG----TGVSEVETGKK 371
           KV+P  +R+LI+  +  +K+ GGI+LP SA   E+ +  E+++VG        +++ G K
Sbjct: 3   KVIPLGERLLIKPIKEEKKTEGGIVLPDSAK--EKPMKAEVVAVGKIDDDEKFDIKVGDK 60

Query: 372 VLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           V++S     E+ +  E+ ++     D+LA +E
Sbjct: 61  VIYSKYAGTEIKIDDED-YIIIDVNDILAKIE 91



>sp|Q59686|CH10_PASMU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|JC4518|JC4518 heat-shock protein GroES -
           Pasteurella multocida>gb:PMU30165_158942 Pasteurella
           multocida groESL heat shock operon, GroES (groES) and
           GroEL (groEL) genes, complete cds.>gb:AE006151_215994
           Pasteurella multocida subsp. multocida str. Pm70 section
           118 of 204 of the complete genome.>gb:AE004439_1118724
           Pasteurella multocida subsp. multocida str. Pm70,
           complete genome.
          Length = 96

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I+ EE+  +SAGGI+L  SA    +    ++L+VG G           +V+ G
Sbjct: 5   PLHDRVIIKREEVETRSAGGIVLTGSAA--TKSTRAKVLAVGKGRILENGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DTVIFNDGYGVKAEKIDGEEVLIISENDILAIVE 96



>sp|O51831|CH10_BUCMP 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF003957_467336 Myzus persicae primary
           endosymbiont inner membrane protein gene, partial cds,
           ThdF gene, complete cds, tRNA-Phe gene, complete
           sequence, SymS (groES), SymL (groEL) and 37.5 kDa
           protein genes, complete cds, and elongation factor P
           gene, partial cds.
          Length = 96

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/97 (30%), Positives = 49/97 (50%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRVL++ +E+  KSAGGI+L  SA    +   G + ++G G           +V
Sbjct: 2   KIRPLHDRVLVKRQEVESKSAGGIVLTGSAA--GKSTRGTVTAIGKGRVLDNGQIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F++    +      E  +   E D+LA+VE
Sbjct: 60  KVGDTVIFNEGYGAKTEKINTEELLLLTESDILAIVE 96



>sp|P25749|CH10_BUCAI 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A42281|A42281 symbionin symS - pea
           aphid>pir|A84932|A84932 10 kD chaperonin [imported] -
           Buchnera sp. (strain APS)>gb:APSYMSL_582335
           Acyrthosiphon pisum endosymbiont symS and symL genes for
           symbionin.>gb:BA000003_653399 Buchnera aphidicola str.
           APS (Acyrthosiphon pisum) genomic DNA, complete
           sequence.
          Length = 96

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRVL++ +E+  KSAGGI+L  SA    +   G + +VG G           +V
Sbjct: 2   KIRPLHDRVLVKRQEVESKSAGGIVLTGSAA--GKSTRGTVTAVGKGRVLDNGDIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F++    +      E  +   E D+LA+VE
Sbjct: 60  KVGDVVIFNEGYGAKTEKIDNEELLILTESDILAIVE 96



>gb:AB002286_520 Wolbachia sp. DNA for GroES protein homolog, GroEL
           protein homolog, complete cds.
          Length = 96

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 33/91 (36%), Positives = 49/91 (53%), Gaps = 9/91 (9%)
 Frame = +3

Query: 222 DRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKV 374
           D VLI+   + E+  GGI+LP SA K  +   GE++++G+G            V+TG KV
Sbjct: 11  DNVLIK--PITEEKQGGIVLPSSAEK--KPNKGEVIAIGSGSRNSSGERIALTVKTGDKV 66

Query: 375 LFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +      EV     E++V  KE DLLAV++
Sbjct: 67  FYRQWAGTEVE-HDNEKYVVMKESDLLAVIK 96



>sp|Q9KNR6|CH11_VIBCH 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>pir|C82048|C82048 chaperonin, 10 Kd subunit
           VC2665 [imported] - Vibrio cholerae (strain N16961
           serogroup O1)>gb:AE004332_53036 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, section 240 of
           251 of the complete chromosome.>gb:AE003852_1053810
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, complete chromosome.
          Length = 96

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++  +E+  KSAGGI+L  SA   E+   G++L+VG G           +V+ G
Sbjct: 5   PLHDRVIVERQEVESKSAGGIVLTGSAA--EKSTRGKVLAVGKGRILENGSVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      +  +   E D+LA+VE
Sbjct: 63  DTVIFAESYGTKTEKIDGKEVLILAEHDILAIVE 96



>sp|P60366|CH11_RHOPA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:BX572596_800756 Rhodopseudomonas
           palustris CGA009 complete genome; segment 4/16.
          Length = 98

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  +   K+ GGI++P SA   E+   G++++VG G           +V+ G
Sbjct: 8   PLHDRVVVKRIDAETKTKGGIIIPDSAK--EKPQEGQVIAVGPGGRDETGKLTPIDVKVG 65

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  E+ L  EE  +  KE D++ VV
Sbjct: 66  DRVLFGKWSGTEIKLDGEEL-LIMKESDIMGVV 97



>sp|P95677|CH10_RHOCA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:S82593_169235 groESL operon: Cpn10=10.6 kda
           GroES subunit, Cpn60=57.7 kda GroEL subunit [Rhodobacter
           capsulatus, B10, ATCC 33303, Genomic, 2302 nt].
          Length = 95

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL++  +  EK+ GG+++P +A   E+   GE+++VG G  +         V  G
Sbjct: 5   PLHDRVLVKRVQSEEKTKGGLIIPDTAK--EKPAEGEVVAVGAGARKDSGELIAPAVAVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            ++LF   +  EV L   E  +  KE D++ ++
Sbjct: 63  DRILFGKWSGTEVTLDGVEM-LIMKESDIMGII 94



>sp|P26210|CH10_BACP3 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (Heat shock 12 kDa protein).>pir|JC1479|JC1479
           heat shock protein TGroES - thermophilic bacterium
           PS-3>gb:S57424_168720 tgrE chaperonin operon: TGroES,
           TGroEL=heat shock protein [thermophilic bacterium PS3,
           Genomic, 824 nt].
          Length = 94

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DR++I + E  EK+A GI+LP +A   E+   G +++VG G           + + G
Sbjct: 4   PLGDRIVIEVVETEEKTASGIVLPDTAK--EKPQEGRVVAVGAGRVLDNGQRIGRKSKVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +V+FS     EV    +E ++  +E D+LAV+
Sbjct: 62  DRVIFSKYAGTEVKYDGKE-YLILRESDILAVI 93



>gb:BX842655_826118 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 10/11.
          Length = 224

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 25/95 (26%), Positives = 49/95 (51%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           V P  DR+++++    + +AGG+ +P S       L G +++VG G           +V+
Sbjct: 129 VTPLDDRLMVQVSGAEKMTAGGLYIPDSVADTSGNLQGFVVAVGRGHMNKKGHVRPMDVQ 188

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KV+FS+    ++ +  E+  +  +E D++ VV
Sbjct: 189 VGDKVVFSEYAGSKIKIQNEDL-IILREADVMGVV 222



>sp|Q9KLC7|CH12_VIBCH 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>pir|C82412|C82412 chaperonin, 10 Kd chain
           VCA0819 [imported] - Vibrio cholerae (strain N16961
           serogroup O1)>gb:AE004410_53947 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome II, section 67 of 93
           of the complete chromosome.>gb:AE003853_1050893 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome II,
           complete chromosome.
          Length = 96

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  D++++   E+  KS GGI+L   +VK      G++++VG G           EV+TG
Sbjct: 5   PLHDKLIVERLEVENKSEGGIVLTSQSVKKSN--RGKVVAVGLGRPLKNGDRARMEVKTG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +++F+D    +      + ++   E D+LA+VE
Sbjct: 63  DQIIFNDGYGVKTEKVDGKEYLILSESDVLAIVE 96



>sp|O59804|CH10_SCHPO 10 kDa heat shock protein, mitochondrial
           (HSP10) (10 kDa chaperonin).>pir|T41381|T41381
           Chaperonins 10 Kd subunit - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC550_1721382 S.pombe
           chromosome III cosmid c550.
          Length = 104

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           +VP  DR+L++  +   K+A GI LP+ +V  E+   G ++SVG G            V 
Sbjct: 11  IVPLLDRILVQRIKADTKTASGIFLPEKSV--EKLSEGRVISVGKGGYNKEGKLAQPSVA 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G +VL        + +G EE  ++ ++ +LLA+++
Sbjct: 69  VGDRVLLPAYGGSNIKVGEEEYSLY-RDHELLAIIK 103



>sp|Q93GT9|CH10_COLMA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB073221_9763 Colwellia maris groESL operon
           (groES and groEL), complete sequence.
          Length = 96

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++ ++   KS GGI+L  SA   E+    E+++VG G           +V+ G
Sbjct: 5   PLHDRVIVKRKDAESKSEGGIVLMGSAT--EKSTRAEVIAVGNGRILENGEVRPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            +V+FS+    +      E  +   E D+LA+VE
Sbjct: 63  DQVIFSEGYGVKTEKIDGEEVLILSESDILAIVE 96



>sp|P15598|CH10_CHLCV 10 kDa chaperonin (Protein Cpn10) (groES
           protein) (11.2 kDa stress response
           protein).>pir|JL0116|JL0116 hypA protein - Chlamydophila
           psittaci>gb:CPHYPAB_93004 Chlamydophila caviae hypA and
           hypB genes for stress response
           proteins.>gb:AE016996_374699 Chlamydophila caviae GPIC
           section 3 of 4 of the complete
           genome.>gb:AE015925_994378 Chlamydophila caviae GPIC
           complete genome.
          Length = 102

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    ++ P  DR+L++ EE    + GGI+LP +A K  +    E+L +GTG     
Sbjct: 1   MSDQATTLRIKPLGDRILVKREEEDSTARGGIILPDTAKK--KQDRAEVLVLGTGKRDKD 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                 EV  G  VL       E+ +  EE +V  +E +++AV++
Sbjct: 59  GNVLPFEVTVGDTVLIDKYAGQELTVDGEE-YVIVQESEVMAVLK 102



>sp|Q9F4E8|CH10_BUCTC 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401308_747017 Buchnera aphidicola
           (Tetraneura caerulescens) groES gene and partial groEL
           gene.
          Length = 97

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I+ +E   KSAGGI+L  SA    +   G +L+VG G           +V+ G
Sbjct: 5   PLHDRVIIKRQESESKSAGGIVLTGSAA--GKSTRGTVLAVGNGRILDNGSVKSLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      E  +   E D+LA+VE
Sbjct: 63  DVVIFNEGYGAKTEKMDHEEVLILTESDILAIVE 96



>sp|Q96539|CH10_BRANA 10 kDa chaperonin (Protein CPN10) (Protein
           groES).>gb:BNU65890_1633702 Brassica napus 10 kDa
           chaperonin mRNA, complete cds.
          Length = 98

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V 356
           +++P  +R+L++    P K+  GILLP+ A K      G++++VG G  +         V
Sbjct: 4   RLIPTFNRILVQGVIQPAKTESGILLPEKASKLN---SGKVIAVGPGSRDKDGKLIPVSV 60

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G  VL  +    +V LG +E H+F ++ D+L  +
Sbjct: 61  KEGDTVLLPEYGGTQVKLGEKEYHLF-RDEDVLGTL 95



>gb:AB002290_528 Wolbachia sp. DNA for GroES protein homolog, GroEL
           protein homolog, partial cds.>gb:AB039040_6077 Wolbachia
           sp. Wstri genes for molecular chaperone groES and groEL,
           partial cds.>gb:AB039041_6079 Wolbachia sp. wFur genes
           for molecular chaperone groES and groEL, partial
           cds.>gb:AB039281_6088 Wolbachia sp. wJapo genes for
           molecular chaperone gro EL and groES, partial
           cds.>gb:AB039282_6090 Wolbachia sp. wDry gene for
           molecular chaperone groES and groEL, partial
           cds.>gb:AB167350_16050 Wolbachia endosymbiont of
           Hypolimnas bolina bolina groES and groEL genes for
           molecular chaperone groE small and large subunits,
           partial cds.>gb:AB167351_16052 Wolbachia endosymbiont of
           Hypolimnas bolina philippensis groES and groEL genes for
           molecular chaperone groE small and large subunits,
           partial cds.>gb:AB167398_16056 Wolbachia endosymbiont of
           Hypolimnas bolina jacintha groES and groEL genes for
           molecular chaperone groE small and large subunits,
           partial cds.
          Length = 82

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 9/85 (10%)
 Frame = +3

Query: 240 LEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVN 392
           ++ + E+  GGI+LP SA K  +   GE++++G+G            V+TG KV +    
Sbjct: 1   IKPITEEKQGGIVLPSSAEK--KPTKGEVIAIGSGSRNSSGERIALTVKTGDKVFYRQWA 58

Query: 393 AYEVNLGTEERHVFCKEGDLLAVVE 467
             EV     E++V  KE DLLAV++
Sbjct: 59  GTEVE-HDNEKYVVMKESDLLAVIK 82



>sp|Q93MH2|CH10_RHOPA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF406639_507852 Rhodopseudomonas palustris
           groESL operon, complete sequence.
          Length = 95

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVL+R  +  EK+ GG+++P +A   E+   GE+++ G G  +         V+ G
Sbjct: 5   PLHDRVLVRRVQSDEKTKGGLIIPDTAK--EKPAEGEVVACGEGARKDSGELIAMSVKAG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            +VLF   +  EV +   E  +  KE D+L ++
Sbjct: 63  DRVLFGKWSGTEVTIDGAEL-LIMKESDILGIL 94



>sp|Q9AEP8|CH10_LACLC 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AY029215_585449 Lactococcus lactis subsp.
           cremoris chaperonin GroES and chaperonin GroEL genes,
           complete cds.
          Length = 94

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  +RV++R++E  EKS GGI+L  ++   E+    E+++VG G +          V+ G
Sbjct: 4   PLENRVVLRVKEEEEKSMGGIVL--TSASQEKPQTAEVIAVGEGKTTNHGTLISPLVKVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F       V +  EE  +  K+ DLLA+VE
Sbjct: 62  DTVIFEKFAGTTVKMDGEE-FLILKDSDLLAIVE 94



>sp|P37283|CH10_LACLA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S32105|S32105 chaperonin groES -
           Lactococcus lactis>pir|JN0660|JN0660 heat shock protein
           groES - Lactococcus lactis subsp.
           lactis>gb:LLGROESEL_140906 L.lactis groES and groEL
           genes.>gb:AE006276_217295 Lactococcus lactis subsp.
           lactis IL1403 section 38 of 218 of the complete
           genome.>gb:AE005176_1094368 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 94

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  +RV++R++E  EKS GGI+L  ++   E+    E+++VG G +          V+ G
Sbjct: 4   PLENRVVLRVKEEEEKSMGGIVL--TSASQEKPQTAEVVAVGEGKTNHHGTLISPLVKVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F       V +  EE  +  K+ DLLA+VE
Sbjct: 62  DTVIFEKFAGTTVKMDGEE-FLILKDSDLLAIVE 94



>sp|P31296|CH10_HAEDU 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|A49203|A49203 heat shock protein GroES -
           Haemophilus ducreyi>gb:HEAGROESL_136761 Haemophilus
           ducreyi heat shock protein (groES and groEL) gene,
           complete cds.>gb:AE017155_393141 Haemophilus ducreyi
           strain 35000HP section 5 of 6 of the complete
           genome.>gb:AE017143_1027403 Haemophilus ducreyi strain
           35000HP complete genome.
          Length = 96

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 10/95 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSA-VKFERYLMGEILSVGTG---------VSEVET 362
           P  D+V+++ EE+   SAGGI+L  SA VK  R   G++++VGTG            V+ 
Sbjct: 5   PLHDKVILKREEVETCSAGGIVLTGSATVKSTR---GKVIAVGTGRLLENGSIQPLSVKE 61

Query: 363 GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           G  V+F++    +V     E  +   E D+LA+VE
Sbjct: 62  GDMVIFNEGYGAKVEKIDGEEILILSENDILAIVE 96



>sp|P26822|CH10_CLOPE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S22343|S22343 chaperonin groES -
           Clostridium perfringens>gb:CPGROESL_92984 C.perfringens
           groEL and groES genes for HSP60 and HSP10 (GROESL
           operon).>gb:BA000016_675330 Clostridium perfringens str.
           13 DNA, complete genome.
          Length = 94

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 8/95 (8%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV--------SEVET 362
           + P  DRV+I+  E  E +  GI++  +A   ER    E+++VG G          EV+ 
Sbjct: 3   IKPLGDRVVIKRLEAEETTKSGIIVTGTAK--ERPQEAEVVAVGPGAIVDGKRTEMEVKI 60

Query: 363 GKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           G KVL+S     EV    EE +   ++ D+LA+VE
Sbjct: 61  GDKVLYSKYAGTEVKFEGEE-YTILRQDDILAIVE 94



>sp|P31682|CH10_CHLPN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|S19022|S19022 10 kDa chaperonin CP0637
           [imported] - Chlamydophila pneumoniae (strains CWL029
           and AR39)>pir|G86507|G86507 10 KDa chaperonin [imported]
           - Chlamydophila pneumoniae  (strain
           J138)>gb:AE001600_37000 Chlamydia pneumoniae section 16
           of 103 of the complete genome.>gb:AE002221_44114
           Chlamydophila pneumoniae AR39, section 49 of 94 of the
           complete genome.>gb:AE017157_393481 Chlamydophila
           pneumoniae TW-183, section 1 of 4 of the complete
           genome.>gb:BA000008_663508 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:CHTGRO_846271
           Chlamydophila pneumoniae groE operon, complete
           sequence.>gb:AE002161_886239 Chlamydophila pneumoniae
           AR39, complete genome.>gb:AE001363_941557 Chlamydia
           pneumoniae, complete genome.>gb:AE009440_1027743
           Chlamydophila pneumoniae TW-183, complete genome.
          Length = 102

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    ++ P  DR+L++ EE    + GGI+LP +A K  +    E+L +GTG     
Sbjct: 1   MSDQATTLRIKPLGDRILVKREEEEATARGGIILPDTAKK--KQDRAEVLVLGTGKRTDD 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                 EV+ G  +L       E+ +  EE +V  +  +++AV++
Sbjct: 59  GTLLPFEVQVGDIILMDKYAGQEITIDDEE-YVILQSSEIMAVLK 102



>sp|Q59176|CH10_BUCAP 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:D85628_120682 Buchnera aphidicola inner
           membrane protein (60K), thiophene and furan oxidation
           protein (thdF), 10 kd chaperonin (groES), 60 kd
           chaperonin (groEL) and ORF (yjeK)
           DNA.>gb:AE014077_302950 Buchnera aphidicola str. Sg
           (Schizaphis graminum) section 2 of 57 of the complete
           genome.>gb:AF008210_467912 Buchnera aphidicola genomic
           fragment containing (chaperone Hsp60) groEL, DNA
           biosynthesis initiating protein (dnaA), ATP operon
           (atpCDGAHFEB), and putative chromosome replication
           protein (gidA) genes, complete cds; and termination
           factor Rho (rho) gene, partial cds.>gb:AE013218_934928
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           complete genome.
          Length = 96

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEV 356
           K+ P  DRVL++  E   KSAGGI+L  SA    +   G I +VG G           +V
Sbjct: 2   KIRPLHDRVLVKRNEAELKSAGGIVLTGSAA--AKSTRGTITAVGNGRVLDNGQIKPLDV 59

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           + G  V+F++    +      E  +   E D+LA+VE
Sbjct: 60  KVGDVVIFNEGYGAKTEKIDNEELLILNESDILAIVE 96



>sp|P94165|CH10_ACTPL 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:APU55016_582406 Actinobacillus
           pleuropneumoniae heat-shock 10 protein GroES (mopB),
           heat-shock 60 protein GroEL (mopA), purine nucleoside
           phosphorylase (deoD) genes, complete cds, alcohol
           dehydrogenase (adhE) gene, partial cds.
          Length = 96

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  D+V+++ EE+  +SAGGI+L  SA    +   G++++VGTG            V+ G
Sbjct: 5   PLHDKVILKREEVETRSAGGIVLTGSAA--TKSTRGKVIAVGTGRLLENGSVQALAVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      E  +   E D+LA+VE
Sbjct: 63  DVVIFNEGYGVKSEKIDGEEVLILSENDILAIVE 96



>sp|P46399|CH10_ACTAC 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:ACNGROESL_18730 Actinobacillus
           actinomycetemcomitans groES and groEL genes, complete
           cds.
          Length = 96

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  D+V+++ E++  KSAGGI+L  SA    +    ++L+VG G            V+ G
Sbjct: 5   PLHDKVILKREDVETKSAGGIVLTGSAA--TKSTRAKVLAVGPGRLLENGSVHPMHVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+FSD    +      E  +   E D+LA+VE
Sbjct: 63  DTVIFSDGYGVKTEKIDGEEVLIISESDILAIVE 96



>gb:CP000020_870380 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 96

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++  +E+  KSAGGI+L  SA   E+   G +L+VG G           +V+ G
Sbjct: 5   PLHDRVIVERQEVESKSAGGIVLTGSAA--EKSTRGTVLAVGKGRILENGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      +  +   E D++A+VE
Sbjct: 63  DSVIFAEGYGTKSEKIDGKEVLIMSENDIMAIVE 96



>gb:AF005236_467543 Sitophilus oryzae principal endosymbiont GroES
           (groES) and GroEL (groEL) genes, partial cds.
          Length = 89

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 9/90 (10%)
 Frame = +3

Query: 225 RVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVL 377
           RV+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V+
Sbjct: 1   RVIVKRKEVEAKSAGGIVLTGSAA--GKSTRGEVLAVGHGRILENGEVKALDVKVGDIVI 58

Query: 378 FSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           F+D    +      +  +   E D+LA+VE
Sbjct: 59  FNDGYGVKAEKIDNDEVLIMSESDILAIVE 88



>pir|B60273|B60273 heat shock protein groES - Chlamydia
           trachomatis>gb:CHTGROE_846273 Chlamydia trachomatis groE
           operon.
          Length = 102

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 29/105 (27%), Positives = 55/105 (52%), Gaps = 9/105 (8%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE-- 353
           +S +    K+ P  DR+L++ EE    + GGI+LP +A K  +    E++++GTG  +  
Sbjct: 1   MSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKK--KQDRAEVVALGTGKKDDK 58

Query: 354 -------VETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
                  V+ G  VL    +  E+ +  EE +V  +  +++AV++
Sbjct: 59  GQQLPFVVQVGDIVLIDKYSGQELTVEGEE-YVIVQMSEVIAVLQ 102



>pir|A97821|A97821 10K chaperonin [imported] - Rickettsia conorii
           (strain Malish 7)>gb:AE008650_239333 Rickettsia conorii
           str. Malish 7, section 82 of 114 of the complete
           genome.>gb:AE006914_1121451 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 99

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+ I+  E  EK+ GGI++P +    E+ + GEI++VG G+          E++ G
Sbjct: 9   PLHDRIAIKPIEQEEKTKGGIIIPDTVK--EKPMQGEIVAVGNGIRNEKGEIHPLELKVG 66

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
            KVL+      E+ + GT  + +  KE D+  ++
Sbjct: 67  DKVLYGKWAGTEIEIKGT--KLIVMKESDVFGII 98



>sp|Q93GT7|CH10_TETHA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AB073399_9775 Tetragenococcus halophilus
           groESL operon (cpn10, cpn60 genes), complete sequence.
          Length = 94

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVLI + E  EK+ GGI+L  +A   E+   G++++VG G            V  G
Sbjct: 4   PLGDRVLIEVSEEEEKTVGGIVLASTAQ--EKPQTGKVVAVGPGRTLDNGELATVPVNVG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             VLF      EV    ++  +F  + DL+A+VE
Sbjct: 62  DTVLFEKYAGSEVKYDGQDYMIFSAK-DLVAIVE 94



>sp|Q92H03|CH10_RICCN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).
          Length = 95

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 29/94 (30%), Positives = 50/94 (53%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DR+ I+  E  EK+ GGI++P +    E+ + GEI++VG G+          E++ G
Sbjct: 5   PLHDRIAIKPIEQEEKTKGGIIIPDTVK--EKPMQGEIVAVGNGIRNEKGEIHPLELKVG 62

Query: 366 KKVLFSDVNAYEVNL-GTEERHVFCKEGDLLAVV 464
            KVL+      E+ + GT  + +  KE D+  ++
Sbjct: 63  DKVLYGKWAGTEIEIKGT--KLIVMKESDVFGII 94



>sp|O68323|CH10_LACHE 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AF031929_471074 Lactobacillus helveticus
           cochaperonin GroES and chaperonin GroEL genes, complete
           cds; and DNA mismatch repair enzyme (hexA) gene, partial
           cds.
          Length = 94

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSEVETGKKVLFS--- 383
           P  DRV++++++  EK+ GGI+L  +A K  +   GE+++VG G +    G+K+  S   
Sbjct: 4   PIGDRVIVKVKDEEEKTVGGIVLASNAKK--KPTEGEVVAVGEG-AYASNGEKIPMSVKK 60

Query: 384 -DVNAYEVNLGTE-----ERHVFCKEGDLLAVVE 467
            DV  Y+   GT      E+++   E D+LA+ +
Sbjct: 61  GDVVLYDRYSGTNVEYEGEKYLVLHEKDILAIAK 94



>sp|P43734|CH10_HAEIN 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>pir|B64076|B64076 chaperonin groES -
           Haemophilus influenzae (strain Rd KW20)>gb:U32736_204213
           Haemophilus influenzae Rd KW20 section 51 of 163 of the
           complete genome.>gb:L42023_1096762 Haemophilus
           influenzae Rd KW20 complete genome.
          Length = 96

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+I+ EE+  +SAGGI+L  SA    +    ++L+VG G           +V+ G
Sbjct: 5   PLHDRVIIKREEVETRSAGGIVLTGSAA--TKSTRAKVLAVGKGRILENGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      E  +   E D+LA+VE
Sbjct: 63  DIVIFNDGYGVKSEKIDGEEVLIISENDILAIVE 96



>sp|P34893|CH10_ARATH 10 kDa chaperonin (Protein CPN10) (Protein
           groES).>pir|S65597|S65597 chaperonin groES homolog -
           Arabidopsis thaliana>gb:AE005172_890494 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATHCHAPHOM_1553103 Arabidopsis thaliana
           (clone PATIS81) 10 kDa chaperonin gene homologue,
           complete cds.>gb:AY063928_1565875 Arabidopsis thaliana
           putative chaperonin CPN10 protein (At1g14980) mRNA,
           complete cds.>gb:AY086708_1571752 Arabidopsis thaliana
           clone 26943 mRNA, complete sequence.>gb:AY091252_1574460
           Arabidopsis thaliana putative chaperonin CPN10 protein
           (At1g14980) mRNA, complete cds.>gb:D88314_1675106
           Arabidopsis thaliana mRNA for mitochondrial chaperonin
           10, complete cds.>gb:T15D22_1723473 Arabidopsis thaliana
           chromosome 1 BAC T15D22 sequence, complete sequence.
          Length = 98

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------V 356
           +++P  +R+L++    P K+  GILLP+ + K      G++++VG G  +         V
Sbjct: 4   RLIPTFNRILVQRVIQPAKTESGILLPEKSSKLN---SGKVIAVGPGSRDKDGKLIPVSV 60

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G  VL  +    +V LG  E H+F ++ D+L  +
Sbjct: 61  KEGDTVLLPEYGGTQVKLGENEYHLF-RDEDVLGTL 95



>sp|Q930X9|CH13_RHIME 10 kDa chaperonin 3 (Protein Cpn10 3) (groES
           protein 3).>pir|A95270|A95270 GroES3 chaperonin
           [imported] - Sinorhizobium meliloti  (strain 1021)
           magaplasmid pSymA>gb:AE007200_224025 Sinorhizobium
           meliloti 1021 plasmid pSymA section 6 of 121 of the
           complete plasmid sequence.>gb:AE006469_1101793
           Sinorhizobium meliloti 1021 plasmid pSymA, complete
           sequence.
          Length = 105

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  DRV+IR  E   +S GGI++P +A   E+   GE+++VG G           +V+ G
Sbjct: 5   PLLDRVVIRRAEGNTQSKGGIIIPDTAK--EKPQEGEVIAVGPGSRDESGKLIPLDVKIG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             +LF   +  EV +  E+  +  KE D++ +V
Sbjct: 63  DTILFGKWSGTEVKIDGEDL-LIMKESDIMGIV 94



>sp|Q83WI9|CH11_VIBHA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:AY246431_602110 Vibrio harveyi groE heat
           shock operon, complete sequence.
          Length = 102

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 9/97 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++  +E+  KSAGGI+L  SA   E+   G +L+VG G           +V+ G
Sbjct: 5   PLHDRVIVERKEVESKSAGGIVLTGSAA--EKSTRGVVLAVGKGRILENGTVLPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE*IA 476
             V+F++    +      +  +   E D++A+V+ IA
Sbjct: 63  DTVIFAEGYGTKTEKIDGKEVLVMSENDIMAIVDLIA 99



>gb:WSP511283_210519 Wolbachia sp. wEum partial groE operon (groES
           and groEL genes).>gb:WSP511284_210521 Wolbachia
           endosymbiont of Culex fuscocephala partial groE operon
           (groES and groEL genes).>gb:WSP511285_210523 Wolbachia
           sp. wGel partial groE operon (groES and groEL
           genes).>gb:WSP511286_210525 Wolbachia sp. wInd partial
           groE operon (groES and groEL genes).>gb:WSP511287_210527
           Wolbachia sp. wUnif partial groE operon (groES and groEL
           genes).
          Length = 77

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 9/80 (11%)
 Frame = +3

Query: 255 EKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVNAYEVN 407
           E+  GGI+LP SA K  +   GE++++G+G            V+TG KV +      EV 
Sbjct: 1   EEKQGGIVLPSSAEK--KPTKGEVIAIGSGSRNSSGERIALTVKTGDKVFYRQWAGTEVE 58

Query: 408 LGTEERHVFCKEGDLLAVVE 467
               E++V  KE DLLAV++
Sbjct: 59  -HDNEKYVVMKESDLLAVIK 77



>gb:WSP318482_210501 Wolbachia sp. partial groE homologue
           operon.>gb:WSP318484_210505 Wolbachia sp. partial groE
           homologue operon.>gb:WSP318485_210507 Wolbachia sp.
           partial groE homologue operon.>gb:WSP318486_210509
           Wolbachia sp. partial groE homologue operon.
          Length = 78

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 9/80 (11%)
 Frame = +3

Query: 255 EKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVNAYEVN 407
           E+  GGI+LP SA K  +   GE++++G+G            V+TG KV +      EV 
Sbjct: 2   EEKQGGIVLPSSAEK--KPTKGEVIAIGSGSRNSSGERIALTVKTGDKVFYRQWAGTEVE 59

Query: 408 LGTEERHVFCKEGDLLAVVE 467
               E++V  KE DLLAV++
Sbjct: 60  -HDNEKYVVMKESDLLAVIK 78



>gb:CTU69255_119705 Chlamydia trachomatis heat shock
           protein/chaperonin 10 (hypA) gene, partial cds.
          Length = 97

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 9/90 (10%)
 Frame = +3

Query: 180 LSQKWEPTKVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS--- 350
           +S +    K+ P  DR+L++ EE    + GGI+LP +A K  +    E+L++GTG     
Sbjct: 1   MSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKK--KQDRAEVLALGTGKKDDK 58

Query: 351 ------EVETGKKVLFSDVNAYEVNLGTEE 422
                 EV+ G  VL    +  E+ +  EE
Sbjct: 59  GQQLPFEVQVGDIVLIDKYSGQELTVEGEE 88



>gb:AB008153_1213 Erwinia aphidicola gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEVLAVGNGRILENGDVKPLDVKVGDVVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           S+    +      E  +   E D+LA+VE
Sbjct: 59  SEGYGAKTEKIDNEEVLIISENDILAIVE 87



>gb:AB008143_1193 Serratia rubidaea gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAAG--KSTRGEVVAVGKGRVLESGNIQPLDVKIGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +V     E  +   E D+LA+VE
Sbjct: 59  NDGYGVKVEKIDNEEVLIMSESDILAIVE 87



>sp|Q8CWI9|CH12_VIBVU 10 kDa chaperonin 2 (Protein Cpn10 2) (groES
           protein 2).>gb:AE016812_338826 Vibrio vulnificus CMCP6
           chromosome II section 5 of 6 of the complete
           sequence.>gb:BA000038_725748 Vibrio vulnificus YJ016
           DNA, chromosome II, complete
           sequence.>gb:AE016796_1048550 Vibrio vulnificus CMCP6
           chromosome II complete sequence.
          Length = 96

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVS---------EVETG 365
           P  D++++  +E+  KS GGI+L   +VK      G++++ G G           EV+ G
Sbjct: 5   PLNDKLIVERQEVENKSEGGIVLTSQSVKKSN--RGKVIAAGLGKRLENGERASMEVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F+D    +      + ++   E D+LA+VE
Sbjct: 63  DVVIFNDGYGVKTEKMDGKEYLILSESDVLAIVE 96



>sp|Q8CWL1|CH11_VIBVU 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:AE016801_335968 Vibrio vulnificus CMCP6
           chromosome I section 5 of 11 of the complete
           sequence.>gb:BA000037_723933 Vibrio vulnificus YJ016
           DNA, chromosome I, complete
           sequence.>gb:AE016795_1045692 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 96

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++  +E+  KSAGGI+L  SA   E+   G +L+VG G           +V+ G
Sbjct: 5   PLHDRVIVERQEVESKSAGGIVLTGSAA--EKSTRGVVLAVGKGRILENGTVQPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      +  +   E D++A+V+
Sbjct: 63  DTVIFAESYGTKTEKIDGKEVLIMSENDIMAIVD 96



>sp|Q87KX3|CH11_VIBPA 10 kDa chaperonin 1 (Protein Cpn10 1) (groES
           protein 1).>gb:BA000031_708312 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 96

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV++  +E+  KSAGGI+L  SA   E+   G +L+VG G           +V+ G
Sbjct: 5   PLHDRVIVERKEVESKSAGGIVLTGSAA--EKSTRGVVLAVGKGRILENGTVLPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      +  +   E D++A+VE
Sbjct: 63  DTVIFAEGYGTKTEKIDGKEVLVMSENDIMAIVE 96



>gb:AF335185_502468 Enterococcus faecalis ATCC 29212 GroES (groES)
           and GroEL (groEL) genes, complete cds.
          Length = 94

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+IR+ +  EK+ GGI+L  ++V  E+   GE+++VG G           EV+ G
Sbjct: 4   PLGDRVVIRVAKEEEKTVGGIVL--ASVAQEKPQTGEVIAVGEGRVLENGTKVPMEVKIG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F   +  EV     E ++     D++A VE
Sbjct: 62  DTVMFEKYSGTEVKYEGVE-YLIVSAKDIIATVE 94



>gb:AB008152_1211 Erwinia carotovora gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEVLAVGHGRILENGEVKPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKAEKIDNEEVLIMSESDILAIVE 87



>gb:AB008151_1209 Pantoea ananas gene for GroES protein homologue,
           GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVEAKSAGGIVLTGSAA--GKSTRGEVLAVGKGRILESGEVKPLDVQVGDVVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           S+    +      E  +   E D+LA+VE
Sbjct: 59  SEGYGAKTEKIDNEEVLIISESDILAIVE 87



>gb:AB008150_1207 Erwinia herbicola gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+L+VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVEAKSAGGIVLTGSAA--GKSTRGEVLAVGNGRILESGDIKPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           S+    +      E  +   E D+LAVVE
Sbjct: 59  SEGYGAKTEKIDNEEVLIISESDILAVVE 87



>gb:AB008146_1199 Klebsiella pneumoniae gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVETKSAGGIVLTGSAA--AKSTRGEIIAVGKGRILENGTVQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKTEKIDNEEVLIMSESDILAIVE 87



>sp|Q93EU7|CH10_ENTFA 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE016955_366604 Enterococcus faecalis V583,
           section 9 of 11 of the complete
           genome.>gb:AY328531_609783 Enterococcus faecalis GroES
           (groES) gene, complete cds; and GroEL (groEL) gene,
           partial cds.>gb:AE016830_993092 Enterococcus faecalis
           V583, complete genome.
          Length = 94

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+IR+ +  EK+ GGI+L  ++V  E+   GE+++VG G           EV+ G
Sbjct: 4   PLGDRVVIRVAKEEEKTVGGIVL--ASVAKEKPQTGEVIAVGEGRVLENGTKVPMEVKIG 61

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F   +  EV     E ++     D++A VE
Sbjct: 62  DTVMFEKYSGTEVKYEGVE-YLIVSAKDIIATVE 94



>sp|Q9F4F2|CH10_BUCPP 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:BAP401306_747013 Buchnera aphidicola
           (Pterocomma populeum) groES gene and partial groEL gene.
          Length = 97

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL++ +E+  KSAGGI+L  SA    +   G +++VG G           +V+ G
Sbjct: 5   PLHDRVLVKRQEVELKSAGGIVLTGSAA--GKSTRGTVVAVGKGRILDNGETKSLDVKIG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      E  +   E D+LA+VE
Sbjct: 63  DVVIFNEGYGAKTEKIDNEELLILTESDILAIVE 96



>gb:AF542015_1809990 Griffithsia japonica heat shock protein 10
           mRNA, complete cds.
          Length = 102

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +3

Query: 204 KVVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEV 356
           K+VP  DRVL+      + S GG+LLP+SA+   +   G++++VG G            V
Sbjct: 8   KIVPLLDRVLVEKALAQKTSKGGVLLPESAI--SKLNEGKVIAVGPGARASDGSLVEPSV 65

Query: 357 ETGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
           + G  VL  D    +V +  ++  ++ ++ +LL ++
Sbjct: 66  KEGDNVLLPDYGGSKVQVDGKDLFLY-RDDELLGLI 100



>gb:MAL249748_1685564 Mortierella alpina hsp10 gene for putative
           heat shock protein 10, exons 1-4.
          Length = 104

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 9/96 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGV---------SEVE 359
           +VP  DRVL++  +  +K+A GI +P+ A   E    G +++VG G+         SE+ 
Sbjct: 12  IVPMMDRVLVQRIKPQQKTASGIYIPEKAQ--EALNEGYVVAVGKGLTTQEGKVVPSELA 69

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
            G KVL        V +  EE  +F +E ++LA ++
Sbjct: 70  EGDKVLLPPYGGSVVKVDNEELILF-RESEILAKIQ 104



>gb:CR382125_1657633 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 105

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VE 359
           +VP  DRVL++  +   K+A G+ LP+  V  E+     +L+ G G ++         V+
Sbjct: 11  IVPLLDRVLVQRIKAEAKTASGLYLPEKNV--EKLNQATVLAAGPGFTDSNGNKITPSVQ 68

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G +VL        + LG ++  V  ++ ++LA V
Sbjct: 69  PGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAKV 103



>gb:CR382125_1657632 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 107

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VE 359
           +VP  DRVL++  +   K+A G+ LP+  V  E+     +L+ G G ++         V+
Sbjct: 13  IVPLLDRVLVQRIKAEAKTASGLYLPEKNV--EKLNQATVLAAGPGFTDSNGNKITPSVQ 70

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G +VL        + LG ++  V  ++ ++LA V
Sbjct: 71  PGDQVLIPQFGGSTIKLGKDDEVVLFRDSEILAKV 105



>gb:AY680700_1622085 Vitis vinifera chloroplast chaperonin 21
           (cpn21) mRNA, partial cds; nuclear gene for chloroplast
           product.
          Length = 125

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTGVSE---------VETG 365
           P  DRVLI++ E  EK+AGG+LL +++   E+  +G +++VG G  +         V  G
Sbjct: 34  PLNDRVLIKVAEAEEKTAGGLLLTEASK--EKPSIGTVVAVGPGPLDEDGKRKPLSVSPG 91

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VL+S     +        ++  K  D++AV+
Sbjct: 92  NTVLYSKYAGNDFKGSDGSDYIALKASDIMAVL 124



>gb:AE013598_297990 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 134

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           + P  DRV+++  E  E SAGGI++P SA   E+   GE++++G G            V+
Sbjct: 42  IKPLHDRVVVKPIEADEVSAGGIVIPDSAK--EKSTKGEVVAIGAGKPLDNGSLRAPVVK 99

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KV++             E  V  +E D+LAV+
Sbjct: 100 VGDKVIYGQYAGSSYKSEGVEYKVL-REDDILAVI 133



>gb:WSP511282_210517 Wolbachia sp. wPseu partial groE operon (groES
           and groEL genes).
          Length = 77

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 9/80 (11%)
 Frame = +3

Query: 255 EKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVNAYEVN 407
           E+  GGI+LP SA K  +   GE++++G G            V+TG KV +      EV 
Sbjct: 1   EEKQGGIVLPSSAEK--KPTKGEVIAIGGGSRNSSGERIALTVKTGDKVFYRQWAGTEVE 58

Query: 408 LGTEERHVFCKEGDLLAVVE 467
               E++V  KE DLLAV++
Sbjct: 59  -HDNEKYVVMKESDLLAVIK 77



>gb:WSP318481_210499 Wolbachia sp. partial groE homologue
           operon.>gb:WSP318483_210503 Wolbachia sp. partial groE
           homologue operon.>gb:WSP318487_210511 Wolbachia sp.
           partial groE homologue operon.
          Length = 78

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 9/80 (11%)
 Frame = +3

Query: 255 EKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVNAYEVN 407
           E+  GGI+LP SA K  +   GE++++G G            V+TG KV +      EV 
Sbjct: 2   EEKQGGIVLPSSAEK--KPTKGEVIAIGGGSRNSSGERIALTVKTGDKVFYRQWAGTEVE 59

Query: 408 LGTEERHVFCKEGDLLAVVE 467
               E++V  KE DLLAV++
Sbjct: 60  -HDNEKYVVMKESDLLAVIK 78



>gb:AB008148_1203 Klebsiella planticola gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEIIAVGKGRILDNGTVQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKSEKIDNEEVLIMSESDILAIVE 87



>gb:AB008145_1197 Serratia marcescens gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEVVAVGKGRVLENGNIQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKAEKIDNEEVLIMSESDILAIVE 87



>gb:AB008144_1195 Serratia ficaria gene for GroES protein homologue,
           GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GE+++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEVVAVGKGRVLESGNIQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKAEKIDNEEVLIMSESDILAIVE 87



>gb:AB008140_1187 Enterobacter amnigenus gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVETKSAGGIVLTGSAA--TKSTRGEIIAVGKGRILENGTVQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKSEKIDNEEVLIMSESDILAIVE 87



>gb:AB008139_1185 Enterobacter gergoviae gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVESKSAGGIVLTGSAA--GKSTRGEIIAVGKGRILENGNVQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKSEKIDNEEVLIMSESDILAIVE 87



>gb:AB008137_1181 Enterobacter asburiae gene for GroES protein
           homologue, GroEL protein homologue, partial
           cds.>gb:AB008138_1183 Enterobacter intermedius gene for
           GroES protein homologue, GroEL protein homologue,
           partial cds.>gb:AB008141_1189 Enterobacter aerogenes
           gene for GroES protein homologue, GroEL protein
           homologue, partial cds.>gb:AB008142_1191 Enterobacter
           agglomerans gene for GroES protein homologue, GroEL
           protein homologue, partial cds.>gb:AB008147_1201
           Klebsiella oxytoca gene for GroES protein homologue,
           GroEL protein homologue, partial cds.>gb:AB008149_1205
           Klebsiella ornithinolytica gene for GroES protein
           homologue, GroEL protein homologue, partial cds.
          Length = 88

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 9/89 (10%)
 Frame = +3

Query: 228 VLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLF 380
           V+++ +E+  KSAGGI+L  SA    +   GEI++VG G           +V+ G  V+F
Sbjct: 1   VIVKRKEVETKSAGGIVLTGSAA--AKSTRGEIIAVGKGRILENGTVQPLDVKVGDIVIF 58

Query: 381 SDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
           +D    +      E  +   E D+LA+VE
Sbjct: 59  NDGYGVKSEKIDNEEVLIMSESDILAIVE 87



>sp|Q8RIT8|CH10_XANAC 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE011680_275501 Xanthomonas axonopodis pv.
           citri str. 306, section 58 of 469 of the complete
           genome.>gb:AE012149_279794 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 57 of 460 of the
           complete genome.>gb:AF426387_509858 Xanthomonas
           campestris pv. phaseoli groESL operon, complete
           sequence.>gb:AE008922_913076 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete
           genome.>gb:AE008923_917276 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 95

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 9/95 (9%)
 Frame = +3

Query: 207 VVPQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVE 359
           + P  DRV+++  E  E SAGGI++P SA   E+   GE++++G G            V+
Sbjct: 3   IKPLHDRVVVKPIEADEVSAGGIVIPDSAK--EKSTKGEVVAIGAGKPLDNGSLRAPVVK 60

Query: 360 TGKKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
            G KV++             E  V  +E D+LAV+
Sbjct: 61  VGDKVIYGQYAGSSYKSEGVEYKVL-REDDILAVI 94



>sp|Q8CX49|CH10_SHEON 10 kDa chaperonin (Protein Cpn10) (groES
           protein).>gb:AE015516_315120 Shewanella oneidensis MR-1
           section 65 of 457 of the complete
           genome.>gb:AE014299_950717 Shewanella oneidensis MR-1
           complete genome.
          Length = 96

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 29/93 (31%), Positives = 47/93 (50%), Gaps = 9/93 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  E+   SAGGI+L  SA   E+   GE+L+VG G           +V+ G
Sbjct: 5   PLHDRVIVKRLEVESTSAGGIVLTGSAA--EKSTRGEVLAVGNGRILENGTVRPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             V+F++    +      +  +   E DL+A+V
Sbjct: 63  DVVIFNEGYGVKKEKIDGQEVLILSEADLMAIV 95



>gb:BSP344977_750880 Buchnera sp. N27 groES gene for GroES- related
           molecular chaperonin and groEL gene.
          Length = 96

 Score = 40.8 bits (94), Expect = 0.025
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 9/94 (9%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRVL++  E   KSAGGI+L  SA    +   G I +VG G           +V+ G
Sbjct: 5   PLHDRVLVKRNEAELKSAGGIVLTGSAA--GKSTRGTITAVGNGRVLDNGQIKPLDVKVG 62

Query: 366 KKVLFSDVNAYEVNLGTEERHVFCKEGDLLAVVE 467
             V+F++    +      E  +   E D+LA+VE
Sbjct: 63  DVVIFNEGYGAKTEKIDNEELLILTESDILAIVE 96



>gb:WSP511281_210515 Wolbachia endosymbiont of Aedes albopictus
           partial groE operon (groES and groEL genes).
          Length = 76

 Score = 40.8 bits (94), Expect = 0.025
 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 9/79 (11%)
 Frame = +3

Query: 255 EKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETGKKVLFSDVNAYEVN 407
           E+  GGI+LP SA K  +   GE++++G G            V+TG KV +      EV 
Sbjct: 1   EEKQGGIVLPSSAEK--KPTKGEVIAIGGGSRNSSGERIALTVKTGDKVFYRQWAGTEVE 58

Query: 408 LGTEERHVFCKEGDLLAVV 464
               E++V  KE DLLAV+
Sbjct: 59  -HDNEKYVVMKESDLLAVI 76



>gb:AB057417_8380 Pseudoalteromonas sp. PS1M3 gene for GroES, GroEL,
           complete cds.
          Length = 95

 Score = 40.8 bits (94), Expect = 0.025
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 10/94 (10%)
 Frame = +3

Query: 213 PQADRVLIRLEELPEKSAGGILLPKSAVKFERYLMGEILSVGTG---------VSEVETG 365
           P  DRV+++  E   KSAGGI+L  SA   E+   GE+++VG G           EV+ G
Sbjct: 5   PLQDRVIVKRLEEETKSAGGIVLTGSAA--EKSTRGEVVAVGNGRILDNGDVRALEVKAG 62

Query: 366 KKVLF-SDVNAYEVNLGTEERHVFCKEGDLLAVV 464
             VLF S V   E   G E  ++  +E ++L +V
Sbjct: 63  DTVLFGSYVEKTEKIEGQE--YLIMREDNILGIV 94


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 758,984,403
Number of Sequences: 1806583
Number of extensions: 16004887
Number of successful extensions: 44696
Number of sequences better than 10.0: 373
Number of HSP's better than 10.0 without gapping: 41923
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44497
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43235250408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)