BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2234
         (1179 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB030083_1518398 Populus nigra PnLPK mRNA for lectin-like pro...   451   e-125   
gb:AY663848_1620593 Oryza sativa (japonica cultivar-group) lecti...   372   e-102   
gb:AP004811_1845488 Oryza sativa (japonica cultivar-group) genom...   370   e-101   
gb:AP003983_1835912 Oryza sativa (japonica cultivar-group) genom...   361   2e-98   
gb:AP004765_1844681 Oryza sativa (japonica cultivar-group) genom...   308   2e-82   
gb:AP003981_1835885 Oryza sativa (japonica cultivar-group) genom...   301   2e-80   
gb:AP002032_1821485 Arabidopsis thaliana genomic DNA, chromosome...   300   4e-80   
gb:OSJN00073_1694337 Oryza sativa genomic DNA, chromosome 4, BAC...   285   1e-75   
gb:AP003224_1825581 Oryza sativa (japonica cultivar-group) genom...   283   6e-75   
gb:AP003886_1834819 Oryza sativa (japonica cultivar-group) genom...   280   5e-74   
pir|T45878|T45878 receptor lectin kinase-like protein - Arabidop...   278   2e-73   Arabidopsis thaliana [mouse-ear cress]
pir|T49986|T49986 lectin-like protein kinase-like - Arabidopsis ...   277   3e-73   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00188_1696446 Oryza sativa genomic DNA, chromosome 4, BAC...   276   4e-73   
gb:AP005730_1856758 Oryza sativa (japonica cultivar-group) genom...   275   1e-72   
gb:AP005730_1856757 Oryza sativa (japonica cultivar-group) genom...   275   1e-72   
gb:AY358029_1601932 Medicago truncatula lectin-like receptor kin...   271   2e-71   
pir|T48335|T48335 receptor like protein kinase - Arabidopsis tha...   270   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb:AC134931_1741947 Oryza sativa (japonica cultivar-group) chrom...   270   5e-71   
gb:AP004166_1838479 Oryza sativa (japonica cultivar-group) genom...   268   2e-70   
gb:OSJN00183_1696341 Oryza sativa genomic DNA, chromosome 4, BAC...   268   2e-70   
gb:AP004301_1839834 Oryza sativa (japonica cultivar-group) genom...   267   3e-70   
gb:AP004254_1839176 Oryza sativa (japonica cultivar-group) genom...   266   5e-70   
gb:AE016959_1022785 Oryza sativa (japonica cultivar-group) chrom...   266   8e-70   
gb:AP004166_1838468 Oryza sativa (japonica cultivar-group) genom...   264   2e-69   
gb:AP003758_1833017 Oryza sativa (japonica cultivar-group) genom...   264   2e-69   
gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genom...   264   3e-69   
gb:AP004301_1839825 Oryza sativa (japonica cultivar-group) genom...   263   5e-69   
gb:AB026639_1517086 Arabidopsis thaliana genomic DNA, chromosome...   263   7e-69   
gb:AP006172_1861335 Oryza sativa (japonica cultivar-group) genom...   262   9e-69   
gb:AP004301_1839828 Oryza sativa (japonica cultivar-group) genom...   262   9e-69   
gb:AY358027_1601930 Medicago truncatula lectin-like receptor kin...   262   9e-69   
gb:AP004768_1844723 Oryza sativa (japonica cultivar-group) genom...   261   2e-68   
gb:AP004301_1839829 Oryza sativa (japonica cultivar-group) genom...   261   2e-68   
gb:AP004254_1839184 Oryza sativa (japonica cultivar-group) genom...   261   3e-68   
gb:AY358028_1601931 Medicago truncatula lectin-like receptor kin...   259   1e-67   
gb:AP004123_1837935 Oryza sativa (japonica cultivar-group) genom...   258   1e-67   
gb:AP004014_1836388 Oryza sativa (japonica cultivar-group) genom...   258   1e-67   
gb:AP003981_1835888 Oryza sativa (japonica cultivar-group) genom...   258   1e-67   
gb:AP004166_1838475 Oryza sativa (japonica cultivar-group) genom...   257   4e-67   
gb:AP005100_1847816 Oryza sativa (japonica cultivar-group) genom...   256   6e-67   
gb:AP005534_1853651 Oryza sativa (japonica cultivar-group) genom...   256   8e-67   
gb:AP006172_1861328 Oryza sativa (japonica cultivar-group) genom...   255   1e-66   
gb:AP004301_1839822 Oryza sativa (japonica cultivar-group) genom...   255   1e-66   
gb:AP005829_1858630 Oryza sativa (japonica cultivar-group) genom...   255   1e-66   
gb:AP003758_1833018 Oryza sativa (japonica cultivar-group) genom...   254   2e-66   
gb:AP005100_1847815 Oryza sativa (japonica cultivar-group) genom...   254   2e-66   
gb:OSJN00183_1696342 Oryza sativa genomic DNA, chromosome 4, BAC...   254   2e-66   
pir|T47694|T47694 probable serine/threonine-specific protein kin...   254   2e-66   Arabidopsis thaliana [mouse-ear cress]
gb:AP004301_1839831 Oryza sativa (japonica cultivar-group) genom...   254   3e-66   
gb:AP004123_1837931 Oryza sativa (japonica cultivar-group) genom...   254   3e-66   
gb:BT004634_1637668 Arabidopsis thaliana At3g53810 gene, complet...   253   7e-66   
pir|T45921|T45921 serine/threonine-specific kinase like protein ...   253   7e-66   Arabidopsis thaliana [mouse-ear cress]
gb:AP006172_1861338 Oryza sativa (japonica cultivar-group) genom...   252   1e-65   
gb:AP004301_1839832 Oryza sativa (japonica cultivar-group) genom...   252   1e-65   
gb:AP004014_1836383 Oryza sativa (japonica cultivar-group) genom...   251   2e-65   
pir|T02537|T02537 probable serine/threonine-specific protein kin...   250   3e-65   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022784 Oryza sativa (japonica cultivar-group) chrom...   250   4e-65   
pir|T50661|T50661 receptor-type protein kinase LRK1 [imported] -...   250   4e-65   Arabidopsis thaliana [mouse-ear cress]
gb:AP004014_1836374 Oryza sativa (japonica cultivar-group) genom...   249   6e-65   
gb:AP004166_1838474 Oryza sativa (japonica cultivar-group) genom...   249   1e-64   
gb:AP004301_1839833 Oryza sativa (japonica cultivar-group) genom...   248   2e-64   
gb:AJ784275_1814004 Hordeum vulgare subsp. vulgare mRNA for puta...   248   2e-64   
pir|S68589|S68589 serine/threonine-specific kinase lecRK1 (EC 2....   248   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb:AP004014_1836380 Oryza sativa (japonica cultivar-group) genom...   247   3e-64   
gb:AP004014_1836375 Oryza sativa (japonica cultivar-group) genom...   247   4e-64   
gb:AC093018_1735833 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   247   4e-64   
gb:AP004301_1839835 Oryza sativa (japonica cultivar-group) genom...   246   5e-64   
gb:AP004014_1836377 Oryza sativa (japonica cultivar-group) genom...   244   2e-63   
gb:AY358030_1601933 Medicago truncatula lectin-like receptor kin...   244   2e-63   
gb:AP006172_1861333 Oryza sativa (japonica cultivar-group) genom...   243   4e-63   
gb:AP004301_1839826 Oryza sativa (japonica cultivar-group) genom...   243   4e-63   
gb:AP004014_1836376 Oryza sativa (japonica cultivar-group) genom...   243   4e-63   
pir|T47799|T47799 receptor lectin kinase-like protein - Arabidop...   243   4e-63   Arabidopsis thaliana [mouse-ear cress]
pir|T01308|T01308 probable serine/threonine-specific protein kin...   243   4e-63   Arabidopsis thaliana [mouse-ear cress]
gb:AB016890_1513216 Arabidopsis thaliana genomic DNA, chromosome...   243   5e-63   
gb:ATF24G16_1549841 Arabidopsis thaliana DNA chromosome 3, BAC c...   243   7e-63   
pir|T49315|T49315 receptor lectin kinase 3 - Arabidopsis thalian...   243   7e-63   Arabidopsis thaliana [mouse-ear cress]
pir|T47798|T47798 receptor lectin kinase 3 - Arabidopsis thalian...   243   7e-63   Arabidopsis thaliana [mouse-ear cress]
gb:ATU93161_1557393 Arabidopsis thaliana AthlecRK4 pseudogene, c...   242   9e-63   
gb:AP003758_1833016 Oryza sativa (japonica cultivar-group) genom...   241   2e-62   
pir|A96724|A96724 hypothetical protein F20P5.15 [imported] - Ara...   241   2e-62   Arabidopsis thaliana [mouse-ear cress]
gb:AF487461_1804285 Gossypium hirsutum receptor kinase Lecrk mRN...   241   3e-62   
gb:AP005518_1853323 Oryza sativa (japonica cultivar-group) genom...   240   4e-62   
gb:AP005091_1847649 Oryza sativa (japonica cultivar-group) genom...   240   4e-62   
gb:AP003742_1832719 Oryza sativa (japonica cultivar-group) genom...   240   4e-62   
pir|H96723|H96723 hypothetical protein F20P5.16 [imported] - Ara...   239   8e-62   Arabidopsis thaliana [mouse-ear cress]
pir|T08960|T08960 serine/threonine-specific protein kinase (EC 2...   238   1e-61   Arabidopsis thaliana [mouse-ear cress]
gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genom...   238   2e-61   
gb:AP004014_1836385 Oryza sativa (japonica cultivar-group) genom...   238   2e-61   
gb:AP004301_1839823 Oryza sativa (japonica cultivar-group) genom...   236   7e-61   
gb:AP004014_1836378 Oryza sativa (japonica cultivar-group) genom...   235   1e-60   
pir|T01309|T01309 probable serine/threonine-specific protein kin...   235   1e-60   Arabidopsis thaliana [mouse-ear cress]
pir|B86289|B86289 probable serine/threonine-specific protein kin...   235   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AB016890_1513217 Arabidopsis thaliana genomic DNA, chromosome...   234   3e-60   
gb:OSJN00280_1697870 Oryza sativa genomic DNA, chromosome 4, BAC...   234   3e-60   
gb:ATAC010871_1543204 Arabidopsis thaliana chromosome III BAC T1...   233   4e-60   
gb:OSJN00256_1697499 Oryza sativa genomic DNA, chromosome 4, BAC...   233   6e-60   
pir|D85062|D85062 hypothetical protein AT4g04960 [imported] - Ar...   232   1e-59   Arabidopsis thaliana [mouse-ear cress]
pir|T47484|T47484 receptor like protein kinase - Arabidopsis tha...   232   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AB017067_1513421 Arabidopsis thaliana genomic DNA, chromosome...   231   2e-59   
pir|T47481|T47481 receptor-like protein kinase - Arabidopsis tha...   231   2e-59   Arabidopsis thaliana [mouse-ear cress]
pir|T47483|T47483 receptor like protein kinase - Arabidopsis tha...   231   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb:BT008663_1639865 Arabidopsis thaliana clone RAFL16-97-D11 (R5...   230   4e-59   
gb:AP005091_1847629 Oryza sativa (japonica cultivar-group) genom...   230   5e-59   
pir|D84869|D84869 probable receptor protein kinase [imported] - ...   229   6e-59   Arabidopsis thaliana [mouse-ear cress]
pir|T48176|T48176 receptor like protein kinase - Arabidopsis tha...   229   8e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AC009894_1536870 Arabidopsis thaliana chromosome I BAC T6H22 ...   229   1e-58   
pir|G96602|G96602 probable receptor protein kinase F14G9.24 [imp...   229   1e-58   Arabidopsis thaliana [mouse-ear cress]
pir|T04606|T04606 protein kinase homolog F20O9.40 - Arabidopsis ...   228   1e-58   Arabidopsis thaliana [mouse-ear cress]
gb:BT015370_1642198 Arabidopsis thaliana At5g01560 gene, complet...   227   4e-58   
pir|T48177|T48177 receptor like protein kinase - Arabidopsis tha...   227   4e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023607 Oryza sativa (japonica cultivar-group) chrom...   226   5e-58   
gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genom...   224   2e-57   
pir|T48175|T48175 receptor like protein kinase - Arabidopsis tha...   224   3e-57   Arabidopsis thaliana [mouse-ear cress]
pir|F96602|F96602 hypothetical protein T6H22.8.2 [imported] - Ar...   224   3e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AP004688_1843412 Oryza sativa (japonica cultivar-group) genom...   223   4e-57   
gb:AB015471_1512521 Arabidopsis thaliana genomic DNA, chromosome...   223   4e-57   
pir|E96602|E96602 hypothetical protein T6H22.9 [imported] - Arab...   221   2e-56   Arabidopsis thaliana [mouse-ear cress]
pir|C96729|C96729 hypothetical protein F24J13.10 [imported] - Ar...   221   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AP005156_1848351 Oryza sativa (japonica cultivar-group) genom...   221   2e-56   
gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genom...   221   3e-56   
gb:AY572461_1615703 Oryza sativa putative cytokinin receptor mRN...   221   3e-56   
pir|T47482|T47482 receptor-like protein kinase - Arabidopsis tha...   221   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genom...   219   6e-56   
gb:AY056317_1563628 Arabidopsis thaliana putative receptor prote...   219   6e-56   
gb:AB026632_1517030 Arabidopsis thaliana genomic DNA, chromosome...   219   6e-56   
pir|C96574|C96574 hypothetical protein T3F20.25 [imported] - Ara...   219   1e-55   Arabidopsis thaliana [mouse-ear cress]
pir|T47473|T47473 receptor-like protein kinase - Arabidopsis tha...   218   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...   216   5e-55   
gb:OSJN00093_1694776 Oryza sativa genomic DNA, chromosome 4, BAC...   216   5e-55   
pir|D96574|D96574 hypothetical protein T3F20.24 [imported] - Ara...   216   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020597 Oryza sativa (japonica cultivar-group) chrom...   216   9e-55   
gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genom...   214   4e-54   
gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18 ...   214   4e-54   
pir|F86420|F86420 probable receptor-like serine/threonine kinase...   214   4e-54   Arabidopsis thaliana [mouse-ear cress]
pir|C84869|C84869 probable receptor protein kinase [imported] - ...   213   5e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AC009894_1536869 Arabidopsis thaliana chromosome I BAC T6H22 ...   213   8e-54   
gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genom...   211   2e-53   
gb:AP003811_1833701 Oryza sativa (japonica cultivar-group) genom...   211   2e-53   
gb:AE005173_894228 Arabidopsis thaliana chromosome 1, bottom arm...   211   2e-53   
pir|F85057|F85057 receptor-like protein kinase [imported] - Arab...   211   2e-53   Arabidopsis thaliana [mouse-ear cress]
pir|E96641|E96641 hypothetical protein T25B24.4 [imported] - Ara...   211   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genom...   211   2e-53   
gb:OSJN00093_1694777 Oryza sativa genomic DNA, chromosome 4, BAC...   211   2e-53   
gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC...   211   2e-53   
gb:AY085009_1570091 Arabidopsis thaliana clone 124301 mRNA, comp...   211   2e-53   
gb:ATAC009326_1542913 Arabidopsis thaliana chromosome III P1 MZB...   211   2e-53   
pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis ...   211   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832651 Oryza sativa (japonica cultivar-group) genom...   210   4e-53   
gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genom...   210   4e-53   
gb:AF084036_1767053 Arabidopsis thaliana receptor-like protein k...   210   4e-53   
gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.   210   4e-53   
gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complet...   210   4e-53   
gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC cl...   210   4e-53   
pir|T04835|T04835 probable serine/threonine-specific protein kin...   210   4e-53   Arabidopsis thaliana [mouse-ear cress]
pir|A85041|A85041 probable receptor kinase [imported] - Arabidop...   210   4e-53   Arabidopsis thaliana [mouse-ear cress]
pir|T04665|T04665 probable serine/threonine-specific protein kin...   210   4e-53   Arabidopsis thaliana [mouse-ear cress]
pir|C85420|C85420 protein kinase-like protein [imported] - Arabi...   210   4e-53   Arabidopsis thaliana [mouse-ear cress]
sp|P27450|CX32_ARATH|CX32_ARATH Probable serine/threonine-protein kinase Cx...   210   4e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genom...   210   5e-53   
gb:AP000420_1820165 Arabidopsis thaliana genomic DNA, chromosome...   210   5e-53   
gb:ITU20948_1683300 Ipomoea trifida receptor protein kinase (IRK...   210   5e-53   
pir|T47793|T47793 receptor-like protein kinase - Arabidopsis tha...   210   5e-53   Arabidopsis thaliana [mouse-ear cress]
pir|H86246|H86246 hypothetical protein [imported] - Arabidopsis ...   210   5e-53   Arabidopsis thaliana [mouse-ear cress]
sp|Q06548|APKA_ARATH|APKA_ARATH Protein kinase APK1A (EC 2.7.1.-).>pir|S286...   210   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP003811_1833703 Oryza sativa (japonica cultivar-group) genom...   209   7e-53   
gb:AF024649_1762137 Arabidopsis thaliana receptor-like serine/th...   209   7e-53   
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...   209   7e-53   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...   209   7e-53   
gb:AB006705_1509998 Arabidopsis thaliana genomic DNA, chromosome...   209   7e-53   
gb:AP004260_1839289 Oryza sativa (japonica cultivar-group) genom...   209   9e-53   
gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genom...   209   9e-53   
gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chrom...   209   9e-53   
gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isola...   209   9e-53   
gb:AB026632_1517029 Arabidopsis thaliana genomic DNA, chromosome...   209   9e-53   
gb:AB026632_1517028 Arabidopsis thaliana genomic DNA, chromosome...   209   9e-53   
pir|C85057|C85057 probable receptor-like protein kinase [importe...   209   9e-53   Arabidopsis thaliana [mouse-ear cress]
pir|S70769|S70769 S-receptor kinase (EC 2.7.1.-) Ark1 precursor ...   209   9e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genom...   209   1e-52   
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...   209   1e-52   
gb:AJ704376_1813563 Senecio squalidus mRNA for S-receptor kinase...   208   1e-52   
gb:AF403127_1796415 Oryza sativa S-locus receptor-like kinase RL...   208   1e-52   
gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genom...   208   2e-52   
pir|T10567|T10567 probable serine/threonine-specific protein kin...   208   2e-52   Arabidopsis thaliana [mouse-ear cress]
pir|T04837|T04837 probable serine/threonine-specific protein kin...   208   2e-52   Arabidopsis thaliana [mouse-ear cress]
pir|JQ1677|JQ1677 S-receptor kinase (EC 2.7.1.-) precursor - rap...   208   2e-52   Brassica napus var. napus [annual rape]
gb:AC135205_1742004 Oryza sativa (japonica cultivar-group) chrom...   207   3e-52   
pir|A86247|A86247 hypothetical protein [imported] - Arabidopsis ...   207   3e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AP004768_1844703 Oryza sativa (japonica cultivar-group) genom...   207   3e-52   
gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genom...   207   3e-52   
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...   207   3e-52   
pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 - turnip>...   207   3e-52   Brassica rapa
pir|S51527|S51527 S-receptor kinase (EC 2.7.1.-) A14 precursor -...   207   3e-52   Brassica napus [oilseed rape]
gb:AP003990_1836012 Oryza sativa (japonica cultivar-group) genom...   207   4e-52   
gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chrom...   207   4e-52   
gb:AB006702_1509943 Arabidopsis thaliana genomic DNA, chromosome...   207   4e-52   
gb:AE016959_1022495 Oryza sativa (japonica cultivar-group) chrom...   207   4e-52   
gb:AY303171_1597401 Solanum bulbocastanum chromosome 8 clone 177...   206   6e-52   
pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 prec...   206   6e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genom...   206   7e-52   
gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genom...   206   7e-52   
gb:AP003856_1834380 Oryza sativa (japonica cultivar-group) genom...   206   7e-52   
gb:AF224705_1778584 Arabidopsis thaliana receptor-like protein k...   206   7e-52   
pir|D84860|D84860 probable protein kinase [imported] - Arabidops...   206   7e-52   Arabidopsis thaliana [mouse-ear cress]
pir|T14519|T14519 probable S-receptor kinase (EC 2.7.1.-) SFR1 -...   206   7e-52   Brassica oleracea
pir|T12973|T12973 protein kinase homolog T6H20.210 - Arabidopsis...   206   7e-52   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00093_1694779 Oryza sativa genomic DNA, chromosome 4, BAC...   206   1e-51   
gb:OSJN00073_1694338 Oryza sativa genomic DNA, chromosome 4, BAC...   206   1e-51   
gb:BOLSRKA_1633859 Turnip mRNA for S-receptor kinase SRK9, parti...   206   1e-51   
gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, compl...   206   1e-51   
gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4...   206   1e-51   
pir|T14471|T14471 probable S-receptor kinase (EC 2.7.1.-) srk29 ...   206   1e-51   Brassica oleracea
pir|T14398|T14398 S-receptor kinase (EC 2.7.1.-) - turnip>gb:D88...   206   1e-51   Brassica rapa
gb:AP004401_1841245 Oryza sativa (japonica cultivar-group) genom...   205   1e-51   
gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome...   205   1e-51   
gb:AF527808_1808433 Sorghum bicolor clone BAC SBTXS_0040L6 php20...   205   1e-51   
gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chrom...   205   1e-51   
gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genom...   205   2e-51   
pir|T01711|T01711 probable serine/threonine-specific protein kin...   205   2e-51   Arabidopsis thaliana [mouse-ear cress]
pir|T14450|T14450 serine/threonine kinase (EC 2.7.1.-) BRLK - wi...   205   2e-51   Brassica oleracea
pir|T51453|T51453 serine/threonine specific protein kinase-like ...   205   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...   204   2e-51   
gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRN...   204   2e-51   
gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11 ...   204   2e-51   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...   204   2e-51   
gb:AE016959_1023140 Oryza sativa (japonica cultivar-group) chrom...   204   2e-51   
pir|T14472|T14472 S-receptor kinase (EC 2.7.1.-) - wild cabbage>...   204   2e-51   Brassica oleracea
gb:AP004687_1843385 Oryza sativa (japonica cultivar-group) genom...   204   3e-51   
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...   204   3e-51   
pir|T47526|T47526 protein kinase-like - Arabidopsis thaliana>gb:...   204   3e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AP004260_1839291 Oryza sativa (japonica cultivar-group) genom...   204   4e-51   
gb:AC079288_1732515 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   204   4e-51   
gb:AB024416_1515946 Brassica oleracea SRK2-b mRNA, complete cds.      204   4e-51   
gb:AB013720_1512253 Brassica oleracea mRNA for SRK23Bol, partial...   204   4e-51   
gb:AB012106_1511634 Brassica rapa mRNA for SRK45, complete cds.       204   4e-51   
gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genom...   203   5e-51   
gb:AP003736_1832661 Oryza sativa (japonica cultivar-group) genom...   203   6e-51   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...   203   6e-51   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...   203   6e-51   
pir|A41369|A41369 S-receptor kinase (EC 2.7.1.-) 6 precursor - w...   203   6e-51   Brassica oleracea var. viridis [collards]
sp|Q09092|SRK6_BRAOL|SRK6_BRAOL Putative serine/threonine-protein kinase re...   203   6e-51   Brassica oleracea
gb:AK117389_1815427 Arabidopsis thaliana At2g02800 mRNA for puta...   202   8e-51   
gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC...   202   8e-51   
gb:BOY18259_1633944 Brassica oleracea mRNA for SRK5 protein, par...   202   8e-51   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...   202   8e-51   
pir|T00848|T00848 probable serine/threonine-specific protein kin...   202   8e-51   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00153_1695778 Oryza sativa genomic DNA, chromosome 4, BAC...   202   1e-50   
gb:AY074844_1567697 Arabidopsis thaliana AT4g21410/T6K22_140 mRN...   202   1e-50   
gb:AB032473_1518696 Brassica oleracea SRK18 mRNA for S18 S-locus...   202   1e-50   
gb:AX038195_1457677 Sequence 10 from Patent WO0060086.                202   1e-50   
gb:AP003863_1834477 Oryza sativa (japonica cultivar-group) genom...   202   1e-50   
gb:AP003736_1832657 Oryza sativa (japonica cultivar-group) genom...   202   1e-50   
gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein k...   202   1e-50   
gb:AF078082_1766256 Phaseolus vulgaris receptor-like protein kin...   202   1e-50   
gb:AC079288_1732513 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   202   1e-50   
gb:STU306629_1723040 Solanum tuberosum mRNA for putative recepto...   202   1e-50   
gb:STU306628_1723039 Solanum tuberosum mRNA for putative recepto...   202   1e-50   
gb:STU306627_1723038 Solanum tuberosum mRNA for putative recepto...   202   1e-50   
gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specif...   202   1e-50   
gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specif...   202   1e-50   
gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like pro...   202   1e-50   
gb:AY091006_1574238 Arabidopsis thaliana putative receptor serin...   202   1e-50   
gb:AB041620_1519687 Brassica rapa BcRL3 gene for receptor kinase...   202   1e-50   
pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis tha...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis ...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
pir|T04845|T04845 probable serine/threonine-specific protein kin...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
pir|A86421|A86421 Receptor-like serine/threonine kinase (RFK1) [...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
pir|T47684|T47684 serine/threonine-specific protein kinase-like ...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
sp|P46573|APKB_ARATH|APKB_ARATH Protein kinase APK1B (EC 2.7.1.-).>pir|T027...   202   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb:BOY18260_1633945 Brassica oleracea mRNA for SRK15 protein, pa...   201   2e-50   
gb:AB097116_1525939 Brassica rapa SRK-60, SLG-60 genes for S rec...   201   2e-50   
gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genom...   201   2e-50   
gb:AF474072_1803107 Hordeum vulgare sp. vulgare cultivar Morex B...   201   2e-50   
gb:AC136220_1743061 Oryza sativa (japonica cultivar-group) chrom...   201   2e-50   
gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   201   2e-50   
gb:OSJN00019_1693376 Oryza sativa genomic DNA, chromosome 4, BAC...   201   2e-50   
gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC BA...   201   2e-50   
gb:AY099582_1576608 Arabidopsis thaliana serine/threonine kinase...   201   2e-50   
gb:AY062569_1565225 Arabidopsis thaliana putative protein (At4g2...   201   2e-50   
gb:AE016959_1020855 Oryza sativa (japonica cultivar-group) chrom...   201   2e-50   
pir|T01086|T01086 probable serine/threonine-specific protein kin...   201   2e-50   
pir|T14470|T14470 receptor-like kinase (EC 2.7.1.-) SFR2 - wild ...   201   2e-50   
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...   201   3e-50   
gb:BOARLKGEN_1633734 B.oleraceae gene encoding serine/threonine ...   201   3e-50   
gb:AY059921_1564765 Arabidopsis thaliana Unknown protein (F19K19...   201   3e-50   
pir|T06082|T06082 protein kinase homolog T9A14.110 - Arabidopsis...   201   3e-50   
pir|T14375|T14375 S-receptor kinase (EC 2.7.1.-) 1 - turnip>gb:A...   201   3e-50   
pir|H86301|H86301 hypothetical protein F19K19.4 [imported] - Ara...   201   3e-50   
pir|T05181|T05181 S-receptor kinase (EC 2.7.1.-) T6K22.120 precu...   201   3e-50   
sp|P43293|NAK_ARATH|NAK_ARATH Probable serine/threonine-protein kinase NAK...   201   3e-50   
gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genom...   200   4e-50   
gb:AP003368_1828580 Oryza sativa (japonica cultivar-group) genom...   200   4e-50   
gb:STU306626_1723037 Solanum tuberosum mRNA for putative recepto...   200   4e-50   
gb:AC079022_1541726 Oryza sativa chromosome 5 clone P0574H01, co...   200   4e-50   
gb:AB041621_1519688 Brassica rapa BcRK5 gene for receptor kinase...   200   4e-50   
gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genom...   200   5e-50   
gb:AF224707_1778586 Arabidopsis thaliana receptor-like protein k...   200   5e-50   
gb:AF024648_1762136 Arabidopsis thaliana receptor-like serine/th...   200   5e-50   
gb:AC079357_1732541 Oryza sativa (japonica cultivar-group) chrom...   200   5e-50   
gb:AY142496_1582925 Arabidopsis thaliana putative protein kinase...   200   5e-50   
gb:AB052755_1521237 Arabidopsis lyrata mRNA for SRKa, partial cds.    200   5e-50   
gb:AX038197_1457678 Sequence 12 from Patent WO0060086.>gb:ATAC01...   200   5e-50   
pir|T52285|T52285 serine/threonine-specific protein kinase APK2a...   200   5e-50   
gb:AP004231_1839010 Oryza sativa (japonica cultivar-group) genom...   199   7e-50   
gb:OSJN00017_1693336 Oryza sativa genomic DNA, chromosome 4, BAC...   199   7e-50   
gb:AE016959_1020856 Oryza sativa (japonica cultivar-group) chrom...   199   7e-50   
pir|T05180|T05180 S-receptor kinase (EC 2.7.1.-) ARK3 precursor ...   199   7e-50   
gb:AP004348_1840627 Oryza sativa (japonica cultivar-group) genom...   199   9e-50   
gb:AP004314_1840053 Oryza sativa (japonica cultivar-group) genom...   199   9e-50   
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...   199   9e-50   
gb:AC079288_1732514 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   199   9e-50   
pir|T00788|T00788 probable protein kinase [imported] - Arabidops...   199   9e-50   
pir|H86420|H86420 probable receptor-like serine/threonine kinase...   199   9e-50   
gb:AF403126_1796414 Oryza sativa S-locus receptor-like kinase RL...   199   1e-49   
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...   199   1e-49   
gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC...   199   1e-49   
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...   199   1e-49   
pir|A96563|A96563 probable protein kinase 60711-62822 [imported]...   199   1e-49   
gb:AP004685_1843366 Oryza sativa (japonica cultivar-group) genom...   198   2e-49   
gb:ATAC012395_1543484 Arabidopsis thaliana chromosome III BAC T1...   198   2e-49   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...   198   2e-49   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...   198   2e-49   
pir|D96639|D96639 protein T1F9.12 [imported] - Arabidopsis thali...   198   2e-49   
gb:AP004093_1837600 Oryza sativa (japonica cultivar-group) genom...   198   2e-49   
gb:AP004048_1836910 Oryza sativa (japonica cultivar-group) genom...   198   2e-49   
gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 ge...   198   2e-49   
gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC...   198   2e-49   
gb:BT004627_1637661 Arabidopsis thaliana At3g07070 gene, complet...   198   2e-49   
gb:ATHPRKINA_1553318 Arabidopsis thaliana Columbia protein kinas...   198   2e-49   
pir|A96529|A96529 hypothetical protein F13F21.28 [imported] - Ar...   198   2e-49   
pir|T04830|T04830 probable serine/threonine-specific protein kin...   198   2e-49   
gb:OSJN00195_1696529 Oryza sativa genomic DNA, chromosome 4, BAC...   197   3e-49   
gb:ATH9671_1552957 Arabidopsis thaliana gene encoding putative k...   197   3e-49   
gb:AE005172_889763 Arabidopsis thaliana chromosome 1, top arm co...   197   3e-49   
pir|D96728|D96728 hypothetical protein F24J13.3 [imported] - Ara...   197   3e-49   
pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis ...   197   3e-49   
pir|T10566|T10566 probable serine/threonine-specific protein kin...   197   3e-49   
pir|D85065|D85065 receptor protein kinase-like protein [imported...   197   3e-49   
pir|S31429|S31429 S-receptor kinase (EC 2.7.1.-) precursor - wil...   197   3e-49   
gb:AP005742_1856979 Oryza sativa (japonica cultivar-group) genom...   197   3e-49   
gb:AP005092_1847661 Oryza sativa (japonica cultivar-group) genom...   197   3e-49   
gb:AP003406_1828884 Oryza sativa (japonica cultivar-group) genom...   197   3e-49   
gb:AF084035_1767052 Arabidopsis thaliana receptor-like protein k...   197   3e-49   
gb:AY494981_1608865 Triticum turgidum A genome HMW glutenin A ge...   197   3e-49   
gb:AB121973_1528021 Brassica rapa MLPK mRNA for protein kinase, ...   197   3e-49   
pir|T10569|T10569 probable serine/threonine-specific protein kin...   197   3e-49   
gb:AP005679_1855870 Oryza sativa (japonica cultivar-group) genom...   197   4e-49   
gb:AP003863_1834484 Oryza sativa (japonica cultivar-group) genom...   197   4e-49   
gb:BT020268_1642663 Arabidopsis thaliana At1g26970 mRNA, complet...   197   4e-49   
gb:BT015737_1642355 Arabidopsis thaliana At1g69790 mRNA, complet...   197   4e-49   
pir|A96720|A96720 hypothetical protein T6C23.1 [imported] - Arab...   197   4e-49   
gb:AF224706_1778585 Arabidopsis thaliana receptor-like protein k...   196   6e-49   
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...   196   6e-49   
gb:AE016959_1021800 Oryza sativa (japonica cultivar-group) chrom...   196   6e-49   
pir|T04831|T04831 probable serine/threonine-specific protein kin...   196   6e-49   
pir|T02153|T02153 protein kinase homolog T1F15.1 - Arabidopsis t...   196   6e-49   
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...   196   8e-49   
gb:OSJN00133_1190827 Oryza sativa (japonica cultivar-group) chro...   196   8e-49   
pir|T01550|T01550 receptor kinase homolog A_TM018A10.18 - Arabid...   196   8e-49   
gb:AP003518_1830289 Oryza sativa (japonica cultivar-group) genom...   196   1e-48   
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...   196   1e-48   
gb:AP003406_1828888 Oryza sativa (japonica cultivar-group) genom...   195   1e-48   
gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genom...   195   1e-48   
gb:AC136220_1743067 Oryza sativa (japonica cultivar-group) chrom...   195   1e-48   
gb:AC135916_1742802 Genomic sequence for Oryza sativa, Nipponbar...   195   1e-48   
gb:AC129718_1740653 Oryza sativa (japonica cultivar-group) chrom...   195   1e-48   
gb:OSJN00133_1190831 Oryza sativa (japonica cultivar-group) chro...   195   1e-48   
gb:AP003854_1834320 Oryza sativa (japonica cultivar-group) genom...   195   2e-48   
gb:AB052756_1521238 Arabidopsis lyrata mRNA for SRKb, complete cds.   195   2e-48   
gb:AB024421S2_1515950 Brassica oleracea SRK13-b gene, exon 2, 3,...   195   2e-48   
gb:AE005172_890869 Arabidopsis thaliana chromosome 1, top arm co...   195   2e-48   
pir|B96640|B96640 hypothetical protein T25B24.15 [imported] - Ar...   195   2e-48   
gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine pr...   194   2e-48   
gb:AP003736_1832650 Oryza sativa (japonica cultivar-group) genom...   194   2e-48   
gb:AF480497_1803756 Oryza sativa clone BAC 24K23, complete seque...   194   2e-48   
gb:OSJN00174_1696190 Oryza sativa genomic DNA, chromosome 4, BAC...   194   2e-48   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...   194   2e-48   
pir|G86420|G86420 probable receptor-like serine/threonine kinase...   194   2e-48   
gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genom...   194   3e-48   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...   194   3e-48   
gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC...   194   3e-48   
gb:AY427196_1605784 Vitis riparia isolate stkVr121 resistance pr...   194   3e-48   
gb:AB032474_1518697 Brassica oleracea SRK60 mRNA for S60 S-locus...   194   3e-48   
gb:AB024419S2_1515949 Brassica oleracea SRK13 gene, exon 2, 3, 4...   194   3e-48   
gb:AB013717S2_1512251 Brassica rapa gene for SRK46Bra, exon 2, 3...   194   3e-48   
gb:AE016959_1023261 Oryza sativa (japonica cultivar-group) chrom...   194   3e-48   
gb:AE016959_1021829 Oryza sativa (japonica cultivar-group) chrom...   194   3e-48   
pir|D86244|D86244 protein Ser/Thr protein kinase homolog [import...   194   3e-48   
pir|T10573|T10573 probable serine/threonine-specific protein kin...   194   3e-48   
pir|T10568|T10568 probable serine/threonine-specific protein kin...   194   3e-48   
pir|T04833|T04833 hypothetical protein F21P8.50 - Arabidopsis th...   194   3e-48   
pir|B85122|B85122 serine/threonine kinase-like protein (partial)...   194   3e-48   
pir|T05753|T05753 S-receptor kinase (EC 2.7.1.-) M4I22.100 precu...   194   3e-48   
pir|JC2481|JC2481 S-receptor kinase (EC 2.7.1.-) 8 precursor - f...   194   3e-48   
gb:AP004858_1846106 Oryza sativa (japonica cultivar-group) genom...   194   4e-48   
gb:AY099669_1576694 Arabidopsis thaliana serine/threonine protei...   194   4e-48   
gb:AY085132_1570213 Arabidopsis thaliana clone 13257 mRNA, compl...   194   4e-48   
gb:AB028609_1517917 Arabidopsis thaliana genomic DNA, chromosome...   194   4e-48   
gb:AB012247_1511814 Arabidopsis thaliana genomic DNA, chromosome...   194   4e-48   
gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome...   194   4e-48   
gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genom...   193   5e-48   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...   193   5e-48   
gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complet...   193   5e-48   
gb:BT005955_1638877 Arabidopsis thaliana At4g34440 gene, complet...   193   5e-48   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...   193   5e-48   
gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complet...   193   5e-48   
gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, compl...   193   5e-48   
gb:AC007127_1535275 Arabidopsis thaliana chromosome 2 clone T23A...   193   5e-48   
gb:AE005173_893805 Arabidopsis thaliana chromosome 1, bottom arm...   193   5e-48   
pir|E84549|E84549 probable protein kinase [imported] - Arabidops...   193   5e-48   
pir|T05149|T05149 protein kinase homolog F18E5.30 - Arabidopsis ...   193   5e-48   
gb:AF403128_1796416 Oryza sativa S-locus receptor-like kinase RL...   193   6e-48   
gb:ATCHRIV12_1544293 Arabidopsis thaliana DNA chromosome 4, cont...   193   6e-48   
gb:AB026654_1517312 Arabidopsis thaliana genomic DNA, chromosome...   193   6e-48   
gb:AB016892_1513231 Arabidopsis thaliana genomic DNA, chromosome...   193   6e-48   
gb:AX138085_1462208 Sequence 31 from Patent EP1094113.                193   6e-48   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...   193   6e-48   
pir|F84564|F84564 probable protein kinase [imported] - Arabidops...   193   6e-48   
pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5....   193   6e-48   
gb:AP004991_1846842 Oryza sativa (japonica cultivar-group) genom...   192   8e-48   
gb:BOLRPKB_1633858 Brassica campestris mRNA for receptor protein...   192   8e-48   
gb:AY303171_1597402 Solanum bulbocastanum chromosome 8 clone 177...   192   8e-48   
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...   192   8e-48   
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...   192   8e-48   
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...   192   1e-47   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...   192   1e-47   
gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genom...   192   1e-47   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...   192   1e-47   
gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome...   192   1e-47   
gb:AX138087_1462209 Sequence 33 from Patent EP1094113.                192   1e-47   
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                192   1e-47   
gb:AX120053_1461706 Sequence 36 from Patent WO0129240.                192   1e-47   
gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.             192   1e-47   
gb:AE016959_1022791 Oryza sativa (japonica cultivar-group) chrom...   192   1e-47   
pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis...   192   1e-47   
pir|H85056|H85056 probable receptor-like protein kinase [importe...   192   1e-47   
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...   192   1e-47   
gb:AP003728_1832549 Oryza sativa (japonica cultivar-group) genom...   192   1e-47   
gb:AC113332_1738903 Oryza sativa (japonica cultivar-group) chrom...   192   1e-47   
gb:AC098693_1736831 Oryza sativa (japonica cultivar-group) chrom...   192   1e-47   
gb:AE005173_893807 Arabidopsis thaliana chromosome 1, bottom arm...   192   1e-47   
pir|G85056|G85056 probable receptor-like protein kinase [importe...   192   1e-47   
pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis t...   192   1e-47   
pir|JC2482|JC2482 S-receptor kinase (EC 2.7.1.-) 12 precursor - ...   192   1e-47   
gb:AP004401_1841247 Oryza sativa (japonica cultivar-group) genom...   191   2e-47   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...   191   2e-47   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...   191   2e-47   
gb:OSJN00019_1693377 Oryza sativa genomic DNA, chromosome 4, BAC...   191   2e-47   
gb:OSJN00019_1693370 Oryza sativa genomic DNA, chromosome 4, BAC...   191   2e-47   
gb:AB025636_1516647 Arabidopsis thaliana genomic DNA, chromosome...   191   2e-47   
pir|T01181|T01181 hypothetical protein T26D22.12 - Arabidopsis t...   191   2e-47   
pir|T01551|T01551 receptor kinase homolog A_TM018A10.19 - Arabid...   191   2e-47   
pir|T05179|T05179 S-receptor kinase (EC 2.7.1.-) T6K22.100 precu...   191   2e-47   
gb:AP003561_1830795 Oryza sativa (japonica cultivar-group) genom...   191   2e-47   
gb:AP003237_1825950 Oryza sativa (japonica cultivar-group) genom...   191   2e-47   
gb:AC098693_1736830 Oryza sativa (japonica cultivar-group) chrom...   191   2e-47   
gb:AC091233_1734637 Oryza sativa chromosome 3 BAC OSJNBa0053G10 ...   191   2e-47   
gb:OSJN00055_1693993 Oryza sativa genomic DNA, chromosome 4, BAC...   191   2e-47   
gb:AY133720_1581540 Arabidopsis thaliana clone C103370 putative ...   191   2e-47   
gb:AY086096_1571154 Arabidopsis thaliana clone 21250 mRNA, compl...   191   2e-47   
pir|A96566|A96566 hypothetical protein F6D8.24 [imported] - Arab...   191   2e-47   
gb:AF131222_1770837 Lophopyrum elongatum protein serine/threonin...   191   3e-47   
gb:AC130597_1740689 Oryza sativa (japonica cultivar-group) chrom...   191   3e-47   
gb:AC099774_1737232 Oryza sativa chromosome 10 BAC OSJNBa0073L20...   191   3e-47   
gb:BT000052_1634330 Arabidopsis thaliana serine/threonine kinase...   191   3e-47   
gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13...   191   3e-47   
gb:AB099698_1526154 Arabidopsis thaliana CDG1 mRNA for protein k...   191   3e-47   
gb:AB026649_1517226 Arabidopsis thaliana genomic DNA, chromosome...   191   3e-47   
gb:AB023482_1515614 Oryza sativa (japonica cultivar-group) genom...   191   3e-47   
gb:AX120071_1461715 Sequence 54 from Patent WO0129240.                191   3e-47   
gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.             191   3e-47   
pir|G84510|G84510 probable receptor-like protein kinase [importe...   191   3e-47   
gb:AK118493_1816466 Arabidopsis thaliana At4g23140 mRNA for puta...   190   4e-47   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                 190   5e-47   
gb:AY085162_1570243 Arabidopsis thaliana clone 13461 mRNA, compl...   190   5e-47   
pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -...   190   5e-47   
pir|T48301|T48301 protein kinase-like - Arabidopsis thaliana>gb:...   190   5e-47   
pir|T00574|T00574 probable protein kinase [imported] - Arabidops...   190   5e-47   
gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genom...   189   7e-47   
gb:AP003280_1827145 Oryza sativa (japonica cultivar-group) genom...   189   7e-47   
gb:AY693370_1623417 Mangifera indica receptor-type protein kinas...   189   7e-47   
gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA...   189   7e-47   
gb:AB054061_1521307 Brassica rapa SRK22 mRNA for S locus recepto...   189   7e-47   
gb:AE005173_893819 Arabidopsis thaliana chromosome 1, bottom arm...   189   7e-47   
pir|T01502|T01502 probable serine/threonine-specific protein kin...   189   7e-47   
pir|T04848|T04848 protein kinase homolog F16G20.10 - Arabidopsis...   189   7e-47   
pir|F84658|F84658 probable protein kinase [imported] - Arabidops...   189   7e-47   
pir|T04841|T04841 protein kinase homolog F21P8.130 - Arabidopsis...   189   7e-47   
pir|G84686|G84686 probable protein kinase [imported] - Arabidops...   189   7e-47   
pir|T02053|T02053 S-receptor kinase (EC 2.7.1.-) KIK1 precursor ...   189   7e-47   
gb:AP003991_1836031 Oryza sativa (japonica cultivar-group) genom...   189   9e-47   
gb:AP003863_1834476 Oryza sativa (japonica cultivar-group) genom...   189   9e-47   
gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich r...   189   9e-47   
pir|T05270|T05270 probable serine/threonine-specific protein kin...   189   1e-46   
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...   189   1e-46   
pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3 p...   189   1e-46   
gb:AP003863_1834475 Oryza sativa (japonica cultivar-group) genom...   188   2e-46   
gb:AF510989_1807255 Oryza officinalis serine/threonine protein k...   188   2e-46   
gb:BT011239_1640989 Arabidopsis thaliana At4g34500 gene, complet...   188   2e-46   
gb:AY007545_1558031 Brassica napus protein serine/threonine kina...   188   2e-46   


>gb:AB030083_1518398 Populus nigra PnLPK mRNA for lectin-like protein
            kinase, complete cds.
          Length = 676

 Score =  451 bits (1159), Expect = e-125
 Identities = 222/299 (74%), Positives = 253/299 (84%), Gaps = 1/299 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF E+ KLGQGG+GVVYKG L  E ++IAVK FSRE+IKGQ DFL+EL+IINRLRHK
Sbjct: 345  ATNNFDERHKLGQGGFGVVYKGLLTKENIQIAVKKFSRENIKGQDDFLSELTIINRLRHK 404

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYALQYL 359
            HLV+LLGWCHR+G LLLVY+YMP+GSLD HLF   E +  L W LR KI+SGV  AL YL
Sbjct: 405  HLVRLLGWCHRNGMLLLVYDYMPNGSLDNHLFHELEGNVILEWNLRYKIISGVASALHYL 464

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            HNE++Q VVHRDLKASNIMLDS FNARLGDFGLARAL+NE+TSY E EGV GT+GYIAPE
Sbjct: 465  HNEYDQTVVHRDLKASNIMLDSEFNARLGDFGLARALENEKTSYAELEGVPGTMGYIAPE 524

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
            C  TGKAT +SD+Y FGAV+LEVVCGQRP T+IGGFQ LVDWVW LHR+ RILEAVD RL
Sbjct: 525  CFHTGKATRESDVYGFGAVVLEVVCGQRPWTKIGGFQFLVDWVWSLHREERILEAVDERL 584

Query: 720  KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVWPSAL 896
              D+V EEAKRLLLLGLACSHPIA+ERP+T  + QII GSVP P+VP F+PAFVWP+A+
Sbjct: 585  NSDYVAEEAKRLLLLGLACSHPIASERPKTQAIFQIISGSVPPPHVPLFKPAFVWPAAV 643



>gb:AY663848_1620593 Oryza sativa (japonica cultivar-group) lectin
            receptor kinase 1 (lrk1) mRNA, complete
            cds.>gb:AP003983_1835913 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1038_A06.
          Length = 736

 Score =  372 bits (956), Expect = e-102
 Identities = 185/306 (60%), Positives = 235/306 (76%), Gaps = 11/306 (3%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEG---LEIAVKWFSRESIKGQGDFLAELSIINRLR 176
            T NF EK KLGQGGYGVVY+  + GE    +E+AVK FS  + KGQ DFLAELSIINRLR
Sbjct: 378  TNNFDEKMKLGQGGYGVVYRATVVGENGQNMEVAVKQFSGANTKGQEDFLAELSIINRLR 437

Query: 177  HKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQY 356
            H++LVKL+GWCH++G LLLVY+YMP+GSLD HLF G E++ L+W+ R  +V+GV  AL Y
Sbjct: 438  HRNLVKLVGWCHQNGVLLLVYDYMPNGSLDTHLFGGPESEVLNWQQRYNVVTGVASALNY 497

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH+E++Q V+HRD+K SN+MLDS FNARLGDFGLARAL++++TSYT+  GV GT+GYIAP
Sbjct: 498  LHHEYDQMVIHRDIKPSNVMLDSAFNARLGDFGLARALESDKTSYTDIIGVPGTLGYIAP 557

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPG-TRIGGFQSLVDWVWFLH-------RDGR 692
            EC  TG+AT +SD++ FGAV+LE+VCG+R   +   G   L++ VW LH         GR
Sbjct: 558  ECFHTGRATRESDVFGFGAVILEIVCGRRISCSNPAGCSQLLEAVWKLHGAAGGGGGGGR 617

Query: 693  ILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            ILEAVD RL  +F   EA+RLLLLGLACSHP   ERPRT  ++QI+ G+ P P+VPP +P
Sbjct: 618  ILEAVDQRLAGEFDEAEAERLLLLGLACSHPNPGERPRTQTILQILTGAAPPPHVPPSKP 677

Query: 873  AFVWPS 890
            AF+WP+
Sbjct: 678  AFMWPA 683



>gb:AP004811_1845488 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0019A05.>gb:AP005477_1852598 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:OSJNBb0039F24.
          Length = 764

 Score =  370 bits (951), Expect = e-101
 Identities = 190/308 (61%), Positives = 230/308 (74%), Gaps = 13/308 (4%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAG----EGLEIAVKWFSRESIKGQGDFLAELSIINRL 173
            TE+F  K KLGQGGYGVVYK  +AG    E +E+AVK FS  + KGQ DFLAELSIINRL
Sbjct: 388  TEDFAAKNKLGQGGYGVVYKAVVAGDSDGESVEVAVKQFSAANTKGQEDFLAELSIINRL 447

Query: 174  RHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYAL 350
            RH++LV+L GWCH++G LLLVY+YMP+GSLD+HLF G    P LSWE R  IV+GV  AL
Sbjct: 448  RHRNLVRLRGWCHQNGVLLLVYDYMPNGSLDKHLFGGAAVAPVLSWEQRYNIVAGVAAAL 507

Query: 351  QYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYI 530
             YLH+E++QRV+HRD+K SNIMLDS F ARLGDFGLARALD+++TSYTE  GV GT+GYI
Sbjct: 508  NYLHHEYDQRVIHRDIKPSNIMLDSAFGARLGDFGLARALDSDKTSYTEMVGVPGTMGYI 567

Query: 531  APECLLTGKATEQSDIYAFGAVLLEVVCGQR-------PGTRIGGFQSLVDWVWFLHRDG 689
            APEC  TG+AT +SD++  GAVLLEV CG+R        G  IGG   L++WVW LH  G
Sbjct: 568  APECFHTGRATRESDVFGLGAVLLEVACGRRVSFGAGGDGGAIGGCSQLLEWVWRLHGAG 627

Query: 690  RILEAVDIRLKED-FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            RIL+AVD +L    F  ++A RLLLLGLACSHP    RP    VVQ++  +VP P VPP 
Sbjct: 628  RILDAVDPKLAGGAFDADDADRLLLLGLACSHPDPGARPTAKAVVQVLARAVPAPAVPPS 687

Query: 867  RPAFVWPS 890
            +PAF+WP+
Sbjct: 688  KPAFMWPA 695



>gb:AP003983_1835912 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1038_A06.
          Length = 734

 Score =  361 bits (926), Expect = 2e-98
 Identities = 178/302 (58%), Positives = 231/302 (76%), Gaps = 7/302 (2%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGE---GLEIAVKWFSRESIKGQGDFLAELSIINRLR 176
            T NF EK KLGQGGYGVVY+  + GE     ++AVK FS  + KG+ DFLAEL IIN LR
Sbjct: 383  TNNFDEKMKLGQGGYGVVYRATVVGEDGRSTDVAVKQFSGANTKGKEDFLAELRIINCLR 442

Query: 177  HKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQY 356
            H++LVK++GWC ++G+LLLVY+YMP+GSLD+H+F       L W+ R  +V+GV  AL Y
Sbjct: 443  HRNLVKIVGWCRQNGRLLLVYDYMPNGSLDRHIFGEPGAAALDWKQRYNVVAGVASALNY 502

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH+E++Q V+HRD+K SNIMLDS FNARLGDFGLARAL++++TSYT+  GV GT+GYIAP
Sbjct: 503  LHHEYDQMVIHRDIKPSNIMLDSAFNARLGDFGLARALESDKTSYTDMAGVTGTLGYIAP 562

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPG-TRIGGFQSLVDWVWFLH---RDGRILEA 704
            EC  TG+AT +SD++ FGAV+LE+VCG+R   + + G+ SL++WVW LH     G ILEA
Sbjct: 563  ECFHTGRATRESDVFGFGAVVLEIVCGRRVSCSDLPGWLSLLEWVWKLHGAAGGGGILEA 622

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            VD RL  +F   EA+RLLLLGLACSHP   ERPRT  ++QI+ G+ P P+VPP +PAF+W
Sbjct: 623  VDQRLAGEFDEVEAERLLLLGLACSHPNPGERPRTQAILQILTGAAPPPHVPPSKPAFMW 682

Query: 885  PS 890
            P+
Sbjct: 683  PA 684



>gb:AP004765_1844681 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0711H09.
          Length = 739

 Score =  308 bits (788), Expect = 2e-82
 Identities = 163/311 (52%), Positives = 212/311 (68%), Gaps = 16/311 (5%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGL-----------EIAVKWFSRESIKGQGDFLA 149
            AT+NF E+ +LG+GGYG+VYKG L    +           E+AVK F+R+  K   DFL 
Sbjct: 361  ATKNFDERLRLGKGGYGMVYKGVLPAAAVDDDDGRPPAATEVAVKMFTRDDAKCVDDFLK 420

Query: 150  ELSIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGG----ETDPLSWELR 317
            E+ II+RLRH+++V L+GWCH+ G+LLLVYEYMP+GSLDQH+F  G    +   LSWE R
Sbjct: 421  EVQIIHRLRHRNIVPLVGWCHKKGQLLLVYEYMPNGSLDQHIFRRGAVHEQRPALSWESR 480

Query: 318  CKIVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTE 497
              IV+ V   L Y+H+E+   V+HRD+KASN++LD++F ARLGDFGLAR LD +R+S+T+
Sbjct: 481  RDIVADVAAGLHYVHHEYGPMVLHRDIKASNVLLDASFRARLGDFGLARVLDLDRSSFTD 540

Query: 498  GEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFL 677
              GVAGT GYIAPE  +  KAT Q+D++AFG ++LEVV G+           L DWVW +
Sbjct: 541  -LGVAGTRGYIAPEYSVGHKATRQTDVFAFGVLVLEVVTGRHALLGDPACPMLSDWVWRM 599

Query: 678  HRDGRILEAVDIRLKED-FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            H  G +L AVD  L  D F   EA RLLLLGLACSHP   +RP   +V+QI+ GS P P 
Sbjct: 600  HGRGALLGAVDQSLGTDGFDAGEATRLLLLGLACSHPNPGDRPTMPEVLQILSGSAPPPE 659

Query: 855  VPPFRPAFVWP 887
            VP  +P+FVWP
Sbjct: 660  VPQLKPSFVWP 670



>gb:AP003981_1835885 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1019_E02.
          Length = 689

 Score =  301 bits (771), Expect = 2e-80
 Identities = 148/300 (49%), Positives = 213/300 (71%), Gaps = 6/300 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  ++KLG+GG+G VY+G+L  + +EIA+K  ++ S +G+ ++++E+ II+RLRH+
Sbjct: 346  ATDNFAAERKLGEGGFGAVYQGFLKDQNIEIAIKRVAKGSTQGRKEYISEVKIISRLRHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+GWCH HG+ LLVYE+MP+ SLD+HL+ GG    L+W LR KI  GV  AL YLH
Sbjct: 406  NLVQLVGWCHEHGEFLLVYEFMPNRSLDKHLYDGGNL--LAWPLRFKITIGVASALLYLH 463

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ VVHRD+K SN+MLDS FNA+LGDFGLAR +D++R S T    +AGT+GY+APEC
Sbjct: 464  EEWEQCVVHRDVKPSNVMLDSGFNAKLGDFGLARLVDHDRGSQT--TVIAGTMGYMAPEC 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP------GTRIGGFQSLVDWVWFLHRDGRILEA 704
            + TGKA++++D+Y+FG + LE+ CG+RP        RI    SLV WVW L+    IL A
Sbjct: 522  VTTGKASKETDVYSFGILALEIACGRRPVVPKEDNDRI----SLVQWVWDLYGRNEILNA 577

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            +D RL  +F   E   L+++GL C+HP  N RP    V+ ++    P+P++PP  P  ++
Sbjct: 578  IDGRLDGEFEEREVISLMVVGLWCAHPDYNIRPSIRQVISVLKFEAPLPDLPPKMPVAMY 637



>gb:AP002032_1821485 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MPH15.
          Length = 652

 Score =  300 bits (768), Expect = 4e-80
 Identities = 149/304 (49%), Positives = 214/304 (70%), Gaps = 8/304 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKG-WLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRH 179
            AT NFG + KLGQGG+G+V+KG W   +G +IAVK  S +S +G+ +F+AE++ I  L H
Sbjct: 326  ATGNFGAENKLGQGGFGMVFKGKW---QGRDIAVKRVSEKSHQGKQEFIAEITTIGNLNH 382

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGET-DPLSWELRCKIVSGVGYALQY 356
            ++LVKLLGWC+   + LLVYEYMP+GSLD++LF+  ++   L+WE R  I++G+  AL+Y
Sbjct: 383  RNLVKLLGWCYERKEYLLVYEYMPNGSLDKYLFLEDKSRSNLTWETRKNIITGLSQALEY 442

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LHN  E+R++HRD+KASN+MLDS+FNA+LGDFGLAR +     ++   + +AGT GY+AP
Sbjct: 443  LHNGCEKRILHRDIKASNVMLDSDFNAKLGDFGLARMIQQSEMTHHSTKEIAGTPGYMAP 502

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPG------TRIGGFQSLVDWVWFLHRDGRIL 698
            E  L G+AT ++D+YAFG ++LEVV G++P        +     S+V+W+W L+R+G I 
Sbjct: 503  ETFLNGRATVETDVYAFGVLMLEVVSGKKPSYVLVKDNQNNYNNSIVNWLWELYRNGTIT 562

Query: 699  EAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +A D  +   F  EE K +LLLGLAC HP  N+RP    V++++ G    P+VP  RPAF
Sbjct: 563  DAADPGMGNLFDKEEMKSVLLLGLACCHPNPNQRPSMKTVLKVLTGETSPPDVPTERPAF 622

Query: 879  VWPS 890
            VWP+
Sbjct: 623  VWPA 626



>gb:OSJN00073_1694337 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0027H06, complete sequence.
          Length = 731

 Score =  285 bits (729), Expect = 1e-75
 Identities = 154/321 (47%), Positives = 213/321 (66%), Gaps = 26/321 (8%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWL--------------------AGEGLEIAVKWFSRES 122
            AT NF E +KLG GG+G VY+G +                    +   +E+AVK F+R+ 
Sbjct: 366  ATNNFDEGRKLGNGGFGAVYRGTIRSSSSSAGKNKATTAAAAAVSSSSVEVAVKRFTRDE 425

Query: 123  IKGQGDFLAELSIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP- 299
             +   DFLAE+ IINRLRH+++V L+GW +  G+LLL+YEYMP+GSLD+ LF   +    
Sbjct: 426  NRCYDDFLAEVDIINRLRHRNVVPLVGWSYEKGELLLIYEYMPNGSLDRQLFPKEKPGRI 485

Query: 300  LSWELRCKIVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLAR-ALDN 476
            L W  R  IV+ +   L Y+H+E E  V+HRD+KASNI+LD+ F  RL DFGLAR  +  
Sbjct: 486  LGWTTRYGIVTDIAAGLHYVHHEHEHMVLHRDIKASNILLDAAFRGRLADFGLARIVVGL 545

Query: 477  ERTSYTEGEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI-GGFQS 653
            ++ SYT+  GVA T G+IAPE  ++ KAT ++D+YAFG +LLE+V G+R   +  G FQ 
Sbjct: 546  DKNSYTD-VGVAETWGFIAPEYSVSHKATRKTDVYAFGVLLLEIVTGRRALCKFQGTFQL 604

Query: 654  LVDWVWFLHRDGRILEAVDIRL---KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQ 824
            LVDWVW LHR+G +L+AVD  +    E+F  ++A RLLLLGLACS+P  ++RP  ++VVQ
Sbjct: 605  LVDWVWRLHREGSLLDAVDNGIASSTEEFDADDAIRLLLLGLACSNPNPSDRPSMTEVVQ 664

Query: 825  IILGSVPVPNVPPFRPAFVWP 887
            ++  S   P+VPP +PAFVWP
Sbjct: 665  VVARSAAPPDVPPVKPAFVWP 685



>gb:AP003224_1825581 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0010B10.
          Length = 696

 Score =  283 bits (723), Expect = 6e-75
 Identities = 141/302 (46%), Positives = 203/302 (67%), Gaps = 12/302 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF +++KLGQGG+G VY+G+L   GL +A+K  S+ S +G+ ++ AE+ II++LRH+
Sbjct: 347  ATKNFSDERKLGQGGFGAVYRGFLKELGLAVAIKRVSKGSTQGRKEYAAEVRIISQLRHR 406

Query: 183  HLVKLLGWCHRH-GKLLLVYEYMPHGSLDQHLF--------IGGETDPLSWELRCKIVSG 335
            HLV+L+GWCH H G  LLVYE MP+GS+D+HL+         GG   PLSW  R  +  G
Sbjct: 407  HLVRLVGWCHEHRGDFLLVYELMPNGSVDRHLYGGGGGSKKAGGAAPPLSWPTRYNVALG 466

Query: 336  VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
            +  AL YLH E  Q VVHRD+K SN+MLD+ F+A+LGDFGLA+ +++    +T    +AG
Sbjct: 467  LASALLYLHEECPQCVVHRDIKPSNVMLDATFSAKLGDFGLAKLVEHGSQPHT--TVLAG 524

Query: 516  TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRD 686
            T+GY+APEC++TG+A+ +SD+Y+FG V LE+ CG+RP        S   LV WVW L+  
Sbjct: 525  TLGYLAPECVITGRASRESDVYSFGVVALEIACGRRPAELDEEDPSKARLVPWVWELYGK 584

Query: 687  GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
              ILEA D RL   F +E+ +RL+++GL C+HP    RP     + ++    P+P++PP 
Sbjct: 585  RAILEAADQRLNGKFDLEQMERLMVVGLWCAHPDHAHRPSIRQALNVLKFEAPLPSLPPK 644

Query: 867  RP 872
             P
Sbjct: 645  MP 646



>gb:AP003886_1834819 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC
            clone:OJ1163_G08.>gb:AP004166_1838484 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OJ1499_A07.
          Length = 705

 Score =  280 bits (715), Expect = 5e-74
 Identities = 146/338 (43%), Positives = 214/338 (63%), Gaps = 5/338 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L  +GL +A+K F+++S K G+ ++ +E+ +I+RLRH
Sbjct: 350  ATKSFAAEEKLGQGGFGAVYRGYLREQGLAVAIKRFAKDSSKQGKKEYRSEIKVISRLRH 409

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE +P+ SLD HL   G    L+W +R KIV G+G AL YL
Sbjct: 410  RNLVQLIGWCHGRDELLLVYELVPNRSLDIHLHGNGTF--LTWPMRVKIVLGLGSALFYL 467

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+EQ VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T    V+GT GY+ PE
Sbjct: 468  HEEWEQCVVHRDIKPSNVMLDESFNAKLGDFGLARFIDHAVGMQTM-TAVSGTPGYVDPE 526

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            C++TG+A+ +SD+Y+FG VLLEV CG+RP      +  G   LV+WVW LH  G ++ A 
Sbjct: 527  CVITGRASSESDVYSFGIVLLEVACGRRPMSLQDNQKNGIFRLVEWVWDLHGQGDVISAA 586

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVWP 887
            D RL  D+ V E +R++ +GL C+HP  + RP     + ++  S  +P +P   P   + 
Sbjct: 587  DERLNGDYDVSEMERVITVGLWCAHPDPSARPSIRAAMAMLQSSGQLPVLPAKMPVPTYA 646

Query: 888  SALXXXXXXXXXXXXXXXXXXXFNSGWSQIDTGHTNSS 1001
              +                    +S  +     HT+SS
Sbjct: 647  PPVASVEGLFTSSTGMLSSSATQSSSTTSGYITHTSSS 684



>pir|T45878|T45878 receptor lectin kinase-like protein - Arabidopsis
            thaliana>gb:ATF4P12_1550723 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F4P12.
          Length = 715

 Score =  278 bits (711), Expect = 2e-73
 Identities = 146/297 (49%), Positives = 205/297 (69%), Gaps = 8/297 (2%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKH 185
            T+NF E + +G G +GVVY+G L   G  +AVK  S  S   + +FL+ELSII  LRH++
Sbjct: 373  TKNFNESRIIGHGAFGVVYRGILPETGDIVAVKRCSHSSQDKKNEFLSELSIIGSLRHRN 432

Query: 186  LVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHN 365
            LV+L GWCH  G++LLVY+ MP+GSLD+ LF    T  L W+ R KI+ GV  AL YLH 
Sbjct: 433  LVRLQGWCHEKGEILLVYDLMPNGSLDKALFESRFT--LPWDHRKKILLGVASALAYLHR 490

Query: 366  EFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECL 545
            E E +V+HRD+K+SNIMLD +FNA+LGDFGLAR ++++++   E    AGT+GY+APE L
Sbjct: 491  ECENQVIHRDVKSSNIMLDESFNAKLGDFGLARQIEHDKS--PEATVAAGTMGYLAPEYL 548

Query: 546  LTGKATEQSDIYAFGAVLLEVVCGQRPGTR--------IGGFQSLVDWVWFLHRDGRILE 701
            LTG+A+E++D++++GAV+LEVV G+RP  +        +G   +LV+WVW L+++G++  
Sbjct: 549  LTGRASEKTDVFSYGAVVLEVVSGRRPIEKDLNVQRHNVGVNPNLVEWVWGLYKEGKVSA 608

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            A D RL+  F   E  R+L++GLACSHP    RP    VVQ+++G   VP VP  RP
Sbjct: 609  AADSRLEGKFDEGEMWRVLVVGLACSHPDPAFRPTMRSVVQMLIGEADVPVVPKSRP 665



>pir|T49986|T49986 lectin-like protein kinase-like - Arabidopsis
            thaliana>gb:ATF12B17_1548321 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F12B17 (ESSA project).
          Length = 651

 Score =  277 bits (709), Expect = 3e-73
 Identities = 137/295 (46%), Positives = 205/295 (69%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            A  NF + +KLG+GG+G VY+G+L    + +A+K F+  S +G+ +F+ E+ II+ LRH+
Sbjct: 331  AANNFADDRKLGEGGFGAVYRGYLNSLDMMVAIKKFAGGSKQGKREFVTEVKIISSLRHR 390

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+GWCH   + L++YE+MP+GSLD HLF  G+   L+W +RCKI  G+  AL YLH
Sbjct: 391  NLVQLIGWCHEKDEFLMIYEFMPNGSLDAHLF--GKKPHLAWHVRCKITLGLASALLYLH 448

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ VVHRD+KASN+MLDSNFNA+LGDFGLAR +D+E    T   G+AGT GY+APE 
Sbjct: 449  EEWEQCVVHRDIKASNVMLDSNFNAKLGDFGLARLMDHELGPQT--TGLAGTFGYMAPEY 506

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQ----RPGTRIGGFQSLVDWVWFLHRDGRILEAVD 710
            + TG+A+++SD+Y+FG V LE+V G+    R   R+    +LV+ +W L+  G ++ A+D
Sbjct: 507  ISTGRASKESDVYSFGVVTLEIVTGRKSVDRRQGRVEPVTNLVEKMWDLYGKGEVITAID 566

Query: 711  IRLK-EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
             +L+   F  ++A+ L+++GL C+HP  N RP     +Q++    PVP++P   P
Sbjct: 567  EKLRIGGFDEKQAECLMIVGLWCAHPDVNTRPSIKQAIQVLNLEAPVPHLPTKMP 621



>gb:OSJN00188_1696446 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0088A01, complete sequence.
          Length = 677

 Score =  276 bits (707), Expect = 4e-73
 Identities = 139/313 (44%), Positives = 198/313 (63%), Gaps = 18/313 (5%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRE----SIKGQGDFLAELSIINR 170
            AT NF   +KLG+GG+G VY G+L+   +E+AVK  +      S +G+ +F+AE++ I++
Sbjct: 330  ATANFSSSRKLGRGGFGTVYHGYLSSMNMEVAVKRVAANNKSSSNRGEQEFVAEVNTISK 389

Query: 171  LRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYAL 350
            L H++LVKL+GWCH  G+LLLVYEY P GSLD+ L+ G     L+WE R KI+ GV  AL
Sbjct: 390  LSHRNLVKLIGWCHEGGELLLVYEYFPMGSLDKLLYGGARPAELTWERRYKIICGVASAL 449

Query: 351  QYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYI 530
            +YLH+    R++HRD+KASN+MLD  ++ARLGDFGLAR +  +  ++   + VAGT GY+
Sbjct: 450  EYLHHGSSSRILHRDVKASNVMLDEEYSARLGDFGLARVIHLDEVTHHSTQAVAGTRGYM 509

Query: 531  APECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI------------GGFQS--LVDWV 668
            A EC  TG+A+  +D+YAFG  ++EV+ G+ P + +            G  Q   +VDW+
Sbjct: 510  AYECFFTGRASLDTDVYAFGVFVMEVLTGRSPSSSVTYHNRQQEHDHDGRRQPMYIVDWM 569

Query: 669  WFLHRDGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
            W  + DG +LEA D  L   +   + +R   L LAC HP   ERP     VQ+++G  P 
Sbjct: 570  WRHYGDGTVLEAADAVLGGAYDEAQVERAARLALACCHPSPRERPSMRTAVQVLVGGAPA 629

Query: 849  PNVPPFRPAFVWP 887
            P  P  +PAFVWP
Sbjct: 630  PEPPFEKPAFVWP 642



>gb:AP005730_1856758 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0073J19.
          Length = 750

 Score =  275 bits (704), Expect = 1e-72
 Identities = 139/295 (47%), Positives = 204/295 (69%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESI-KGQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L  +GL +A+K F ++S  +G+ ++ +E+ +I+RLRH
Sbjct: 395  ATKSFAAEEKLGQGGFGAVYRGYLREQGLAVAIKRFIKDSSNQGRREYKSEIKVISRLRH 454

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH H +LLLVYE +P+ SLD HL   G    L+W +R KI+ G+G AL YL
Sbjct: 455  RNLVQLIGWCHGHDELLLVYELVPNRSLDIHLHGNGTF--LTWPMRVKIILGLGSALFYL 512

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+EQ VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T    V+GT GY+ PE
Sbjct: 513  HEEWEQCVVHRDIKPSNVMLDESFNAKLGDFGLARFIDHIVGMQTM-TAVSGTPGYVDPE 571

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            C++TG+A+ +SD+Y+FG VLLEV CG+RP     ++  G   LV+W W L+  G IL A 
Sbjct: 572  CVITGRASAESDVYSFGIVLLEVACGRRPMSLLDSQKNGIFRLVEWAWDLYGKGDILMAA 631

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            D RL  D+   E +R++++GL C+HP  N RP   + + ++     +P +P   P
Sbjct: 632  DERLNGDYDAAEMERVIVIGLWCAHPDPNARPSIRNAMAMLQSGGQLPVLPAKMP 686



>gb:AP005730_1856757 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0073J19.
          Length = 719

 Score =  275 bits (704), Expect = 1e-72
 Identities = 139/295 (47%), Positives = 204/295 (69%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESI-KGQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L  +GL +A+K F ++S  +G+ ++ +E+ +I+RLRH
Sbjct: 395  ATKSFAAEEKLGQGGFGAVYRGYLREQGLAVAIKRFIKDSSNQGRREYKSEIKVISRLRH 454

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH H +LLLVYE +P+ SLD HL   G    L+W +R KI+ G+G AL YL
Sbjct: 455  RNLVQLIGWCHGHDELLLVYELVPNRSLDIHLHGNGTF--LTWPMRVKIILGLGSALFYL 512

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+EQ VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T    V+GT GY+ PE
Sbjct: 513  HEEWEQCVVHRDIKPSNVMLDESFNAKLGDFGLARFIDHIVGMQTM-TAVSGTPGYVDPE 571

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            C++TG+A+ +SD+Y+FG VLLEV CG+RP     ++  G   LV+W W L+  G IL A 
Sbjct: 572  CVITGRASAESDVYSFGIVLLEVACGRRPMSLLDSQKNGIFRLVEWAWDLYGKGDILMAA 631

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            D RL  D+   E +R++++GL C+HP  N RP   + + ++     +P +P   P
Sbjct: 632  DERLNGDYDAAEMERVIVIGLWCAHPDPNARPSIRNAMAMLQSGGQLPVLPAKMP 686



>gb:AY358029_1601932 Medicago truncatula lectin-like receptor kinase
            7;3 (LecRK7;3) mRNA, complete cds.
          Length = 682

 Score =  271 bits (692), Expect = 2e-71
 Identities = 146/286 (51%), Positives = 188/286 (65%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LGQGG+G VY G L    +++AVK  S ES +G  +F++E++ I RLRH+
Sbjct: 335  ATKGFKEKQLLGQGGFGKVYNGILPKSKIQVAVKRVSHESKQGLREFVSEIASIGRLRHR 394

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLGWC R G LLLVY+YM +GSLD++LF   E   LSWE R KI+ GV   L YLH
Sbjct: 395  NLVMLLGWCRRRGDLLLVYDYMANGSLDKYLFEDSEY-VLSWEQRFKIIKGVASGLLYLH 453

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
              +EQ V+HRD+KASN++LD   N RLGDFGLAR  ++     T    V GT+GY+APE 
Sbjct: 454  EGYEQVVIHRDVKASNVLLDFELNGRLGDFGLARLYEHGANPGT--TRVVGTLGYLAPEL 511

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
              TG+AT  SD++AFGA+LLEVVCG+RP           LVDWVW   ++GR  E VD +
Sbjct: 512  PRTGRATTSSDVFAFGALLLEVVCGRRPIEPKASQDELVLVDWVWERFKEGRAFEVVDPK 571

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            L  DFV  E   +L LGL CS+ +   RP    VV+I+ G V +PN
Sbjct: 572  LNGDFVETEVMMVLKLGLICSNDVPTIRPSMRQVVRILDGEVELPN 617



>pir|T48335|T48335 receptor like protein kinase - Arabidopsis
            thaliana>gb:AB005240_1509461 Arabidopsis thaliana genomic
            DNA, chromosome 5, P1 clone:MOK16.>gb:ATF15A17_1548650
            Arabidopsis thaliana DNA chromosome 5, BAC clone F15A17
            (ESSA project).>gb:AY093212_1575166 Arabidopsis thaliana
            receptor like protein kinase (At5g03140) mRNA, complete
            cds.>gb:BT008791_1639987 Arabidopsis thaliana At5g03140
            gene, complete cds.
          Length = 711

 Score =  270 bits (691), Expect = 3e-71
 Identities = 145/299 (48%), Positives = 202/299 (67%), Gaps = 8/299 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F   + +G G +G VYKG L   G  IA+K  S  S +G  +FL+ELS+I  LRH+
Sbjct: 370  ATDCFSSSRVIGNGAFGTVYKGILQDSGEIIAIKRCSHIS-QGNTEFLSELSLIGTLRHR 428

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +L++L G+C   G++LL+Y+ MP+GSLD+ L+    T P  W  R KI+ GV  AL YLH
Sbjct: 429  NLLRLQGYCREKGEILLIYDLMPNGSLDKALYESPTTLP--WPHRRKILLGVASALAYLH 486

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E E +++HRD+K SNIMLD+NFN +LGDFGLAR  +++++   +    AGT+GY+APE 
Sbjct: 487  QECENQIIHRDVKTSNIMLDANFNPKLGDFGLARQTEHDKS--PDATAAAGTMGYLAPEY 544

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR--------PGTRIGGFQSLVDWVWFLHRDGRIL 698
            LLTG+ATE++D++++GAV+LEV  G+R        PG R G   SLVDWVW L+R+G++L
Sbjct: 545  LLTGRATEKTDVFSYGAVVLEVCTGRRPITRPEPEPGLRPGLRSSLVDWVWGLYREGKLL 604

Query: 699  EAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
             AVD RL E F  EE  R++++GLACS P    RP    VVQI++G   VP VP  +P+
Sbjct: 605  TAVDERLSE-FNPEEMSRVMMVGLACSQPDPVTRPTMRSVVQILVGEADVPEVPIAKPS 662



>gb:AC134931_1741947 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0079L11, complete sequence.
          Length = 771

 Score =  270 bits (689), Expect = 5e-71
 Identities = 141/295 (47%), Positives = 198/295 (67%), Gaps = 4/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKG---QGDFLAELSIINRL 173
            AT  F   + +G G +G VYKG +   G  +AVK  +  S  G   + +FL+ELSII  L
Sbjct: 414  ATRGFDASRVIGNGAFGTVYKGIIPDTGAMVAVKRCTNASADGAQARSEFLSELSIIAGL 473

Query: 174  RHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQ 353
            RH++L++L GWCH  G++LLVY+YM +GSLD+ LF    +  L W  R +I++GV  AL 
Sbjct: 474  RHRNLLRLQGWCHEKGEILLVYDYMRNGSLDKALF-DASSPVLPWSHRREILAGVASALA 532

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH+E E+RV+HRD+K+SN+MLD  + ARLGDFGLAR  ++  +   +    AGT+GY+A
Sbjct: 533  YLHHECERRVIHRDVKSSNVMLDDAYRARLGDFGLARQAEHGES--PDATAAAGTMGYLA 590

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRP-GTRIGGFQSLVDWVWFLHRDGRILEAVD 710
            PE LLTG+ATE +D+++FGA++LEV CG+RP G   G   +LV+WVW LH  G++L+AVD
Sbjct: 591  PEYLLTGRATEATDVFSFGALVLEVACGRRPIGATEGRCNNLVEWVWSLHGAGQVLDAVD 650

Query: 711  IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
             RL+ ++   E +R +L+GLACS P    RP    VVQ++ G    P VP  RP+
Sbjct: 651  ARLRGEYDEAEMRRAMLVGLACSSPEPALRPGMRAVVQMLGGEADPPFVPAARPS 705



>gb:AP004166_1838479 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1499_A07.
          Length = 543

 Score =  268 bits (685), Expect = 2e-70
 Identities = 136/295 (46%), Positives = 201/295 (68%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G L   G+++A+K F+++S K G+ ++ +E+ +I+RLRH
Sbjct: 218  ATKSFAAEEKLGQGGFGAVYRGNLRELGIDVAIKRFAKDSSKQGRKEYKSEIKVISRLRH 277

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE +P+ SLD HL   G    L+W +R  IV G+G AL YL
Sbjct: 278  RNLVQLIGWCHGRNELLLVYELVPNRSLDVHLHGNGTF--LTWPMRINIVLGLGNALLYL 335

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+EQ VVHRD+K SN+MLD +FN +LGDFGLAR +D+   + T     +GT GY+ PE
Sbjct: 336  HEEWEQCVVHRDIKPSNVMLDESFNTKLGDFGLARLIDHAIGAQTMTH-PSGTPGYVDPE 394

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI----GGFQSLVDWVWFLHRDGRILEAV 707
            C++TGKA+ +SD+Y+FG VLLEV CG+RP   +     G   LV+WVW L+  G +L+A 
Sbjct: 395  CVITGKASAESDVYSFGIVLLEVACGRRPMNLLDDQNNGLFRLVEWVWDLYGQGAVLKAA 454

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            D RL  D+   + + +L++GL C+HP    RP     + ++  + P+P +P   P
Sbjct: 455  DERLNGDYDATDMECVLVVGLWCAHPDRCARPSIRVAMAVLQSNGPLPMLPTKMP 509



>gb:OSJN00183_1696341 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0081C01, complete sequence.
          Length = 673

 Score =  268 bits (684), Expect = 2e-70
 Identities = 144/294 (48%), Positives = 194/294 (65%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K+ LG GG+G VY+G L     E+AVK  +  S +G  +F+AE+  I RLRH+
Sbjct: 348  ATDGFSDKRLLGIGGFGRVYRGVLPSSKAEVAVKKVAHGSRQGMREFVAEVVSIGRLRHR 407

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YMP+GSLD+ L+  G+   L W  R +I+ GV   L YLH
Sbjct: 408  NLVQLLGYCRRKGELLLVYDYMPNGSLDKQLYDQGKI-TLRWAQRFRIIRGVASGLLYLH 466

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++EQ VVHRD+KASN++LD++ N RLGDFGLAR  D+    +T    V GT+GY+APE 
Sbjct: 467  EDWEQVVVHRDIKASNVLLDADMNGRLGDFGLARLYDHGTDPHT--THVVGTMGYLAPEL 524

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
              TGKA++ SD++AFGA +LEV CG++P  +        LVDWV    R G I + VD R
Sbjct: 525  GHTGKASKASDVFAFGAFMLEVACGRKPVAQDARDNRVVLVDWVLDRWRAGAITDTVDPR 584

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L  DFV  EA  +L LGL CSHP+   RP T  +VQ + G VP+P + P   +F
Sbjct: 585  LHGDFVESEASLVLRLGLLCSHPLPGARPGTRQLVQYLEGDVPLPELSPTYQSF 638



>gb:AP004301_1839834 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861340 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 692

 Score =  267 bits (683), Expect = 3e-70
 Identities = 140/294 (47%), Positives = 190/294 (64%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F  K  LG GG+G VYKG L    LE+AVK  S ES +G  +F+AE+  I R+RH+
Sbjct: 365  ATHGFDNKNLLGAGGFGKVYKGVLPSSKLEVAVKRVSHESRQGMKEFVAEVVSIGRIRHR 424

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C R G+LLLVY+YMP+GSLD +L+       LSW+ R +I+ G+   L YLH
Sbjct: 425  NIVQLLGYCRRKGELLLVYDYMPNGSLDAYLYNNELKPTLSWDQRFRIIKGIASGLFYLH 484

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +++E+ V+HRD+KASN++LD+  N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 485  DKWEKVVIHRDIKASNVLLDTEMNGRLGDFGLARLYDHGTDLQT--THVVGTMGYLAPEL 542

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            + TGKA+  +D++AFGA LLEV CGQRP           LVDWV    + G +   VD R
Sbjct: 543  VCTGKASPLTDVFAFGAFLLEVTCGQRPVNHSSQDSPGVLVDWVLEHWQKGLLTNTVDAR 602

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L+ D+ ++EA  +L LGL CSHP  N RP    V+Q + G VP+P +     +F
Sbjct: 603  LQGDYNIDEACFVLKLGLLCSHPFTNMRPNMQQVMQYLDGDVPLPELTQMDMSF 656



>gb:AP004254_1839176 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1126_D10.
          Length = 676

 Score =  266 bits (681), Expect = 5e-70
 Identities = 137/299 (45%), Positives = 202/299 (67%), Gaps = 5/299 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G L   GL++A+K F+++S K G+ ++ +E+ +I+RLRH
Sbjct: 351  ATKSFAAEEKLGQGGFGAVYRGNLRELGLDVAIKRFAKDSSKQGRKEYKSEIKVISRLRH 410

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE +P+ SLD HL   G    L+W +R  IV G+G AL YL
Sbjct: 411  RNLVQLIGWCHGRDELLLVYELVPNRSLDVHLHGNGTF--LTWPMRINIVLGLGNALLYL 468

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+EQ VVHRD+K SNIMLD +FNA+LGDFGLAR +D+     T     +GT GY+ PE
Sbjct: 469  HEEWEQCVVHRDIKPSNIMLDESFNAKLGDFGLARLIDHNVGVQTMTH-PSGTPGYLDPE 527

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS----LVDWVWFLHRDGRILEAV 707
            C++TGKA+ +SD+Y+FG VLLEV CG+RP + +    +    LV+WVW L+  G +L+A 
Sbjct: 528  CVITGKASAESDVYSFGVVLLEVACGRRPMSLLDNQNNSLFRLVEWVWDLYGQGVVLKAA 587

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            D RL  D+     + ++ +GL C+HP    RP     + ++  + P+P +P   P  ++
Sbjct: 588  DERLNNDYDATSMECVMAVGLWCAHPDRYARPSIRAAMTVLQSNGPLPVLPSKMPVPIY 646



>gb:AE016959_1022785 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AE017098_1752604 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 52 of 77
            of the complete sequence.
          Length = 947

 Score =  266 bits (679), Expect = 8e-70
 Identities = 143/297 (48%), Positives = 192/297 (64%), Gaps = 10/297 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +K+ LG GG+G VYKG L     E+AVK  S ES +G  +F+AE+  I R+RH+
Sbjct: 352  ATGGFKDKRLLGAGGFGRVYKGVLPRSRTEVAVKRVSHESRQGMREFIAEVVSIGRIRHR 411

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YMP+GSLD++L    E   L W  R  I+ GV   L Y+H
Sbjct: 412  NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLHGCDEKPILDWAQRIYIIKGVASGLLYMH 471

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++EQ V+HRD+KASN++LDS  N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 472  EDWEQVVIHRDIKASNVLLDSEMNGRLGDFGLARLYDHGADPQT--THVVGTMGYLAPEM 529

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQS-------LVDWVWFLHRDGR 692
            + +GKAT +SD++AFGA LLEV CG+RP      + G  +       LVDWV    R+G 
Sbjct: 530  VRSGKATTRSDVFAFGAFLLEVTCGRRPIEEEEEVAGAGADDDDRFVLVDWVLGHWREGA 589

Query: 693  ILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            I +AVD +L+ ++   EA+ +L LGL C HP    RP    V+Q + GS P+P +PP
Sbjct: 590  ITDAVDAKLRGEYDAAEAELVLRLGLTCLHPSPAARPSMRQVMQYLDGSAPLPELPP 646



>gb:AP004166_1838468 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1499_A07.
          Length = 688

 Score =  264 bits (675), Expect = 2e-69
 Identities = 136/295 (46%), Positives = 198/295 (67%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L   GL +A+K F++ S K G+ ++ +E+ +I+RLRH
Sbjct: 363  ATKSFAPEEKLGQGGFGAVYRGYLRELGLAVAIKRFAKNSSKQGRKEYKSEIKVISRLRH 422

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE  P+ SLD HL   G    L+W +R  IV G+G AL YL
Sbjct: 423  RNLVQLIGWCHGRTELLLVYELFPNRSLDVHLHGNGTF--LTWPMRINIVHGLGSALLYL 480

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E++Q VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T     +GT GY+ PE
Sbjct: 481  HEEWDQCVVHRDIKPSNVMLDESFNAKLGDFGLARLIDHAVGIQTMTH-PSGTPGYLDPE 539

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            C++TGKA+ +SD+Y+FG VLLEV CG+RP     T+      LV+WVW L+  G +L+A 
Sbjct: 540  CVITGKASAESDVYSFGIVLLEVACGRRPISLQDTQNNCLFRLVEWVWDLYGQGAVLKAA 599

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            D RL  ++     + ++ +GL C+HP    RP    V+ ++  + P+P +P   P
Sbjct: 600  DERLNNEYDTTSMECVMAVGLWCAHPDRCARPSIRAVMAVLQSNGPLPVLPAKMP 654



>gb:AP003758_1833017 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1562_B11.
          Length = 671

 Score =  264 bits (675), Expect = 2e-69
 Identities = 140/289 (48%), Positives = 186/289 (64%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VY+G L    +E+AVK  S ES +G  +F+AE++ I RLRH+
Sbjct: 348  ATKGFSDKNLLGTGGFGSVYRGVLRKPDMEVAVKRVSHESRQGMKEFVAEVASIGRLRHR 407

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YMP GSLD++L+  G   PLSW  R  I+ GV   L YLH
Sbjct: 408  NLVQLLGYCRRKGELLLVYDYMPKGSLDKYLY-DGSKHPLSWPQRFHIIRGVASGLLYLH 466

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++E  V+HRD+KASN++LD   N RLGDFGLAR  D+   + T    V GT+GY+APE 
Sbjct: 467  EDWEHVVIHRDVKASNVLLDDEMNGRLGDFGLARLYDHGAVAQT--THVVGTMGYLAPEL 524

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
              TGKAT  +D++AFGA LLEV CG+RP      G    LVDWV      G ++  VD R
Sbjct: 525  GHTGKATPSTDVFAFGAFLLEVTCGRRPIVQDEHGNRAVLVDWVTEQWSKGALVNVVDAR 584

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            +   F  +E   +L LGL CSHP+ N RP    V Q + G + +P++ P
Sbjct: 585  IPSCFDPDEVSLVLKLGLLCSHPLPNARPTMRQVAQYLDGDMALPDLSP 633



>gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0491D10.
          Length = 698

 Score =  264 bits (674), Expect = 3e-69
 Identities = 145/304 (47%), Positives = 201/304 (66%), Gaps = 7/304 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKG---QGDFLAELSIINRL 173
            AT  F   + +G+G +G VYK  + G     AV +  + S +    + +F+AELS+I  L
Sbjct: 364  ATRGFHASRVIGKGAFGTVYKAAMPGTATASAVSYAVKRSTQAHQSRNEFVAELSVIACL 423

Query: 174  RHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQ 353
            RHK+LV+L GWC   G+LLLVYEYMP+GSLD+ L+  GE   LSW  R  + SG+   L 
Sbjct: 424  RHKNLVQLEGWCDDKGELLLVYEYMPNGSLDKALY--GEPCTLSWPERYTVASGIASVLS 481

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH E EQRV+HRD+K SNI+LD N + RLGDFGLAR +D+ ++  +     AGT+GY+A
Sbjct: 482  YLHQECEQRVIHRDIKTSNILLDGNLSPRLGDFGLARLMDHNKSPVS--TLTAGTMGYLA 539

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG---FQSLVDWVWFLHRDGRILEA 704
            PE L +GKATEQ+D++++G V+LEV CG+RP  +  G     +LVDWVW LH + R+++A
Sbjct: 540  PEYLQSGKATEQTDVFSYGVVVLEVCCGRRPIDKDDGGGKNVNLVDWVWRLHGEDRLIDA 599

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII-LGSVPVPNVPPFRPAFV 881
             D RL   F  +E  RLLL+GL+C++P  +ERP    VVQI+   + PVP VP  +P  V
Sbjct: 600  ADPRLAGGFYRDEMLRLLLVGLSCANPNCDERPAMRRVVQILNREAEPVP-VPRKKPLLV 658

Query: 882  WPSA 893
            + S+
Sbjct: 659  FSSS 662



>gb:AP004301_1839825 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861332 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 681

 Score =  263 bits (672), Expect = 5e-69
 Identities = 138/290 (47%), Positives = 187/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VY+G L    LE+AVK  S ES +G  +F+AE+  I R+RH+
Sbjct: 354  ATDGFADKHLLGSGGFGKVYRGVLPKSKLEVAVKKVSHESRQGMKEFVAEIVSIGRIRHR 413

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY Y+P+GSLD++L+   +   LSW  R +I+ G+   L YLH
Sbjct: 414  NLVQLLGYCRRKGELLLVYAYIPNGSLDKYLYSEEDKPILSWAQRFRIIKGIASGLLYLH 473

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
              +E+ VVHRD+KA NI+LD + N +LGDFGLAR  D+   S T    V GT+GY+APE 
Sbjct: 474  ERWEKVVVHRDIKAGNILLDKDMNGQLGDFGLARLYDHGTDSQT--THVVGTMGYLAPEL 531

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            + TGKA+  +D++AFG  LLEV CGQ+P       G   +LVDWV    RDG +++ VD 
Sbjct: 532  IRTGKASPLTDVFAFGVFLLEVTCGQKPIKEKNPQGSHIALVDWVLEHWRDGSLMDTVDG 591

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL  ++   EA  +L LGL CSHP A  RP    V   + G  P+P + P
Sbjct: 592  RLHGEYDAGEAALVLKLGLLCSHPFAAARPGMGQVTCCLAGEAPLPELTP 641



>gb:AB026639_1517086 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K21L13.
          Length = 675

 Score =  263 bits (671), Expect = 7e-69
 Identities = 141/304 (46%), Positives = 204/304 (67%), Gaps = 10/304 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F   +KLG+GG+G VY+G L      +AVK  S +S +G+ +FL E+ II++LRH+
Sbjct: 346  ATNRFSSHRKLGEGGFGAVYEGNLKEINTMVAVKKLSGDSRQGKNEFLNEVKIISKLRHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+GWC+   + LL+YE +P+GSL+ HLF G   + LSW++R KI  G+  AL YLH
Sbjct: 406  NLVQLIGWCNEKNEFLLIYELVPNGSLNSHLF-GKRPNLLSWDIRYKIGLGLASALLYLH 464

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E++Q V+HRD+KASNIMLDS FN +LGDFGLAR +++E  S+T   G+AGT GY+APE 
Sbjct: 465  EEWDQCVLHRDIKASNIMLDSEFNVKLGDFGLARLMNHELGSHT--TGLAGTFGYMAPEY 522

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR---------PGTRIGGFQSLVDWVWFLH-RDGR 692
            ++ G A+++SDIY+FG VLLE+V G++           T     +SLV+ VW L+ +   
Sbjct: 523  VMKGSASKESDIYSFGIVLLEIVTGRKSLERTQEDNSDTESDDEKSLVEKVWELYGKQEL 582

Query: 693  ILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            I   VD +L EDF  +EA+ LL+LGL C+HP  N RP     +Q++    P+P++P  RP
Sbjct: 583  ITSCVDDKLGEDFDKKEAECLLVLGLWCAHPDKNSRPSIKQGIQVMNFESPLPDLPLKRP 642

Query: 873  AFVW 884
              ++
Sbjct: 643  VAMY 646



>gb:AP006172_1861335 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 671

 Score =  262 bits (670), Expect = 9e-69
 Identities = 139/287 (48%), Positives = 189/287 (65%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VYKG L    LE+AVK  S ES +G  +F+AE++ I R+RH+
Sbjct: 344  ATDGFSDKHILGAGGFGRVYKGILPKSKLEVAVKRVSHESRQGMKEFVAEVASIGRIRHR 403

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YM +GSLD++L   G    L W  + +I+  V   L YLH
Sbjct: 404  NLVQLLGYCRRKGELLLVYDYMSNGSLDRYLHYEGNKPVLDWVQKFQIIKDVASGLLYLH 463

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++++ V+HRD+KASN++LD   NARLGDFGLAR  D+   ++T    + GT+GY+APE 
Sbjct: 464  EKWDKVVIHRDIKASNVLLDKEMNARLGDFGLARLYDHGTDAHT--THMVGTMGYLAPEL 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TGKA+  +D++AFG  LLEV+CGQRP      G    LVDWV     +  +L+ VD R
Sbjct: 522  IHTGKASTLTDVFAFGTFLLEVICGQRPIKEDAHGNQILLVDWVLEHWHNESLLDTVDPR 581

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ D+ VEEA  +L LGL CSHP  N RP    VV  + G  PVP +
Sbjct: 582  LQGDYNVEEACLVLKLGLLCSHPSTNARPCMQQVVDYLEGDTPVPEL 628



>gb:AP004301_1839828 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0483E09.
          Length = 695

 Score =  262 bits (670), Expect = 9e-69
 Identities = 139/287 (48%), Positives = 189/287 (65%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VYKG L    LE+AVK  S ES +G  +F+AE++ I R+RH+
Sbjct: 368  ATDGFSDKHILGAGGFGRVYKGILPKSKLEVAVKRVSHESRQGMKEFVAEVASIGRIRHR 427

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YM +GSLD++L   G    L W  + +I+  V   L YLH
Sbjct: 428  NLVQLLGYCRRKGELLLVYDYMSNGSLDRYLHYEGNKPVLDWVQKFQIIKDVASGLLYLH 487

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++++ V+HRD+KASN++LD   NARLGDFGLAR  D+   ++T    + GT+GY+APE 
Sbjct: 488  EKWDKVVIHRDIKASNVLLDKEMNARLGDFGLARLYDHGTDAHT--THMVGTMGYLAPEL 545

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TGKA+  +D++AFG  LLEV+CGQRP      G    LVDWV     +  +L+ VD R
Sbjct: 546  IHTGKASTLTDVFAFGTFLLEVICGQRPIKEDAHGNQILLVDWVLEHWHNESLLDTVDPR 605

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ D+ VEEA  +L LGL CSHP  N RP    VV  + G  PVP +
Sbjct: 606  LQGDYNVEEACLVLKLGLLCSHPSTNARPCMQQVVDYLEGDTPVPEL 652



>gb:AY358027_1601930 Medicago truncatula lectin-like receptor kinase
            7;1 (LecRK7;1) mRNA, complete cds.
          Length = 659

 Score =  262 bits (670), Expect = 9e-69
 Identities = 143/286 (50%), Positives = 195/286 (68%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VYKG +    LE+AVK  S ESI+G  +F++E+  I RLRH+
Sbjct: 337  ATKGFREKGLLGVGGFGRVYKGVIQSSKLEVAVKRVSHESIQGMREFVSEIVSIGRLRHR 396

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L G+C R  +LLLVY+YMP+GSLD +L+   +   L+W  R +I+ GV   + YLH
Sbjct: 397  NLVQLHGYCRRKSELLLVYDYMPNGSLDNYLYNQPKV-RLNWSQRFRIIKGVASGVVYLH 455

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+E+ V+HRD+KASN++LDS FNARLGDFGL+R  D+    +T    +AGTIGY+APE 
Sbjct: 456  EEWEKVVIHRDIKASNVLLDSGFNARLGDFGLSRLHDHGADPHT--THLAGTIGYLAPEH 513

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            +  GKAT+ SD+++FGA LLEVVCG+RP  R+G  +S  LVD V+   + G ILEA D+ 
Sbjct: 514  IRRGKATKFSDVFSFGAFLLEVVCGRRPIGRVGDNESLILVDSVFECWQRGEILEAKDVH 573

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            L  ++V EE + +L LGL CSH     RP    VVQ +    P+P+
Sbjct: 574  LGTNYVSEEVELVLKLGLLCSHSEPLARPSMRQVVQYLERDTPLPD 619



>gb:AP004768_1844723 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0010C01.
          Length = 674

 Score =  261 bits (667), Expect = 2e-68
 Identities = 140/287 (48%), Positives = 195/287 (67%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +++ LG GG+G VYKG L    +EIAVK  S ES +G  +F+AE+  I +LRH+
Sbjct: 353  ATNGFSDERLLGFGGFGRVYKGVLLVSRVEIAVKKVSHESRQGMKEFIAEVVSIGQLRHR 412

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C + G+LLLVY+YMP+GSLD++L+    +  LSW  R +I+ G+  ++ YLH
Sbjct: 413  NLVQLLGYCRQKGELLLVYDYMPNGSLDKYLY-AENSKILSWAQRFRIIKGIASSILYLH 471

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++EQ V+HRD+KASN++LD+  N RLGDFGLAR  D     +T    V GTIGY+APE 
Sbjct: 472  EDWEQVVLHRDIKASNVLLDAEMNCRLGDFGLARLYDRGTDPHT--THVVGTIGYLAPEL 529

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWVWFLHRDGRILEAVDIR 716
              TG+ ++ SDI+AFG  +LEV CG+RP  +   GG   LVD V    R G + +AVD R
Sbjct: 530  GHTGRPSKASDIFAFGVFMLEVTCGRRPVLQDTNGGQLLLVDMVLEHWRQGTVTDAVDPR 589

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ DF VEEA  +L L L CSHP+ + RP    VVQ++ G++P+P +
Sbjct: 590  LQGDFAVEEASLVLKLCLLCSHPLPSARPGIRQVVQLLDGAMPLPEL 636



>gb:AP004301_1839829 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861336 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 698

 Score =  261 bits (667), Expect = 2e-68
 Identities = 138/294 (46%), Positives = 189/294 (64%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F     +G GG+G VYKG L    LEIAVK  S +S +G  +F+AE+  I RL+H+
Sbjct: 371  ATDGFKSMNLVGVGGFGRVYKGVLQSSKLEIAVKRVSHDSKQGMKEFIAEVVSIGRLQHR 430

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVYEYM +GSLD+HL+  G+   L W+ R +I+ G+   L YLH
Sbjct: 431  NLVQLLGYCRRKGELLLVYEYMANGSLDKHLYSEGDKRVLDWDQRLQIIKGIASGLLYLH 490

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+E+ +VHRD+K SN++LDS  N+RLGDFGLAR  D      T    V GTIGY+APE 
Sbjct: 491  EEWEKVIVHRDIKTSNVLLDSEMNSRLGDFGLARLYDRGADPLT--THVVGTIGYLAPEL 548

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI--GGFQSLVDWVWFLHRDGRILEAVDIR 716
              + KAT  +DI+AFG  +LEV CG+RP  ++  G    LVDWV      G I E VD +
Sbjct: 549  GRSSKATPLTDIFAFGIFILEVTCGRRPIMQVPEGEQHVLVDWVLEHWHKGSITEIVDTK 608

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L  ++ V+E   +L LGL CSHP++N RP    V++ + G + +P + P   +F
Sbjct: 609  LHGNYNVDEVCLVLKLGLLCSHPLSNARPNIRQVMKYLTGDMAMPELVPTHHSF 662



>gb:AP004254_1839184 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1126_D10.
          Length = 541

 Score =  261 bits (666), Expect = 3e-68
 Identities = 130/261 (49%), Positives = 190/261 (72%), Gaps = 5/261 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L  +GL +A+K F+++S K G+ ++ +E+ +I+RLRH
Sbjct: 236  ATKSFAAEEKLGQGGFGAVYRGYLREQGLAVAIKRFAKDSSKQGRKEYKSEIKVISRLRH 295

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLL+YE +P+ SLD HL   G    L+W +R KIV G+G AL YL
Sbjct: 296  RNLVQLIGWCHGRDELLLIYELVPNRSLDIHLHGNGTF--LTWPMRVKIVLGIGSALFYL 353

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+ Q VVHRD+K SN+MLD  FNA+LGDFGLAR +D+     T    V+GT GY+ PE
Sbjct: 354  HEEWGQCVVHRDIKPSNVMLDEFFNAKLGDFGLARFIDHTVGMRTM-TAVSGTPGYVDPE 412

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            CL+TG+A+ +SD+Y+FG VLLEV CG++P     ++  G   LV+W W L+  G +L+ V
Sbjct: 413  CLITGRASVKSDVYSFGIVLLEVACGRKPMSLLDSQTDGVFRLVEWAWDLYGKGDVLKVV 472

Query: 708  DIRLKEDFVVEEAKRLLLLGL 770
            D+RL +D+ V E +R+++LGL
Sbjct: 473  DVRLNDDYDVTEMERVIVLGL 493



>gb:AY358028_1601931 Medicago truncatula lectin-like receptor kinase
            7;2 (LecRK7;2) mRNA, complete cds.
          Length = 669

 Score =  259 bits (661), Expect = 1e-67
 Identities = 140/287 (48%), Positives = 189/287 (65%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VYKG + G  LE+AVK  S ES +G  +F++E+  I RLRH+
Sbjct: 337  ATKGFKEKGLLGVGGFGRVYKGVMPGSKLEVAVKRVSHESRQGMREFVSEIVSIGRLRHR 396

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD +L+       L+W  R +I+ GV   L YLH
Sbjct: 397  NLVPLLGYCRRKGELLLVYDYMPNGSLDNYLY-NQPRVTLNWSQRFRIIKGVALGLFYLH 455

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD   N RLGDFGLAR  D+    +T    + GT+GY+APE 
Sbjct: 456  EEWEQVVIHRDIKASNVLLDGELNGRLGDFGLARLYDHGADPHT--THLVGTVGYLAPEH 513

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
              TGKAT+ SD+++FGA LLEV CG+RP   +   +   LVD V+   + G ILEA D+ 
Sbjct: 514  TRTGKATKFSDVFSFGAFLLEVACGRRPIENVAENECVILVDCVFECWKRGNILEAKDVN 573

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L  ++V EE + +L LGL CSH     RP    VVQ +   +P+P++
Sbjct: 574  LGTNYVSEEVELVLKLGLLCSHSEPLARPGMRQVVQYLERDIPLPDL 620



>gb:AP004123_1837935 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1654_A02.>gb:AP005534_1853648 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0030M21.
          Length = 591

 Score =  258 bits (660), Expect = 1e-67
 Identities = 140/294 (47%), Positives = 194/294 (65%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L     E+AVK  S +S +G  +F+AE++ I RLRH+
Sbjct: 272  ATERFKNKNLLGIGGFGRVYKGVLPTSSSEVAVKRVSHDSRQGIKEFVAEVASIGRLRHR 331

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    +LLLVY+YMP+GSLD++L+   +   L+W  R +I+ G+   L YLH
Sbjct: 332  NLVQLLGYCRLKEELLLVYDYMPNGSLDKYLYSHDDKPTLNWAQRFQIIKGIASGLLYLH 391

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+K SN++LD++ N RLGDFGLAR  +  R +  +   VAGT GY+APE 
Sbjct: 392  EEWEQIVIHRDIKPSNVLLDNDMNGRLGDFGLARLYN--RDTELQTTVVAGTFGYMAPEL 449

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR-IGGFQSLV-DWVWFLHRDGRILEAVDIR 716
             LTGKA+  +D++AFGA LLEV  G+RP  + I G + L+ DWV+      +IL  +D R
Sbjct: 450  ALTGKASPLTDVFAFGAFLLEVTSGRRPVEQDIEGHRLLLTDWVFENCSKEQILAVIDPR 509

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L  +  + EA  +L LGL CSHP++N RP    VVQ + G +P+P + P R  F
Sbjct: 510  LNGNINISEASLVLKLGLLCSHPMSNVRPTMRQVVQYLNGDMPLPEMSPMRFTF 563



>gb:AP004014_1836388 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1606_D04.
          Length = 670

 Score =  258 bits (660), Expect = 1e-67
 Identities = 143/288 (49%), Positives = 191/288 (66%), Gaps = 2/288 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +K+ LG GG+G VYKG L    LE+ VK  S +S +G  +F+AE+  + RLRH+
Sbjct: 344  ATNGFVDKQLLGVGGFGKVYKGVLPSSKLEVGVKVMSHDSKQGMKEFVAEVVSMGRLRHR 403

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVYEYMP+GSLD++L+   +  P +W  R +I+ GV   L YLH
Sbjct: 404  NLVQLLGYCRRKGELLLVYEYMPNGSLDKYLYDQDKPSP-NWIQRFEIIKGVASGLLYLH 462

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LDS  N RLGDFGLAR  D+   ++T    VAGT GYI+PE 
Sbjct: 463  EEWEQVVIHRDIKASNVLLDSEMNGRLGDFGLARLHDHGVDAHT--TCVAGTRGYISPEL 520

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
               GKAT+ +D++AFGA +LEV CG+RP      G  Q LVD+V    +   IL  +D R
Sbjct: 521  ARLGKATKATDVFAFGAFILEVACGRRPIGMNSSGELQVLVDFVLRFWQRDLILCMLDTR 580

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP 860
            L  +FV EEA+ +L LGL CSHP    RP    V+Q + G V +P +P
Sbjct: 581  LGGEFVTEEAELVLKLGLLCSHPSPASRPSMRLVMQYLCGDVLLPAMP 628



>gb:AP003981_1835888 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1019_E02.
          Length = 588

 Score =  258 bits (660), Expect = 1e-67
 Identities = 145/329 (44%), Positives = 205/329 (62%), Gaps = 6/329 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGE-GLEIAVKWFSRESIKGQGDFLAELSIINRLRH 179
            AT +F E  KLG+GG+G VY+G L+   G+ +AVK  S+ S +G+ ++ +E+SII+RLRH
Sbjct: 229  ATNDFSEDGKLGEGGFGSVYRGVLSEPAGVHVAVKRISKTSKQGRKEYASEVSIISRLRH 288

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH  G  LLVYE +P+GSLD HL+ GG T  L W  R +I  G+G AL YL
Sbjct: 289  RNLVQLVGWCHGRGDFLLVYELVPNGSLDAHLYGGGAT--LPWPTRYEIALGLGSALLYL 346

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H+ +E+ VVHRD+K SNIMLDS F A+LGDFGLA+ +D+   S T    +AGT+GY+ PE
Sbjct: 347  HSGYEKCVVHRDIKPSNIMLDSAFAAKLGDFGLAKLVDHGDASQTTAV-LAGTMGYMDPE 405

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPG-TRIGGFQS-LVDWVWFLHRDGRILEAVDI 713
               +GKA+  SD+Y+FG VLLE+ CG+RP   +    +S L++WVW LH  G ILEA D 
Sbjct: 406  YAASGKASTASDVYSFGIVLLEMCCGRRPVLLQEQSIRSRLLEWVWDLHGRGAILEAADE 465

Query: 714  RLKEDFVVEEAKR---LLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            RL+   +  +AK+   ++++GL C+HP    RP     +  +    P+P +PP  P   +
Sbjct: 466  RLRGGELELDAKQVECVMVVGLWCAHPDRGVRPSIKQALAALQFEAPLPALPPTMPVPTY 525

Query: 885  PSALXXXXXXXXXXXXXXXXXXXFNSGWS 971
             S                     F+S  S
Sbjct: 526  SSLPSLALYCDAAAASSSSSSAGFSSSTS 554



>gb:AP004166_1838475 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1499_A07.
          Length = 683

 Score =  257 bits (656), Expect = 4e-67
 Identities = 134/297 (45%), Positives = 198/297 (66%), Gaps = 11/297 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L   GL +A+K F+++S K G+ ++ +E+ +I+RLRH
Sbjct: 373  ATKSFATEEKLGQGGFGAVYRGYLRELGLAVAIKRFAKDSSKQGRKEYKSEIKVISRLRH 432

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRC------KIVSGVG 341
            ++LV+L+GWCH   +LLLVYE +P+ SLD HL   G    L+W +R        IV G+G
Sbjct: 433  RNLVQLIGWCHGRTELLLVYELVPNRSLDVHLHGNGTF--LTWPMRLGCCHRINIVHGLG 490

Query: 342  YALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTI 521
             AL YLH E++Q VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T     +GT 
Sbjct: 491  SALLYLHEEWDQCVVHRDIKPSNVMLDESFNAKLGDFGLARLIDHAVGVQTMTH-PSGTP 549

Query: 522  GYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS----LVDWVWFLHRDG 689
            GY+ PEC++TGKA+ +SD+Y+FG VLLEV CG+RP + +    +    LV+WVW L+  G
Sbjct: 550  GYLDPECVITGKASAESDVYSFGVVLLEVACGRRPMSLLDNQNNSLFRLVEWVWDLYGQG 609

Query: 690  RILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP 860
             +L+A D RL  D+     + ++ +GL C HP    RP     + ++  + P+P +P
Sbjct: 610  VVLKAADERLNNDYDATSMECVMAVGLWCVHPDRYARPSIRAAMTVLQSNGPLPVLP 666



>gb:AP005100_1847816 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBa0018O23.>gb:AP005766_1857492 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0028O21.
          Length = 669

 Score =  256 bits (654), Expect = 6e-67
 Identities = 139/290 (47%), Positives = 187/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  +  LG GG+G VYKG L    LEIAVK    ES +G  +F+AE+  I RL+H 
Sbjct: 344  ATEGFKNENLLGVGGFGRVYKGTLPVSKLEIAVKRVCHESRQGMKEFVAEIVSIGRLQHH 403

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF-IGGETDPLSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C R G+L LVY+YMP+GS+D+++  I G+T  L+W  R  I+ G+   L YL
Sbjct: 404  NLVQLLGYCRRRGELFLVYDYMPNGSVDKYIHSIEGKT-ILTWAQRWHIIKGIASCLVYL 462

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+E+ V+HRD+KASN++LD + N RLGDFGLAR  D++    T    V GTIGY+APE
Sbjct: 463  HEEWEKAVIHRDIKASNVLLDGDMNGRLGDFGLARLYDHDDDPQT--THVVGTIGYLAPE 520

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               T KAT  +D++AFG  +LEV CGQRP   + +     LVDWV      G ++  VD 
Sbjct: 521  LGHTSKATPLTDVFAFGMFVLEVACGQRPINQSSLDSQTMLVDWVLEQWNKGSLVSTVDS 580

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL+ ++ V EA   + LGL CSHP AN RP    V+  + GS+P+P + P
Sbjct: 581  RLEGNYNVREAVLAINLGLLCSHPFANARPSMRQVIHYLDGSIPLPEMSP 630



>gb:AP005534_1853651 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0030M21.
          Length = 682

 Score =  256 bits (653), Expect = 8e-67
 Identities = 138/294 (46%), Positives = 192/294 (65%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L     E+AVK  S +S +G  +F+AE++ I RLRH+
Sbjct: 363  ATERFNNKNLLGIGGFGRVYKGVLPTSSSEVAVKRVSHDSRQGIKEFVAEVASIGRLRHR 422

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L G+C    +LLLVY+YMP+GSLD++L+   +   L+W  R +I+ G+   L YLH
Sbjct: 423  NLVQLFGYCRLKKELLLVYDYMPNGSLDKYLYSHDDKPTLNWAQRFQIIKGIASGLLYLH 482

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+K SN++LD++ N RLGDFGLAR  +  R +  +   VAGT GY+APE 
Sbjct: 483  EEWEQIVIHRDIKPSNVLLDNDMNGRLGDFGLARLYN--RDTELQTTVVAGTFGYMAPEL 540

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR-IGGFQSLV-DWVWFLHRDGRILEAVDIR 716
             LTGKA+  +D++AFGA LLEV  G+RP  + I G   L+ DWV+    + +IL  +D R
Sbjct: 541  ALTGKASPLTDVFAFGAFLLEVTSGRRPVEQDIEGHPLLLTDWVFEHCSNEQILAVIDPR 600

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L  +  + EA  +L LGL CSHP++N RP    VVQ + G +P+P + P    F
Sbjct: 601  LNGNINISEASLVLKLGLLCSHPMSNVRPTMRQVVQYLNGDMPLPEMSPMHFTF 654



>gb:AP006172_1861328 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 673

 Score =  255 bits (652), Expect = 1e-66
 Identities = 140/290 (48%), Positives = 186/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F +K  LG GG+G VYKG L      +AVK  S ES +G  +F+AE+  I +LRH+
Sbjct: 341  ATEGFKDKNLLGVGGFGKVYKGVLPVSKRVVAVKCVSHESSQGMKEFVAEIVSIGQLRHR 400

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YM +GSLD +L+       L W  R  IV GV   L YLH
Sbjct: 401  NLVQLLGYCRRKGELLLVYDYMSNGSLDNYLYCDLTEPTLDWAQRFNIVKGVTSGLLYLH 460

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++ + V+HRD+KASN++LD + NARLGDFGL+R  D+     T    + GT+GY+APE 
Sbjct: 461  EKWGKIVIHRDIKASNVLLDKDMNARLGDFGLSRLYDHGTDPQT--THLVGTMGYLAPEL 518

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            + TGKA+  +DI+AFG  LLEV CGQRP     +      LVDWV    + G + E VD 
Sbjct: 519  VFTGKASPATDIFAFGVFLLEVTCGQRPLNNNQQDNQPPMLVDWVLEHWQKGLLPETVDK 578

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL+ ++ V+EA  +L LGL CSHPIA ERP  S V + + G  P+P + P
Sbjct: 579  RLQGNYNVDEACLVLKLGLLCSHPIAMERPTMSQVQRYLDGDAPLPELAP 628



>gb:AP004301_1839822 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0483E09.
          Length = 712

 Score =  255 bits (652), Expect = 1e-66
 Identities = 140/290 (48%), Positives = 186/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F +K  LG GG+G VYKG L      +AVK  S ES +G  +F+AE+  I +LRH+
Sbjct: 380  ATEGFKDKNLLGVGGFGKVYKGVLPVSKRVVAVKCVSHESSQGMKEFVAEIVSIGQLRHR 439

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YM +GSLD +L+       L W  R  IV GV   L YLH
Sbjct: 440  NLVQLLGYCRRKGELLLVYDYMSNGSLDNYLYCDLTEPTLDWAQRFNIVKGVTSGLLYLH 499

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++ + V+HRD+KASN++LD + NARLGDFGL+R  D+     T    + GT+GY+APE 
Sbjct: 500  EKWGKIVIHRDIKASNVLLDKDMNARLGDFGLSRLYDHGTDPQT--THLVGTMGYLAPEL 557

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            + TGKA+  +DI+AFG  LLEV CGQRP     +      LVDWV    + G + E VD 
Sbjct: 558  VFTGKASPATDIFAFGVFLLEVTCGQRPLNNNQQDNQPPMLVDWVLEHWQKGLLPETVDK 617

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL+ ++ V+EA  +L LGL CSHPIA ERP  S V + + G  P+P + P
Sbjct: 618  RLQGNYNVDEACLVLKLGLLCSHPIAMERPTMSQVQRYLDGDAPLPELAP 667



>gb:AP005829_1858630 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1008E06.
          Length = 668

 Score =  255 bits (651), Expect = 1e-66
 Identities = 141/294 (47%), Positives = 181/294 (61%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K  +G GG+G VYKG LA   LEIAVK  S ES +G  +F+ E+  I RLRH+
Sbjct: 342  ATQGFKNKNMIGVGGFGKVYKGVLATSKLEIAVKKISHESRQGMKEFITEIVSIGRLRHR 401

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R  +LLLVY YMP GSLD++L        L+W  R +I+  V   L YLH
Sbjct: 402  NLVPLLGYCRRKSELLLVYNYMPKGSLDKYLHDVDNRAILNWAQRFQIIKDVACGLFYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
              +E+ V+HRD+KASNI+LD+  N RLGDFGLAR  D+     T    V  T+GY+APE 
Sbjct: 462  ERWEKVVIHRDIKASNILLDAEMNGRLGDFGLARLYDHGTDLQT--THVVRTMGYLAPEM 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TGKA+  +D++AFGA LLE  CGQRP      G    LVDWV     DG + EAVD+R
Sbjct: 520  VQTGKASPLTDVFAFGAFLLETTCGQRPVKQNSQGNQLMLVDWVLKHWHDGSLTEAVDMR 579

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L+ D+ +EEA  +L L L C HP    RP    V+Q +   +P P + P R  F
Sbjct: 580  LQGDYNIEEACLVLKLALVCLHPFPASRPNMRQVMQYLDKDLPQPELAPTRLGF 633



>gb:AP003758_1833018 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1562_B11.
          Length = 692

 Score =  254 bits (650), Expect = 2e-66
 Identities = 139/291 (47%), Positives = 181/291 (62%), Gaps = 4/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VYKG L     EIAVK  S  S +G  +F+AE+  I R+RH+
Sbjct: 362  ATQGFTDKNLLGAGGFGSVYKGVLPVSNTEIAVKRVSHNSRQGMREFIAEVVSIGRIRHR 421

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C R G+LLLVY+Y  +GSLD+ L     +  L W  R  I+ GV  AL YLH
Sbjct: 422  NIVRLLGYCRRKGELLLVYDYKTNGSLDKCLHDNATSTTLCWPKRIHIIKGVASALSYLH 481

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALD---NERTSYTEGEGVAGTIGYIA 533
             ++EQ V+HRD+KASN++LDS  N  LGDFGL+R  D   + +T+Y     V GT+GYIA
Sbjct: 482  KDWEQVVIHRDVKASNVLLDSEMNGLLGDFGLSRLRDHGADAKTTY-----VVGTMGYIA 536

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRP-GTRIGGFQSLVDWVWFLHRDGRILEAVD 710
            PE + TGKAT  +D++AFG  LLEV CG+RP G        L+DWV      G IL  VD
Sbjct: 537  PELMHTGKATPLTDVFAFGVFLLEVTCGRRPIGESDSNEILLIDWVLKHFLSGSILNVVD 596

Query: 711  IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
             RL   F  EE   +L LGL CSHP+   RP    VV+ + G +P P + P
Sbjct: 597  PRLAGRFSFEEVNLVLKLGLMCSHPLPKARPSMDKVVKYLDGMLPAPELSP 647



>gb:AP005100_1847815 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBa0018O23.>gb:AP005766_1857491 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0028O21.
          Length = 669

 Score =  254 bits (649), Expect = 2e-66
 Identities = 128/287 (44%), Positives = 184/287 (64%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F +   LG GG+G VYKG L    + +A+K  S ES +G   F+AE+  I +LRH+
Sbjct: 344  ATEGFNKNNLLGVGGFGKVYKGVLQKSKVPVAIKRVSHESTQGMKKFIAEVVSIGKLRHR 403

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YM +GSL+++L+       L+W  R  ++ GV + L YLH
Sbjct: 404  NLVPLLGYCRRKGQLLLVYDYMSNGSLNKYLYPEDGKPSLNWAERFHVIKGVAFGLLYLH 463

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++E+ V+HRD+K SN++LDS  N +LGDFGL+R  D+     T    + GT+GY+APE 
Sbjct: 464  EKWEKVVIHRDIKPSNVLLDSEMNGKLGDFGLSRLYDHGTDPQT--THMVGTMGYLAPEL 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TG+A+  +D++AFG  LLEV CGQRP  +   G   SL DWV     +  ++EA+D R
Sbjct: 522  VRTGRASTSTDVFAFGIFLLEVTCGQRPIKKDSQGNQHSLFDWVLQFLHNSSLIEAMDSR 581

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ DF ++E   +L LGL CSHP  N RP    V++ + G  P+P +
Sbjct: 582  LQADFNIDEVCLVLKLGLLCSHPFTNARPSMQQVMEYLEGDTPIPEI 628



>gb:OSJN00183_1696342 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0081C01, complete sequence.
          Length = 679

 Score =  254 bits (649), Expect = 2e-66
 Identities = 140/290 (48%), Positives = 186/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K+ LG GG+G VYKG LA   LEIAVK  S +S +G  +F+AE+  I  LRH+
Sbjct: 346  ATKGFKNKQLLGTGGFGRVYKGVLAKSNLEIAVKRVSHDSKQGMKEFIAEVVSIGHLRHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C R G+LLLVY+YM +GSLD++L+   +T P L W  R +I+ GV   L YL
Sbjct: 406  NLVQLLGYCRRKGELLLVYDYMSNGSLDKYLY--DKTKPVLDWGQRFQIIKGVASGLLYL 463

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H ++EQ V+HRD+KASN++LD   N RLGDFGLAR  D+     T    V GT+GY+APE
Sbjct: 464  HEDWEQVVIHRDIKASNVLLDGEMNGRLGDFGLARLYDHGVDPQT--THVVGTMGYLAPE 521

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDI 713
             + TGKAT  +D++AFG  +LEV CG+RP   I       L+DWV    R    L+ VD 
Sbjct: 522  LVRTGKATPVTDVFAFGVFVLEVTCGRRPLGCIAPDDQNVLLDWVQEHERRHAALDTVDA 581

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL   +  +EA+  L LGL C+HP+ + RP    V Q + G  P+P V P
Sbjct: 582  RLCGKYDADEARLALKLGLMCAHPLPDARPTMRQVTQYLDGDAPMPEVAP 631



>pir|T47694|T47694 probable serine/threonine-specific protein kinase -
            Arabidopsis thaliana>gb:ATT22E16_1555259 Arabidopsis
            thaliana DNA chromosome 3, BAC clone T22E16.
          Length = 684

 Score =  254 bits (649), Expect = 2e-66
 Identities = 137/289 (47%), Positives = 179/289 (61%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  FG+K+ LG GG+G VYKG L G    +AVK  S ES +G  +F++E+S I  LRH+
Sbjct: 342  ATNGFGDKELLGSGGFGKVYKGKLPGSDEFVAVKRISHESRQGVREFMSEVSSIGHLRHR 401

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLGWC R   LLLVY++MP+GSLD +LF       L+W+ R KI+ GV   L YLH
Sbjct: 402  NLVQLLGWCRRRDDLLLVYDFMPNGSLDMYLFDENPEVILTWKQRFKIIKGVASGLLYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
              +EQ V+HRD+KA+N++LDS  N R+GDFGLA+    E  S      V GT GY+APE 
Sbjct: 462  EGWEQTVIHRDIKAANVLLDSEMNGRVGDFGLAKLY--EHGSDPGATRVVGTFGYLAPEL 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
              +GK T  +D+YAFGAVLLEV CG+RP   + +     +VDWVW   + G I + VD R
Sbjct: 520  TKSGKLTTSTDVYAFGAVLLEVACGRRPIETSALPEELVMVDWVWSRWQSGDIRDVVDRR 579

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L  +F  EE   ++ LGL CS+     RP    VV  +    P P V P
Sbjct: 580  LNGEFDEEEVVMVIKLGLLCSNNSPEVRPTMRQVVMYLEKQFPSPEVVP 628



>gb:AP004301_1839831 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861337 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 666

 Score =  254 bits (648), Expect = 3e-66
 Identities = 137/289 (47%), Positives = 183/289 (63%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    LE+AVK  S ES +G  +F+ E+  I RLRH+
Sbjct: 342  ATEGFKNKNLLGTGGFGKVYKGILPTNKLEVAVKRLSHESRQGTKEFITEIVSIGRLRHR 401

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YMP+GSLD++L+   +   L W  R  I+ GV   L YLH
Sbjct: 402  NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYSEDKLS-LDWNKRFHIIKGVASCLLYLH 460

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E E  V+HRD+KASN++LDS  N RLGDFGLA++ D+     T    V GT+GY+APE 
Sbjct: 461  EECESVVIHRDIKASNVLLDSELNGRLGDFGLAKSYDHGSDPQT--TRVVGTMGYLAPEL 518

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TGK +  +D++AFG  LLE+ CGQRP      G    LVDWV    + G ++E +D R
Sbjct: 519  VRTGKPSPLTDVFAFGTFLLEITCGQRPVKQNAQGDRFMLVDWVLEHWQKGSMVETIDKR 578

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L+ +  + EA  +L LGL CS P A  RP  + V+  + G +P+P   P
Sbjct: 579  LQGNCNINEACLVLKLGLLCSQPFARSRPSMNHVMLYLNGDMPLPEFTP 627



>gb:AP004123_1837931 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1654_A02.
          Length = 683

 Score =  254 bits (648), Expect = 3e-66
 Identities = 139/295 (47%), Positives = 190/295 (64%), Gaps = 3/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    LE+AVK  S ES +G  +F+AE+  I RLRH+
Sbjct: 355  ATERFKNKNLLGVGGFGRVYKGVLPKSRLEVAVKRVSHESRQGMKEFVAEVVSIGRLRHR 414

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C    +LLLVY+YMP+GSLD++L+       LSW  R  I+ G+   L YLH
Sbjct: 415  NIVQLLGYCRLKNELLLVYDYMPNGSLDKYLYGHNNMPVLSWAQRFLIIKGIASGLYYLH 474

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ VVHRD+KASN++LDS  NARLGDFGLA+  ++     T    +AGT+GY+APE 
Sbjct: 475  EEWEQVVVHRDIKASNVLLDSEMNARLGDFGLAKLYNHGSDMQT--TIIAGTLGYLAPEI 532

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWV-WFLHRDGRILEAVDI 713
              TGKA+  +D++AFG  LLEV  G++P  R   GG   LVD +   L R+   ++ VD 
Sbjct: 533  TRTGKASPLTDVFAFGVFLLEVTTGRKPVERDTEGGIHMLVDLISAHLDRETLPMDMVDP 592

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            RL+ ++  +EA  +L LGL CSHP+ + RP    V+Q + G +P P + P   +F
Sbjct: 593  RLEGEYNTDEASLVLKLGLLCSHPLPDLRPSMRQVMQYLDGQLPFPELVPSHTSF 647



>gb:BT004634_1637668 Arabidopsis thaliana At3g53810 gene, complete
            cds.
          Length = 677

 Score =  253 bits (645), Expect = 7e-66
 Identities = 140/291 (48%), Positives = 189/291 (64%), Gaps = 4/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VY+G L    LE+AVK  S +S +G  +F+AE+  I R+ H+
Sbjct: 343  ATKGFKEKDLLGSGGFGRVYRGILPTTKLEVAVKRVSHDSKQGMKEFVAEIVSIGRMSHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD++L+   ET  L W+ R  I+ GV   L YLH
Sbjct: 403  NLVPLLGYCRRRGELLLVYDYMPNGSLDKYLYNNPET-TLDWKQRSTIIKGVASGLFYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD++FN RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 462  EEWEQVVIHRDVKASNVLLDADFNGRLGDFGLARLYDHGSDPQT--THVVGTLGYLAPEH 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TG+AT  +D+YAFGA LLEVV G+RP    +       LV+WV+ L   G I+EA D 
Sbjct: 520  SRTGRATTTTDVYAFGAFLLEVVSGRRPIEFHSASDDTFLLVEWVFSLWLRGNIMEAKDP 579

Query: 714  RL-KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            +L    + +EE + +L LGL CSH     RP    V+Q + G + +P + P
Sbjct: 580  KLGSSGYDLEEVEMVLKLGLLCSHSDPRARPSMRQVLQYLRGDMALPELTP 630



>pir|T45921|T45921 serine/threonine-specific kinase like protein -
            Arabidopsis thaliana>gb:ATF5K20_1550785 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F5K20.
          Length = 677

 Score =  253 bits (645), Expect = 7e-66
 Identities = 140/291 (48%), Positives = 189/291 (64%), Gaps = 4/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VY+G L    LE+AVK  S +S +G  +F+AE+  I R+ H+
Sbjct: 343  ATKGFKEKDLLGSGGFGRVYRGILPTTKLEVAVKRVSHDSKQGMKEFVAEIVSIGRMSHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD++L+   ET  L W+ R  I+ GV   L YLH
Sbjct: 403  NLVPLLGYCRRRGELLLVYDYMPNGSLDKYLYNNPET-TLDWKQRSTIIKGVASGLFYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD++FN RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 462  EEWEQVVIHRDVKASNVLLDADFNGRLGDFGLARLYDHGSDPQT--THVVGTLGYLAPEH 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TG+AT  +D+YAFGA LLEVV G+RP    +       LV+WV+ L   G I+EA D 
Sbjct: 520  SRTGRATTTTDVYAFGAFLLEVVSGRRPIEFHSASDDTFLLVEWVFSLWLRGNIMEAKDP 579

Query: 714  RL-KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            +L    + +EE + +L LGL CSH     RP    V+Q + G + +P + P
Sbjct: 580  KLGSSGYDLEEVEMVLKLGLLCSHSDPRARPSMRQVLQYLRGDMALPELTP 630



>gb:AP006172_1861338 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 646

 Score =  252 bits (643), Expect = 1e-65
 Identities = 138/295 (46%), Positives = 191/295 (64%), Gaps = 3/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    L+IAVK  S +S +G  +F+AE+  I  L+H+
Sbjct: 318  ATEGFKNKHLLGTGGFGSVYKGVLPISRLDIAVKRVSHDSTQGMKEFIAEIVSIGCLQHR 377

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C R G+LLLVY+YMP+GSLD++L+ G E  P L W  R +I+ GV   L YL
Sbjct: 378  NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY-GKEGKPTLDWTQRFQIIKGVASGLLYL 436

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E E+ ++HRD+KASN++LD++ NAR+GDFGLAR  D+   +  E   V GTIGY+APE
Sbjct: 437  HEESEKVIIHRDIKASNVLLDNDTNARIGDFGLARLYDH--GTDPETTRVVGTIGYLAPE 494

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLV--DWVWFLHRDGRILEAVDI 713
                GKAT  +D++AFG  +LEV CGQ+P  +      LV  DWV      G + + VDI
Sbjct: 495  LARGGKATPLTDVFAFGMFILEVTCGQKPVMQNTEDDQLVLIDWVLEHWHKGSLADTVDI 554

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +L+ ++ ++EA   L +GL CSHP+ + RP    VVQ +   +P+P   P   +F
Sbjct: 555  KLQGEYNIDEACLALNIGLLCSHPLISVRPNMRQVVQYLNKDIPLPESMPTHLSF 609



>gb:AP004301_1839832 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0483E09.
          Length = 647

 Score =  252 bits (643), Expect = 1e-65
 Identities = 138/295 (46%), Positives = 191/295 (64%), Gaps = 3/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    L+IAVK  S +S +G  +F+AE+  I  L+H+
Sbjct: 319  ATEGFKNKHLLGTGGFGSVYKGVLPISRLDIAVKRVSHDSTQGMKEFIAEIVSIGCLQHR 378

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C R G+LLLVY+YMP+GSLD++L+ G E  P L W  R +I+ GV   L YL
Sbjct: 379  NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLY-GKEGKPTLDWTQRFQIIKGVASGLLYL 437

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E E+ ++HRD+KASN++LD++ NAR+GDFGLAR  D+   +  E   V GTIGY+APE
Sbjct: 438  HEESEKVIIHRDIKASNVLLDNDTNARIGDFGLARLYDH--GTDPETTRVVGTIGYLAPE 495

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLV--DWVWFLHRDGRILEAVDI 713
                GKAT  +D++AFG  +LEV CGQ+P  +      LV  DWV      G + + VDI
Sbjct: 496  LARGGKATPLTDVFAFGMFILEVTCGQKPVMQNTEDDQLVLIDWVLEHWHKGSLADTVDI 555

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +L+ ++ ++EA   L +GL CSHP+ + RP    VVQ +   +P+P   P   +F
Sbjct: 556  KLQGEYNIDEACLALNIGLLCSHPLISVRPNMRQVVQYLNKDIPLPESMPTHLSF 610



>gb:AP004014_1836383 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1606_D04.
          Length = 676

 Score =  251 bits (641), Expect = 2e-65
 Identities = 136/288 (47%), Positives = 183/288 (63%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  +  LG GG+G VYKG+L    L+IAVK  S ES +G  +F+AE+  I RLRH+
Sbjct: 357  ATEGFKNRHLLGTGGFGRVYKGFLFESKLQIAVKRVSHESRQGIREFIAEIVSIGRLRHR 416

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C R G+LLLVY+YMP+GSLD++L        L W  R +I+ GV   L YLH
Sbjct: 417  NIVQLLGYCRRKGELLLVYDYMPNGSLDKYLHCNSTRPSLDWNQRFRIIKGVASGLWYLH 476

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD   NARLGDFGLAR  D+     T    + GTIGY+APE 
Sbjct: 477  GEWEQVVIHRDVKASNVLLDEEMNARLGDFGLARLYDHGTDMQT--THLVGTIGYLAPEL 534

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TGKA+  +D+++FG  +LEV CG+RP   G       +LVDWV     +G +LE +D 
Sbjct: 535  ANTGKASPATDVFSFGIFVLEVACGRRPIEHGMNSEYKFTLVDWVIDRWHEGSLLEVMDP 594

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            +L+  +  +EA   L LGL CSHP    RP    V+Q +   +P P +
Sbjct: 595  KLQNGYDDDEACLALKLGLLCSHPSPIARPTMWHVMQYLNHDLPFPEL 642



>pir|T02537|T02537 probable serine/threonine-specific protein kinase
            F13M22.21  (EC 2.7.1.-) - Arabidopsis
            thaliana>gb:AC004684_1532082 Arabidopsis thaliana
            chromosome 2 clone F13M22 map ve018, complete
            sequence.>gb:AY091070_1574297 Arabidopsis thaliana
            putative receptor protein kinase (At2g37710) mRNA,
            complete cds.
          Length = 675

 Score =  250 bits (639), Expect = 3e-65
 Identities = 140/294 (47%), Positives = 184/294 (62%), Gaps = 7/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VYKG + G  LEIAVK  S ES +G  +F+AE+  I R+ H+
Sbjct: 343  ATKGFKEKGLLGTGGFGSVYKGVMPGTKLEIAVKRVSHESRQGMKEFVAEIVSIGRMSHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD++L+   E   L+W+ R K++ GV   L YLH
Sbjct: 403  NLVPLLGYCRRRGELLLVYDYMPNGSLDKYLYNTPEV-TLNWKQRIKVILGVASGLFYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD   N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 462  EEWEQVVIHRDVKASNVLLDGELNGRLGDFGLARLYDHGSDPQT--THVVGTLGYLAPEH 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-------LVDWVWFLHRDGRILE 701
              TG+AT  +D++AFGA LLEV CG+RP      FQ        LVDWV+ L   G IL 
Sbjct: 520  TRTGRATMATDVFAFGAFLLEVACGRRPIE----FQQETDETFLLVDWVFGLWNKGDILA 575

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            A D  +  +   +E + +L LGL CSH     RP    V+  + G   +P + P
Sbjct: 576  AKDPNMGSECDEKEVEMVLKLGLLCSHSDPRARPSMRQVLHYLRGDAKLPELSP 629



>gb:AE016959_1022784 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AE017098_1752603 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 52 of 77
            of the complete sequence.
          Length = 1192

 Score =  250 bits (638), Expect = 4e-65
 Identities = 140/301 (46%), Positives = 181/301 (60%), Gaps = 9/301 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F  K+ LG GG+G VY+G L   G E+AVK  S ++ +G   F+AE+  I RLRH+
Sbjct: 858  ATAGFDGKRLLGVGGFGRVYRGVLPASGTEVAVKIVSHDAKQGMRQFVAEVVSIGRLRHR 917

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V LLG+C R G+LLLVY+YMP+GSLD+ L   G   PL W  R   V GV   L YLH
Sbjct: 918  NVVPLLGYCRRRGELLLVYDYMPNGSLDRWLHDHG-APPLGWAQRLHAVRGVAAGLLYLH 976

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++EQ VVHRD+KASN++LD   NARLGDFGLAR  D  R +  +   V GT+GY+APE 
Sbjct: 977  EDWEQVVVHRDVKASNVLLDGEMNARLGDFGLARLYD--RGADPQTTRVVGTMGYLAPEL 1034

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---------LVDWVWFLHRDGRI 695
              T + T  +D++AFG+ +LEV CG+RP  R G   +         L DWV      G I
Sbjct: 1035 AHTRRVTPATDVFAFGSFVLEVACGRRPIERGGAMTAAADEDGQLVLADWVLDRWHKGDI 1094

Query: 696  LEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
              A D RL  D+  +EA  +L LGL CSHP+A  RP    VV  + G  P+P   P   +
Sbjct: 1095 AAAADARLCGDYDAKEAALVLKLGLLCSHPVAAARPTMRQVVHFLDGDAPLPEPEPTYRS 1154

Query: 876  F 878
            F
Sbjct: 1155 F 1155



>pir|T50661|T50661 receptor-type protein kinase LRK1 [imported] -
            Arabidopsis thaliana>gb:ATLECGENE_1553572 A.thaliana mRNA
            for receptor like protein kinase.
          Length = 635

 Score =  250 bits (638), Expect = 4e-65
 Identities = 140/294 (47%), Positives = 184/294 (62%), Gaps = 7/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK  LG GG+G VYKG + G  LEIAVK  S ES +G  +F+AE+  I R+ H+
Sbjct: 342  ATKGFKEKGLLGTGGFGSVYKGVMPGTKLEIAVKRVSHESRQGMKEFVAEIVSIGRMSHR 401

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD++L+   E   L+W+ R K++ GV   L YLH
Sbjct: 402  NLVPLLGYCRRRGELLLVYDYMPNGSLDKYLYNTPEV-TLNWKQRIKVILGVASGLFYLH 460

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD   N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 461  EEWEQVVIHRDVKASNVLLDRELNGRLGDFGLARLYDHGSDPQT--THVVGTLGYLAPEH 518

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-------LVDWVWFLHRDGRILE 701
              TG+AT  +D++AFGA LLEV CG+RP      FQ        LVDWV+ L   G IL 
Sbjct: 519  TRTGRATMATDVFAFGAFLLEVACGRRPIE----FQQETDETFLLVDWVFGLWNKGDILA 574

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            A D  +  +   +E + +L LGL CSH     RP    V+  + G   +P + P
Sbjct: 575  AKDPNMGSECDEKEVEMVLKLGLLCSHSDPRARPSMRQVLHYLRGDAKLPELSP 628



>gb:AP004014_1836374 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861342 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 667

 Score =  249 bits (637), Expect = 6e-65
 Identities = 133/289 (46%), Positives = 178/289 (61%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  +  LG GG+G VYKG L    L +AVK  S +S +G  +F+AE+  I RLRH+
Sbjct: 342  ATDGFKNRNLLGLGGFGKVYKGVLPTSKLHVAVKRVSHDSKQGMKEFIAEIVSIGRLRHR 401

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVYEYMP+GSLD++L+       L W  R +I+ GV   L YLH
Sbjct: 402  NLVQLLGYCRRKGELLLVYEYMPNGSLDKYLYCEDSKPTLDWAQRFQIIKGVASGLFYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            + +E+ V+HRD+KASN++LD   N RLGDFGLA+  D+     T    V GT+GY+APE 
Sbjct: 462  DRWEKIVIHRDVKASNVLLDGEMNGRLGDFGLAKLYDHGADPQT--THVVGTMGYLAPEL 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG--GFQSLVDWVWFLHRDGRILEAVDIR 716
              TGKAT  +D+YAFG  +LEV CGQRP         Q L+D V      G +   +D R
Sbjct: 520  ARTGKATPLTDVYAFGIFILEVTCGQRPIDNYADDNSQMLIDCVVEHWHKGSLTNMLDKR 579

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L  D+  +E   +L LGL C+HP    RP    V+Q + G  P+P + P
Sbjct: 580  LLGDYDADEVCLVLKLGLLCAHPFCKSRPSMRQVMQYLDGDKPLPELMP 628



>gb:AP004166_1838474 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1499_A07.
          Length = 681

 Score =  249 bits (635), Expect = 1e-64
 Identities = 136/303 (44%), Positives = 195/303 (64%), Gaps = 5/303 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK-GQGDFLAELSIINRLRH 179
            AT++F  ++KLGQGG+G VY+G+L   GL +A+K F++ S K G+ ++ +E+ +I+RLRH
Sbjct: 355  ATKSFAPEEKLGQGGFGAVYRGYLRELGLAVAIKRFAKNSSKQGRKEYKSEIKVISRLRH 414

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE  P+ SLD HL   G    L+W +R  IV G+G AL YL
Sbjct: 415  RNLVQLIGWCHGRTELLLVYELFPNRSLDVHLHGNGTF--LTWPMRINIVHGLGSALLYL 472

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E++Q VVHRD+K SN+MLD +FNA+LGDFGLAR +D+     T     +GT GY+ PE
Sbjct: 473  HEEWDQCVVHRDIKPSNVMLDESFNAKLGDFGLARLIDHAVGIQTMTH-PSGTPGYLDPE 531

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP----GTRIGGFQSLVDWVWFLHRDGRILEAV 707
            C++TGKA+ +SD+Y+FG VLLEV CG+RP     T+      LV+WVW L+  G +L A 
Sbjct: 532  CVITGKASAESDVYSFGIVLLEVACGRRPISLQDTQNNCLFRLVEWVWDLYGQGAVLNAA 591

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVWP 887
            D RL  ++     + ++ +GL C +P     P          G+V V N   F   F + 
Sbjct: 592  DERLNNEYDTTSMECVMAVGL-CRYPSPYRGP----------GNVGVNNRSQFAEYFGYT 640

Query: 888  SAL 896
            +A+
Sbjct: 641  AAM 643



>gb:AP004301_1839833 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861339 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 760

 Score =  248 bits (632), Expect = 2e-64
 Identities = 135/289 (46%), Positives = 183/289 (63%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    LE+AVK  S  S +G  +F++E+  I  LRH+
Sbjct: 433  ATEGFKSKHILGVGGFGKVYKGVLRTSKLEVAVKKVSHGSNQGMKEFISEVVSIGHLRHR 492

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+LLLVY+YMP+GSLD++L+       L+W  R +I+  V   L YLH
Sbjct: 493  NLVQLLGYCRRKGELLLVYDYMPNGSLDKYLYGEDNKPVLNWAQRMQIIKDVASGLFYLH 552

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++++ V+HRD+KASN++LDS  NARLGDFGLAR  ++     T    + GT+G+IAPE 
Sbjct: 553  EKWDKVVIHRDIKASNVLLDSEMNARLGDFGLARLYEHGTNPQT--THLVGTMGFIAPEL 610

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
              TGKA+  +D++AFG  LLEV CG+ P   +   G + LVDWV      G + E VD +
Sbjct: 611  ARTGKASPLTDVFAFGTFLLEVTCGRWPISNSAHHGRKMLVDWVLQHWHQGSLPETVDPK 670

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L   + V+EA  +L LGL CSHPI   RP    V+Q + G  P+P   P
Sbjct: 671  LHGIYNVDEACLVLTLGLMCSHPIPGARPIMRQVMQYLDGDAPLPEFTP 719



>gb:AJ784275_1814004 Hordeum vulgare subsp. vulgare mRNA for putative
            lectin receptor-type protein kinase (lrk1 gene).
          Length = 692

 Score =  248 bits (632), Expect = 2e-64
 Identities = 135/290 (46%), Positives = 185/290 (63%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F +K  LG+GG+G VYKG L     E+AVK  S +S +G+ +F+AE+  I  LRH+
Sbjct: 364  ATEGFSDKNLLGRGGFGSVYKGVLRKSDKEVAVKRLSHDSRQGKKEFIAEVVSIGHLRHQ 423

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFI-GGETDPLSWELRCKIVSGVGYALQYL 359
            ++ +LLG+C R G+ LLVYEYM +GSLD++L    G T  L W  R  I+ GV  +L YL
Sbjct: 424  NIARLLGYCRRKGEFLLVYEYMENGSLDKYLHTRNGPT--LCWSQRYSIIKGVASSLLYL 481

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E+E  V+HRD+K SN++LDS  N  LGDFGLA+    E  +      VAGTIGY+APE
Sbjct: 482  HEEWEHVVIHRDIKPSNVLLDSKMNGWLGDFGLAKIYGRETAA--PATHVAGTIGYLAPE 539

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG+ T  +D+YAFG  LLEV CG++P    +      LV+WV   HRDG IL+ VD 
Sbjct: 540  LARTGRPTPFTDVYAFGMFLLEVTCGRKPIFTDKQNNRLLLVEWVLEHHRDGSILDTVDP 599

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL+ +F +EE   +L LGL C++P+ N RP    V+Q ++ +   P++ P
Sbjct: 600  RLQGEFNMEEVTIVLKLGLICTYPLPNMRPIMRKVMQYLVHNQSPPDLSP 649



>pir|S68589|S68589 serine/threonine-specific kinase lecRK1 (EC
            2.7.1.-) precursor, lectin receptor-like - Arabidopsis
            thaliana>gb:ATRECLKIN_1554042 A.thaliana mRNA for
            receptor-like kinase.>gb:ATT16L24_1554660 Arabidopsis
            thaliana DNA chromosome 3, BAC clone
            T16L24.>gb:AF001168_1760522 Arabidopsis thaliana
            receptor-like kinase LECRK1 (LECRK1) gene, complete cds.
          Length = 661

 Score =  248 bits (632), Expect = 2e-64
 Identities = 133/286 (46%), Positives = 189/286 (66%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LG+GG+G VYKG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 334  ATKGFKEKQLLGKGGFGQVYKGTLPGSDAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 393

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C     L LVY+YMP+GSLD++L      + L+WE R +I+  V  AL +LH
Sbjct: 394  NLVRLLGYCRHKENLYLVYDYMPNGSLDKYLNRSENQERLTWEQRFRIIKDVATALLHLH 453

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+ Q ++HRD+K +N+++D+  NARLGDFGLA+  D  +    E   VAGT GYIAPE 
Sbjct: 454  QEWVQVIIHRDIKPANVLIDNEMNARLGDFGLAKLYD--QGFDPETSKVAGTFGYIAPEF 511

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWVWFLHRDGRILEAVDIR 716
            L TG+AT  +D+YAFG V+LEVVCG+R   R      + LVDW+  L  +G+I +A +  
Sbjct: 512  LRTGRATTSTDVYAFGLVMLEVVCGRRIIERRAAENEEYLVDWILELWENGKIFDAAEES 571

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            ++++    + + +L LG+ CSH  A+ RP  S V++I+ G   +P+
Sbjct: 572  IRQEQNRGQVELVLKLGVLCSHQAASIRPAMSVVMRILNGVSQLPD 617



>gb:AP004014_1836380 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861348 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 673

 Score =  247 bits (631), Expect = 3e-64
 Identities = 131/289 (45%), Positives = 182/289 (62%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F     LG GG+G VYKG L+   ++IAVK  S ES +G  +F+AE+  I RLRH+
Sbjct: 355  ATEGFKNSHLLGTGGFGRVYKGLLSKSNMQIAVKRVSHESRQGIREFVAEIVSIGRLRHR 414

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C R  +L+LVYEYMPHGSLD++L+       L W  R +I+ GV   L YLH
Sbjct: 415  NIVQLLGYCRRKDELILVYEYMPHGSLDKYLYCHSNHPTLDWIQRFRIIKGVASGLLYLH 474

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++E+ V+HRD+KASN++LD+  NARLGDFGLAR  D+     T    + GTIGY+APE 
Sbjct: 475  GDWEKVVIHRDVKASNVLLDAEMNARLGDFGLARLYDHGTDMQT--THLVGTIGYLAPEL 532

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            +  GKA+  +D++AFG  +LEV CG+RP           LVDWV     +G +LE +D +
Sbjct: 533  VRRGKASPLTDVFAFGIFVLEVTCGRRPIEHKMNSDKLLLVDWVMDCWNEGSLLETMDPK 592

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L+ ++  +EA   L LGL CSH     +P    V+Q +   +P P + P
Sbjct: 593  LQNEYDADEACLALKLGLLCSHQSPAAKPSMWHVMQYLNHDLPFPELAP 641



>gb:AP004014_1836375 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861343 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 676

 Score =  247 bits (630), Expect = 4e-64
 Identities = 131/289 (45%), Positives = 184/289 (63%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K  +G GG+G VYKG L    LE+A+K  S ES +G  +F+AE+  I  L+H+
Sbjct: 345  ATKGFKNKNLVGTGGFGRVYKGVLPNSRLEVAIKRVSYESKQGIKEFVAEVVSIGHLQHR 404

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++VKLLG+C R G+LLLVY+YM +GSLD++L        L+W  R +I+  +   L YLH
Sbjct: 405  NVVKLLGYCRRKGELLLVYDYMANGSLDKYLHRQEGKPTLNWGQRFQIIKDIASGLLYLH 464

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+++ V+HRD+KASN++LD   N RLGDFGLAR  D+     T    V GTIGY+APE 
Sbjct: 465  EEWDKVVIHRDVKASNVLLDKQLNGRLGDFGLARLYDHGTDPQT--THVVGTIGYLAPEL 522

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            +  GKAT  +D+++FG  +LEV CGQ+P      G    LVDWV      G +L+ +DI+
Sbjct: 523  VHRGKATTLTDVFSFGIFILEVTCGQKPIKEDSQGRQLILVDWVLQNWHKGSLLDTMDIK 582

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            ++ ++ + EA  +L LGL CSHP  N RP    V+Q + G VP+P + P
Sbjct: 583  IQGNYDIGEACLVLKLGLMCSHPFPNVRPNVRQVMQYLDGDVPLPELKP 631



>gb:AC093018_1735833 Oryza sativa chromosome 3 BAC OSJNBb0081B07
            genomic sequence, complete sequence.
          Length = 701

 Score =  247 bits (630), Expect = 4e-64
 Identities = 136/284 (47%), Positives = 183/284 (64%), Gaps = 2/284 (0%)
 Frame = +3

Query: 18   GEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKHLVKL 197
            G +  +G GG+G VY G L   G+E+AVK  S +S +G  +F++E++ ++RLRH++LV+L
Sbjct: 364  GFRDVIGAGGFGSVYHGVLPRSGVEVAVKKVSHDSRQGLREFVSEIASMSRLRHRNLVQL 423

Query: 198  LGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHNEFEQ 377
            LG+C R G+L+LVY+YM +GSLD+HLF GGE   LSWE R KIV  V   L YLH  +EQ
Sbjct: 424  LGYCRRRGELVLVYDYMANGSLDKHLFAGGERPALSWEKRGKIVRDVAAGLLYLHEGWEQ 483

Query: 378  RVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECLLTGK 557
             VVHRD+KASN++LD++ N +L DFGLAR  D+     T    + GT+GY+APE   TGK
Sbjct: 484  VVVHRDIKASNVLLDADMNGKLSDFGLARLYDHGANPQT--TRIVGTLGYLAPELSKTGK 541

Query: 558  ATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIRLKEDF 731
            AT  +D++AFGA LLEV CG+RP   T       LV+ V    + G I  A D R+  D 
Sbjct: 542  ATTSTDVFAFGAFLLEVACGRRPMEFTVDDDSPGLVELVLEHWKAGEITAARDPRI-GDC 600

Query: 732  VVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
              ++ + +L LGL CSHP    RP    VVQI+ G+ P P   P
Sbjct: 601  DEDDLEVVLKLGLLCSHPDPRRRPSMRQVVQILEGAAPAPETLP 644



>gb:AP004301_1839835 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861341 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 677

 Score =  246 bits (629), Expect = 5e-64
 Identities = 133/294 (45%), Positives = 182/294 (61%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG+G VYKG L    LEIAVK  S +S +G  +F+AE+  I  L+H+
Sbjct: 343  ATEGFKNKNLLGIGGFGRVYKGLLPTSKLEIAVKRISHDSNQGMKEFVAEIVSIGHLQHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L G+C R  +L+LVY+YM +GSLD+HL+       L+W  R +I+  +   L YLH
Sbjct: 403  NLVQLHGYCRRKSELILVYDYMSNGSLDKHLYGQENNSTLTWAQRFQIIKDIASGLLYLH 462

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+E+ ++HRD+K SNI+LD N N RLGDFGLAR  D+     T    V GTIGY+APE 
Sbjct: 463  EEWEKVILHRDIKPSNILLDDNMNGRLGDFGLARLYDHGTDPQT--THVVGTIGYLAPEL 520

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
              T KAT  +D++AFG  +LEV CG++P   T       LVDWV      G + +AVDI+
Sbjct: 521  ARTSKATPLTDVFAFGMFVLEVTCGRKPIDHTAQDNQLMLVDWVLHCWHQGFLNDAVDIK 580

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L+  + ++EA   L LGL C+HP  N+RP    V QI+   + +P + P   +F
Sbjct: 581  LQGVYNIDEACLALKLGLLCAHPFINKRPSMRHVTQILNREMELPELTPTHMSF 634



>gb:AP004014_1836377 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861345 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 647

 Score =  244 bits (624), Expect = 2e-63
 Identities = 132/292 (45%), Positives = 182/292 (62%), Gaps = 5/292 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  +K LG GG+G VYKG L    LE+A+K  S ES +G  +F+AE+  I R+RH+
Sbjct: 322  ATEGFNNEKILGVGGFGKVYKGVLPDSKLEVAIKRVSHESKQGIKEFIAEIVSIGRIRHR 381

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R  +LLLVY+YMP+GSLD++L        L W  R +I+ GV   L YLH
Sbjct: 382  NLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHCKEGKYTLDWAKRFQIIRGVASGLFYLH 441

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++E+ V+HRD+KASN++LD+  N  LGDFGLAR  ++     T    VAGT GYIAPE 
Sbjct: 442  EKWEKVVIHRDIKASNVLLDAEMNGHLGDFGLARLYEHGNDPQT--THVAGTFGYIAPEM 499

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-----LVDWVWFLHRDGRILEAV 707
              TGKA+  +D+YAF   +LEV CG+RP   I  +       LVDWV    + G +   +
Sbjct: 500  ARTGKASPLTDVYAFAIFVLEVTCGRRP---INNYTHDSPTILVDWVVEHWQKGSLTSTL 556

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            D+RL+ D   +E   +L LGL C++PI   RP    V+Q +   +P+P + P
Sbjct: 557  DVRLQGDHNADEVNLVLKLGLLCANPICTRRPGMRQVMQYLDNEMPLPRLMP 608



>gb:AY358030_1601933 Medicago truncatula lectin-like receptor kinase
            1;1 (LecRK1;1) mRNA, complete cds.
          Length = 678

 Score =  244 bits (624), Expect = 2e-63
 Identities = 127/288 (44%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F + + LG+GGYG VYKG L+  G  +AVK    +    +  F+ E+ II+RL H+
Sbjct: 363  ATNGFDDDRMLGRGGYGQVYKGALSYLGKIVAVKRIFADFENSERVFINEVRIISRLIHR 422

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+ +GWCH   +LLLV+EYMP+GSLD HLF  G+   L+WE+R K+  GV  AL+YLH
Sbjct: 423  NLVQFIGWCHEQDELLLVFEYMPNGSLDTHLF--GDKKSLAWEVRYKVALGVANALRYLH 480

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNE-RTSYTEGEGVAGTIGYIAPE 539
            ++ EQ V+HRD+K++N++LD++F+ +LGDFG+A+ +D   RT  T+   V GT GY+APE
Sbjct: 481  DDAEQCVLHRDIKSANVLLDTDFSTKLGDFGMAKLVDPMLRTQRTD---VVGTYGYLAPE 537

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ-SLVDWVWFLHRDGRILEAVDIR 716
             +  G+A+++SD+Y+FG V LE+  G+R   + G F   L++WVW L+ +G ++ A D +
Sbjct: 538  YINGGRASKESDMYSFGIVALELATGRR-FFQDGDFHVPLMNWVWGLYVEGNLMCAADEK 596

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP 860
            L  +F V E K LL++GL C+H    ERP+  +V++++   + +P +P
Sbjct: 597  LNMEFDVSEMKSLLIVGLWCTHSNDKERPKAYEVIKVLQLEMALPELP 644



>gb:AP006172_1861333 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 688

 Score =  243 bits (621), Expect = 4e-63
 Identities = 135/298 (45%), Positives = 185/298 (62%), Gaps = 6/298 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K  LG GG+G VYKG L    +EIAVK  S +S +G  +F+AE+  + RL+H 
Sbjct: 359  ATQGFESKCLLGVGGFGRVYKGVLPNSNVEIAVKRVSHDSSQGVKEFVAEVVSLGRLQHC 418

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+L+LVYEYM +GSLD++L        LSW  R +I+  +   L YLH
Sbjct: 419  NLVRLLGYCRRKGELMLVYEYMSNGSLDKYLHGQDNKPTLSWAQRFQIIKDIASGLLYLH 478

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E ++ V+HRD+KASN++LD+  NARLGDFGLAR  D+      +   V GTIGY+APE 
Sbjct: 479  EECDKVVIHRDIKASNVLLDNEMNARLGDFGLARLYDHGED--PQSTHVVGTIGYLAPEL 536

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP------GTRIGGFQSLVDWVWFLHRDGRILEA 704
              T KAT  +D++AFG  +LEV CG+RP      GT++     LVDWV        +++ 
Sbjct: 537  GRTSKATPLTDVFAFGTFILEVTCGRRPIYHDSHGTQV----MLVDWVLDHWHKQSLVDT 592

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            VD++L  +F V EA  +L LGL CSHP  N RP    V+Q +   V +P + P   +F
Sbjct: 593  VDLKLHGEFDVGEACLVLKLGLLCSHPFINARPDMRRVMQYLKREVALPELMPTSMSF 650



>gb:AP004301_1839826 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0483E09.
          Length = 713

 Score =  243 bits (621), Expect = 4e-63
 Identities = 135/298 (45%), Positives = 185/298 (62%), Gaps = 6/298 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K  LG GG+G VYKG L    +EIAVK  S +S +G  +F+AE+  + RL+H 
Sbjct: 384  ATQGFESKCLLGVGGFGRVYKGVLPNSNVEIAVKRVSHDSSQGVKEFVAEVVSLGRLQHC 443

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+L+LVYEYM +GSLD++L        LSW  R +I+  +   L YLH
Sbjct: 444  NLVRLLGYCRRKGELMLVYEYMSNGSLDKYLHGQDNKPTLSWAQRFQIIKDIASGLLYLH 503

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E ++ V+HRD+KASN++LD+  NARLGDFGLAR  D+      +   V GTIGY+APE 
Sbjct: 504  EECDKVVIHRDIKASNVLLDNEMNARLGDFGLARLYDHGED--PQSTHVVGTIGYLAPEL 561

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP------GTRIGGFQSLVDWVWFLHRDGRILEA 704
              T KAT  +D++AFG  +LEV CG+RP      GT++     LVDWV        +++ 
Sbjct: 562  GRTSKATPLTDVFAFGTFILEVTCGRRPIYHDSHGTQV----MLVDWVLDHWHKQSLVDT 617

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            VD++L  +F V EA  +L LGL CSHP  N RP    V+Q +   V +P + P   +F
Sbjct: 618  VDLKLHGEFDVGEACLVLKLGLLCSHPFINARPDMRRVMQYLKREVALPELMPTSMSF 675



>gb:AP004014_1836376 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861344 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 621

 Score =  243 bits (621), Expect = 4e-63
 Identities = 135/289 (46%), Positives = 182/289 (62%), Gaps = 2/289 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F     LG GG+G VYKG L+    +IAVK  S ES +G  +F+AE+  I RLRH+
Sbjct: 303  ATEGFKNSHLLGTGGFGRVYKGLLSKSKSQIAVKRVSHESRQGIREFVAEVVSIGRLRHR 362

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+LLG+C R G+LLLVY+YMP+GSLD +L+       L W  R +I+ GV   L YLH
Sbjct: 363  NIVQLLGYCRRKGELLLVYDYMPNGSLDNYLYGHSNRPILDWIQRFRIIKGVASGLWYLH 422

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD   NA LGDFGLAR  D+     T    + GTIGY+APE 
Sbjct: 423  GEWEQVVIHRDIKASNVLLDEEMNACLGDFGLARLYDHGTDMQT--TRLVGTIGYLAPEL 480

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP-GTRIGGFQ-SLVDWVWFLHRDGRILEAVDIR 716
            L  GKA+  +D++AFG  +LEV CG+RP   ++   Q  LVDWV     +  +LEA+D +
Sbjct: 481  LQNGKASPLTDVFAFGIFVLEVTCGRRPIEHKMNSDQLKLVDWVIDCWNERSLLEAMDPK 540

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            L+ ++  +EA   L LGL CSH     RP    V+Q +   +P P + P
Sbjct: 541  LQNEYDADEAFLALKLGLLCSHQSPAARPSMWHVMQYLNHDLPFPELAP 589



>pir|T47799|T47799 receptor lectin kinase-like protein - Arabidopsis
            thaliana>gb:ATF24G16_1549842 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F24G16.
          Length = 626

 Score =  243 bits (621), Expect = 4e-63
 Identities = 131/286 (45%), Positives = 184/286 (64%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F EK+ LG+GG+G V+KG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 299  ATKDFKEKQLLGKGGFGQVFKGTLPGSNAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 358

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C     L LVY++ P+GSLD++L      + L+WE R KI+  V  AL +LH
Sbjct: 359  NLVRLLGYCRHKENLYLVYDFTPNGSLDKYLDRNENQERLTWEQRFKIIKDVASALLHLH 418

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+ Q ++HRD+K +N+++D   NAR+GDFGLA+  D      T    VAGT GYIAPE 
Sbjct: 419  QEWVQIIIHRDIKPANVLIDHEMNARIGDFGLAKLYDQGLDPQT--SRVAGTFGYIAPEL 476

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG--GFQSLVDWVWFLHRDGRILEAVDIR 716
            L TG+AT  +D+YAFG V+LEVVCG+R   R      + LVDW+  L   G++ +A +  
Sbjct: 477  LRTGRATTSTDVYAFGLVMLEVVCGRRMIERRAPENEEVLVDWILELWESGKLFDAAEES 536

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            ++++    E + LL LGL C+H     RP  S V+QI+ G   +P+
Sbjct: 537  IRQEQNRGEIELLLKLGLLCAHHTELIRPNMSAVMQILNGVSQLPD 582



>pir|T01308|T01308 probable serine/threonine-specific protein kinase
            T14P8.4  (EC 2.7.1.-) - Arabidopsis
            thaliana>gb:ATCHRIV6_1546230 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 6.>gb:T14P8_1723441
            Arabidopsis thaliana BAC T14P8.
          Length = 669

 Score =  243 bits (621), Expect = 4e-63
 Identities = 131/290 (45%), Positives = 186/290 (64%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VYKG +     EIAVK  S ES +G  +F+AE+  I ++ H+
Sbjct: 346  ATKGFKDKNILGSGGFGSVYKGIMPKTKKEIAVKRVSNESRQGLKEFVAEIVSIGQMSHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L+G+C R  +LLLVY+YMP+GSLD++L+   E   L W+ R K+++GV  AL YLH
Sbjct: 406  NLVPLVGYCRRRDELLLVYDYMPNGSLDKYLYNSPEV-TLDWKQRFKVINGVASALFYLH 464

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD+  N RLGDFGLA+  D+     T    V GT GY+AP+ 
Sbjct: 465  EEWEQVVIHRDVKASNVLLDAELNGRLGDFGLAQLCDHGSDPQT--TRVVGTWGYLAPDH 522

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            + TG+AT  +D++AFG +LLEV CG+RP     + G    LVDWV+    +  IL+A D 
Sbjct: 523  IRTGRATTTTDVFAFGVLLLEVACGRRPIEINNQSGERVVLVDWVFRFWMEANILDAKDP 582

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
             L  ++  +E + +L LGL CSH     RP    V+Q + G   +P++ P
Sbjct: 583  NLGSEYDQKEVEMVLKLGLLCSHSDPLARPTMRQVLQYLRGDAMLPDLSP 632



>gb:AB016890_1513216 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MNC17.
          Length = 674

 Score =  243 bits (620), Expect = 5e-63
 Identities = 137/287 (47%), Positives = 183/287 (63%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F E + LG GG+G VYKG L   G +IAVK    ++ +G   ++AE++ + RLRHK
Sbjct: 351  ATKGFRENQLLGAGGFGKVYKGILPS-GTQIAVKRVYHDAEQGMKQYVAEIASMGRLRHK 409

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLVY+YMP+GSLD +LF   +   L+W  R  I+ GV  AL YLH
Sbjct: 410  NLVHLLGYCRRKGELLLVYDYMPNGSLDDYLFHKNKLKDLTWSQRVNIIKGVASALLYLH 469

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASNI+LD++ N +LGDFGLAR   ++R    E   V GTIGY+APE 
Sbjct: 470  EEWEQVVLHRDIKASNILLDADLNGKLGDFGLARF--HDRGVNLEATRVVGTIGYMAPEL 527

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
               G  T  +D+YAFGA +LEVVCG+RP       +   LV WV    +   + + VD +
Sbjct: 528  TAMGVTTTCTDVYAFGAFILEVVCGRRPVDPDAPREQVILVKWVASCGKRDALTDTVDSK 587

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L  DF VEEAK LL LG+ CS      RP    ++Q + G+V VP +
Sbjct: 588  L-IDFKVEEAKLLLKLGMLCSQINPENRPSMRQILQYLEGNVSVPAI 633



>gb:ATF24G16_1549841 Arabidopsis thaliana DNA chromosome 3, BAC clone
            F24G16.
          Length = 629

 Score =  243 bits (619), Expect = 7e-63
 Identities = 136/289 (47%), Positives = 183/289 (63%), Gaps = 5/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LG+GG+G VYKG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 329  ATKGFKEKQLLGKGGFGQVYKGMLPGSDAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 388

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---IGGETDPLSWELRCKIVSGVGYALQ 353
            +LV+LLG+C     L LVY++MP+GSLD+ L         + L+WE R KI+  V  AL 
Sbjct: 389  NLVRLLGYCKHKENLYLVYDFMPNGSLDRCLTRSNTNENQERLTWEQRFKIIKDVATALL 448

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            +LH E+ Q +VHRD+K +N++LD   NARLGDFGLA+  D      T    VAGT+GYIA
Sbjct: 449  HLHQEWVQVIVHRDIKPANVLLDHGMNARLGDFGLAKLYDQGFDPQT--SRVAGTLGYIA 506

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAV 707
            PE L TG+AT  +D+YAFG V+LEVVCG+R   R        LVDW+  L   G++ +A 
Sbjct: 507  PELLRTGRATTSTDVYAFGLVMLEVVCGRRLIERRAAENEAVLVDWILELWESGKLFDAA 566

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            +  ++++    E + +L LGL C+H     RP  S V+QI+ G   +PN
Sbjct: 567  EESIRQEQNRGEIELVLKLGLLCAHHTELIRPNMSAVLQILNGVSHLPN 615



>pir|T49315|T49315 receptor lectin kinase 3 - Arabidopsis
            thaliana>gb:ATT16L24_1554664 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T16L24.
          Length = 573

 Score =  243 bits (619), Expect = 7e-63
 Identities = 136/289 (47%), Positives = 183/289 (63%), Gaps = 5/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LG+GG+G VYKG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 243  ATKGFKEKQLLGKGGFGQVYKGMLPGSDAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 302

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---IGGETDPLSWELRCKIVSGVGYALQ 353
            +LV+LLG+C     L LVY++MP+GSLD+ L         + L+WE R KI+  V  AL 
Sbjct: 303  NLVRLLGYCKHKENLYLVYDFMPNGSLDRCLTRSNTNENQERLTWEQRFKIIKDVATALL 362

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            +LH E+ Q +VHRD+K +N++LD   NARLGDFGLA+  D      T    VAGT+GYIA
Sbjct: 363  HLHQEWVQVIVHRDIKPANVLLDHGMNARLGDFGLAKLYDQGFDPQT--SRVAGTLGYIA 420

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAV 707
            PE L TG+AT  +D+YAFG V+LEVVCG+R   R        LVDW+  L   G++ +A 
Sbjct: 421  PELLRTGRATTSTDVYAFGLVMLEVVCGRRLIERRAAENEAVLVDWILELWESGKLFDAA 480

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            +  ++++    E + +L LGL C+H     RP  S V+QI+ G   +PN
Sbjct: 481  EESIRQEQNRGEIELVLKLGLLCAHHTELIRPNMSAVLQILNGVSHLPN 529



>pir|T47798|T47798 receptor lectin kinase 3 - Arabidopsis thaliana
            (fragment)
          Length = 629

 Score =  243 bits (619), Expect = 7e-63
 Identities = 136/289 (47%), Positives = 183/289 (63%), Gaps = 5/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LG+GG+G VYKG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 329  ATKGFKEKQLLGKGGFGQVYKGMLPGSDAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 388

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---IGGETDPLSWELRCKIVSGVGYALQ 353
            +LV+LLG+C     L LVY++MP+GSLD+ L         + L+WE R KI+  V  AL 
Sbjct: 389  NLVRLLGYCKHKENLYLVYDFMPNGSLDRCLTRSNTNENQERLTWEQRFKIIKDVATALL 448

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            +LH E+ Q +VHRD+K +N++LD   NARLGDFGLA+  D      T    VAGT+GYIA
Sbjct: 449  HLHQEWVQVIVHRDIKPANVLLDHGMNARLGDFGLAKLYDQGFDPQT--SRVAGTLGYIA 506

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAV 707
            PE L TG+AT  +D+YAFG V+LEVVCG+R   R        LVDW+  L   G++ +A 
Sbjct: 507  PELLRTGRATTSTDVYAFGLVMLEVVCGRRLIERRAAENEAVLVDWILELWESGKLFDAA 566

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            +  ++++    E + +L LGL C+H     RP  S V+QI+ G   +PN
Sbjct: 567  EESIRQEQNRGEIELVLKLGLLCAHHTELIRPNMSAVLQILNGVSHLPN 615



>gb:ATU93161_1557393 Arabidopsis thaliana AthlecRK4 pseudogene,
            complete sequence, receptor lectin kinase 3 (AthlecRK3)
            gene, complete cds, and AthlecRK2 pseudogene, complete
            sequence.
          Length = 659

 Score =  242 bits (618), Expect = 9e-63
 Identities = 136/289 (47%), Positives = 183/289 (63%), Gaps = 5/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F EK+ LG+GG+G VYKG L G   EIAVK  S +S +G  +FLAE+S I RLRH 
Sbjct: 329  ATKGFKEKQLLGKGGFGQVYKGMLPGSDAEIAVKRTSHDSRQGMSEFLAEISTIGRLRHP 388

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---IGGETDPLSWELRCKIVSGVGYALQ 353
            +LV+LLG+C     L LVY++MP+GSLD+ L         + L+WE R KI+  V  AL 
Sbjct: 389  NLVRLLGYCKHKENLYLVYDFMPNGSLDRCLTRSNTNENQERLTWEQRFKIIKDVATALL 448

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            +LH E+ Q +VHRD+K +N++LD   NARLGDFGLA+  D      T    VAGT+GYIA
Sbjct: 449  HLHQEWVQVIVHRDIKPANVLLDHGMNARLGDFGLAKLYDQGFDPQT--SRVAGTLGYIA 506

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAV 707
            PE L TG+AT  +D+YAFG V+LEVVCG+R   R        LVDW+  L   G++ +A 
Sbjct: 507  PELLRTGRATTSTDVYAFGLVMLEVVCGRRLIERRAAENEAVLVDWILELWESGKLFDAA 566

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            +  ++++    E + +L LGL C+H     RP  S V+QI+ G   +PN
Sbjct: 567  EGSIRQEQNRGEIELVLKLGLLCAHHTELIRPNMSAVLQILNGVSHLPN 615



>gb:AP003758_1833016 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1562_B11.
          Length = 697

 Score =  241 bits (615), Expect = 2e-62
 Identities = 140/294 (47%), Positives = 185/294 (62%), Gaps = 7/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F ++  LG GG+G VY+G L    LEIAVK  S +S +G  +F+AE+  I RLRH+
Sbjct: 364  ATDGFKDRNLLGVGGFGRVYRGVLPESNLEIAVKRVSHDSRQGIREFVAEVVSIGRLRHR 423

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R  +LLLVY+YM +GSLD++L     T  L W  R  I+ GV   L YLH
Sbjct: 424  NLVQLLGYCRRKNELLLVYDYMANGSLDKYLHERNVT-TLFWPERLWIIKGVASGLLYLH 482

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++EQ V+HRD+KASN++LDS  N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 483  EDWEQVVIHRDIKASNVLLDSAMNGRLGDFGLARLYDHGTDPKT--THVVGTMGYLAPEL 540

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP------GTRIGGFQSLVDWVWFLHRDGRILEA 704
            + TGKA+  +D++AFG  LLEV CG+RP        R+     LVD V   HR+G I+ A
Sbjct: 541  VRTGKASPLTDVFAFGVFLLEVTCGRRPIETDEHNKRV----VLVDLVLEHHRNGSIVGA 596

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII-LGSVPVPNVPP 863
             D RL   F VEE   +L LGL CSHP+   RP   +V+Q +  G    P++ P
Sbjct: 597  ADPRLTGKFDVEEVALVLKLGLLCSHPLPGARPSMRNVMQYLERGGKSAPDLSP 650



>pir|A96724|A96724 hypothetical protein F20P5.15 [imported] -
            Arabidopsis thaliana>gb:AE005173_894595 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:F20P5_1677769 Sequence of BAC F20P5 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 656

 Score =  241 bits (615), Expect = 2e-62
 Identities = 129/286 (45%), Positives = 178/286 (62%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F   + LG+GG+G V+KG L    + IAVK  S +S +G  +FLAE++ I RLRH 
Sbjct: 330  ATKGFKNSEVLGKGGFGKVFKGILPLSSIPIAVKKISHDSRQGMREFLAEIATIGRLRHP 389

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
             LV+LLG+C R G+L LVY++MP GSLD+ L+       L W  R  I+  V   L YLH
Sbjct: 390  DLVRLLGYCRRKGELYLVYDFMPKGSLDKFLY-NQPNQILDWSQRFNIIKDVASGLCYLH 448

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++ Q ++HRD+K +NI+LD N NA+LGDFGLA+  D+   S T    VAGT GYI+PE 
Sbjct: 449  QQWVQVIIHRDIKPANILLDENMNAKLGDFGLAKLCDHGIDSQT--SNVAGTFGYISPEL 506

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLV--DWVWFLHRDGRILEAVDIR 716
              TGK++  SD++AFG  +LE+ CG+RP    G    +V  DWV      G IL+ VD +
Sbjct: 507  SRTGKSSTSSDVFAFGVFMLEITCGRRPIGPRGSPSEMVLTDWVLDCWDSGDILQVVDEK 566

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            L   ++ E+   +L LGL CSHP+A  RP  S V+Q + G   +P+
Sbjct: 567  LGHRYLAEQVTLVLKLGLLCSHPVAATRPSMSSVIQFLDGVATLPH 612



>gb:AF487461_1804285 Gossypium hirsutum receptor kinase Lecrk mRNA,
            complete cds.
          Length = 641

 Score =  241 bits (614), Expect = 3e-62
 Identities = 131/269 (48%), Positives = 175/269 (65%), Gaps = 2/269 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K+ LG GG+G VY+G L    LE+AVK  S ES +G  +F+AE+  I RLRH+
Sbjct: 340  ATKGFKDKELLGAGGFGRVYRGVLPSNKLEVAVKRVSHESRQGMREFVAEIVSIGRLRHR 399

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R  +LLLVY+YMP+GSLD++L    +   L+W  R +++ GV   L YLH
Sbjct: 400  NLVQLLGYCRRKDELLLVYDYMPNGSLDKYLHDQPKV-TLNWRQRFRVIKGVASGLFYLH 458

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E++Q VVHR++KASN++LD   N RLGDFGLAR  D+     T    V GT+GY+APE 
Sbjct: 459  GEWDQVVVHRNVKASNVLLDGELNGRLGDFGLARLYDHGTDPQT--THVVGTLGYLAPEH 516

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
              TGKAT  +D++AFGA LLEV CG+RP       +   LVDWV+    +G I+EA D  
Sbjct: 517  TRTGKATPSTDVFAFGAFLLEVACGRRPIEAKSPTEDVILVDWVYSCWSNGDIMEAKDPN 576

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERP 803
            L   +  EE + +L LGL CSH     RP
Sbjct: 577  LGSGYEAEEVELVLKLGLLCSHSEPEARP 605



>gb:AP005518_1853323 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0046H10.
          Length = 722

 Score =  240 bits (613), Expect = 4e-62
 Identities = 136/303 (44%), Positives = 182/303 (60%), Gaps = 10/303 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKW--FSRESIKGQGDFLAELSIINRLR 176
            AT  F  K+ LG GG+G VY+G L   G E+AVK    S ++ +G   F+AE++ + RLR
Sbjct: 368  ATRGFDGKRLLGVGGFGRVYRGVLPASGTEVAVKVVSLSHDAEQGMRQFVAEVASVGRLR 427

Query: 177  HKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQY 356
            H+++V LLG+C R G+LLLVY+YMP+GSLD+ L  G    PL W  R + + GV   L Y
Sbjct: 428  HRNVVPLLGYCRRRGELLLVYDYMPNGSLDRWLH-GQSAPPLGWAQRVRAIRGVAAGLLY 486

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH  +EQ VVHRD+KASN++LD   +ARLGDFGLAR L     +      V GT+GY+AP
Sbjct: 487  LHEGWEQVVVHRDVKASNVLLDGEMDARLGDFGLAR-LYGRGAADPRTTRVVGTLGYLAP 545

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG--------GFQSLVDWVWFLHRDGR 692
            E   T + T  +D++AFG+ +LEV CG+RP    G        G   L DWV      G 
Sbjct: 546  ELAHTRRVTPATDVFAFGSFVLEVACGRRPIEHGGATGDDGDDGEFVLADWVLDRWHKGD 605

Query: 693  ILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            I  A D RL+ D+  EEA  +L LGL C+HP    RP    VVQ++ G  P+P + P   
Sbjct: 606  IAGAADARLRGDYDHEEAALVLKLGLLCTHPAPAARPPMRLVVQVLDGDAPLPELAPTYR 665

Query: 873  AFV 881
            +F+
Sbjct: 666  SFI 668



>gb:AP005091_1847649 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1104_G11.>gb:AP005704_1856369 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0448B03.
          Length = 434

 Score =  240 bits (613), Expect = 4e-62
 Identities = 135/285 (47%), Positives = 190/285 (66%), Gaps = 9/285 (3%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESI-KGQGDFLAELSIINRLRH 179
           AT +F E++KLG+GG+G VY+G LAG G+E+A+K FS +S  +G+  F AE+ II+ LRH
Sbjct: 95  ATRDFAEEEKLGRGGFGSVYQGRLAG-GVEVAIKKFSSDSSSQGRKQFEAEVKIISSLRH 153

Query: 180 KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
           ++LV+LLGWC     LLLVYE + HGSLD+H++      PL+W  R KI+ G+G AL+YL
Sbjct: 154 RNLVRLLGWCDSSMGLLLVYELVQHGSLDKHIY--NADKPLTWSERYKIILGLGSALRYL 211

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H E+EQ VVH D+K SNIMLDS++N +LGDFGLAR +D+++  +   + V GT GYI PE
Sbjct: 212 HEEWEQCVVHGDIKPSNIMLDSSYNTKLGDFGLARLVDHDK-GWQTTKAVLGTAGYIDPE 270

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ--SLVDWVWFLHRDGRILEAVDI 713
            + T + + QSDIY+FG VLLE+V G+ P     G     L+ WVW L+    IL+A D 
Sbjct: 271 FITTRRPSVQSDIYSFGIVLLEIVSGRPPVLLQEGAPPFMLLKWVWSLYGRNAILDAADE 330

Query: 714 RL------KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
           RL      KED    + +R+L++GL C+ P   +RP     + ++
Sbjct: 331 RLWAAGGGKED-DARQMERVLIVGLWCTQPDMADRPSIPQAMHVL 374



>gb:AP003742_1832719 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1118_D07.
          Length = 679

 Score =  240 bits (613), Expect = 4e-62
 Identities = 137/295 (46%), Positives = 187/295 (63%), Gaps = 8/295 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  K  LG+GG+G VY G L+  G+ IAVK  S ES  G   F AE+ I+ RLRH+
Sbjct: 359  ATDGF--KHLLGKGGFGRVYGGVLSASGMPIAVKRVSSESRHGMTQFTAEIIILGRLRHR 416

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---IGGETDPLSWELRCKIVSGVGYALQ 353
            +LV+LLG+C    +LLLVYE+MP+GSLD++L           L W  R  ++  V   L 
Sbjct: 417  NLVRLLGYCRHKEELLLVYEHMPNGSLDKYLHEHTYSSNCRTLGWPQRLHVIKCVAAGLL 476

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH+++EQ +VHRD+KASN++LD++ N RLGDFGLAR  D+   ++T    VAGT GY+A
Sbjct: 477  YLHDDWEQVIVHRDVKASNVLLDADMNGRLGDFGLARLHDHGADAHT--THVAGTRGYLA 534

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWV---WFLHRDGRIL 698
            PE    GKAT+ +D++AFGA +LEV CG+RP      G    LV+WV   W     G ++
Sbjct: 535  PELTRFGKATKATDVFAFGAFVLEVACGRRPMGHNARGELLVLVEWVRDAWAAGGGGSVV 594

Query: 699  EAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            + +D RL E++  EEA+ +L LGL CSHP+   RP    V+Q + G VP+P   P
Sbjct: 595  DTMDPRL-EEYSGEEAELVLKLGLLCSHPLPAARPGMRLVMQYLDGDVPLPEFSP 648



>pir|H96723|H96723 hypothetical protein F20P5.16 [imported] -
            Arabidopsis thaliana>gb:AE005173_894594 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:F20P5_1677770 Sequence of BAC F20P5 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 666

 Score =  239 bits (610), Expect = 8e-62
 Identities = 125/286 (43%), Positives = 186/286 (65%), Gaps = 2/286 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F + + LG+GG+G VYKG L    +EIAVK  S +S +G  +F+AE++ I RLRH 
Sbjct: 340  ATKGFKDTEVLGKGGFGKVYKGTLPVSNVEIAVKMVSHDSRQGMREFIAEIATIGRLRHP 399

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L G+C   G+L LVY+ M  GSLD+ L+   +T  L W  R KI+  V   L YLH
Sbjct: 400  NLVRLQGYCRHKGELYLVYDCMAKGSLDKFLY-HQQTGNLDWSQRFKIIKDVASGLYYLH 458

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++ Q ++HRD+K +NI+LD+N NA+LGDFGLA+  D+     T    VAGT+GYI+PE 
Sbjct: 459  QQWVQVIIHRDIKPANILLDANMNAKLGDFGLAKLCDHGTDPQT--SHVAGTLGYISPEL 516

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLV--DWVWFLHRDGRILEAVDIR 716
              TGKA+ +SD++AFG V+LE+ CG++P       + +V  DWV     +  I++ +D +
Sbjct: 517  SRTGKASTRSDVFAFGIVMLEIACGRKPILPRASQREMVLTDWVLECWENEDIMQVLDHK 576

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            + +++V E+A  +L LGL CSHP+A  RP  S V+Q++     +P+
Sbjct: 577  IGQEYVEEQAALVLKLGLFCSHPVAAIRPNMSSVIQLLDSVAQLPH 622



>pir|T08960|T08960 serine/threonine-specific protein kinase (EC
            2.7.1.-) F19B15.80 - Arabidopsis
            thaliana>gb:ATCHRIV70_1546826 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 70.>gb:ATF19B15_1549278
            Arabidopsis thaliana DNA chromosome 4, BAC clone F19B15
            (ESSA project).
          Length = 669

 Score =  238 bits (608), Expect = 1e-61
 Identities = 130/289 (44%), Positives = 184/289 (63%), Gaps = 5/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F   + LG+GG+G VYKG L+   ++IAVK  S +S +G  +F+AE++ I RLRH 
Sbjct: 340  ATKGFRNSELLGKGGFGKVYKGTLSTSNMDIAVKKVSHDSRQGMREFVAEIATIGRLRHP 399

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C R G+L LVY+ MP GSLD+ L+   E   L W  R KI+  V   L YLH
Sbjct: 400  NLVRLLGYCRRKGELYLVYDCMPKGSLDKFLYHQPE-QSLDWSQRFKIIKDVASGLCYLH 458

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +++ Q ++HRD+K +N++LD + N +LGDFGLA+  ++     T    VAGT GYI+PE 
Sbjct: 459  HQWVQVIIHRDIKPANVLLDDSMNGKLGDFGLAKLCEHGFDPQT--SNVAGTFGYISPEL 516

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
              TGKA+  SD++AFG ++LE+ CG+RP        S   L DWV     D  IL+ VD 
Sbjct: 517  SRTGKASTSSDVFAFGILMLEITCGRRPVLPRASSPSEMVLTDWVLDCWEDD-ILQVVDE 575

Query: 714  RLKED--FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            R+K+D  ++ E+   +L LGL CSHP+A  RP  S V+Q + G   +PN
Sbjct: 576  RVKQDDKYLEEQVALVLKLGLFCSHPVAAVRPSMSSVIQFLDGVAQLPN 624



>gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:B1080A02.
          Length = 652

 Score =  238 bits (606), Expect = 2e-61
 Identities = 131/301 (43%), Positives = 184/301 (61%), Gaps = 7/301 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F     +G GG+G VYK      G+  AVK  S++S     +F AEL+II  L+H 
Sbjct: 323  ATKGFDPSLVVGSGGFGTVYKAVCPCSGVTYAVKR-SKQSRDSYNEFNAELTIIADLKHP 381

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD---PLSWELRCKIVSGVGYALQ 353
            +LV L GWC    +LLLVYE+M +GSLD  L    E +   PLSW  R  +  G+  A+ 
Sbjct: 382  NLVHLQGWCAEKDELLLVYEFMSNGSLDMALHPCSEAECHVPLSWAQRYNVAVGIACAVA 441

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH E +++V+HRD+K SNI+LDS+FN RLGDFGLAR  D   +        AGT+GY+A
Sbjct: 442  YLHEEHDKQVIHRDIKCSNILLDSHFNPRLGDFGLARLKDPNTS--PRSTLAAGTVGYLA 499

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG----GFQSLVDWVWFLHRDGRILE 701
            PE L  GKATE+SD+Y++G VLLE+  G+RP            ++VDWVW LH  G++L+
Sbjct: 500  PEYLQMGKATEKSDVYSYGVVLLEICTGRRPIESAAPDSMNMVNVVDWVWNLHSKGKVLD 559

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            AVD  L  ++   +  R LL+GL+C +P + ERP    V+ ++ G+  + +VP  +P  V
Sbjct: 560  AVDPTLNGEYDAGQMMRFLLVGLSCVNPFSEERPVMRTVLDMLEGNSGLLSVPRKKPLLV 619

Query: 882  W 884
            +
Sbjct: 620  F 620



>gb:AP004014_1836385 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1606_D04.
          Length = 669

 Score =  238 bits (606), Expect = 2e-61
 Identities = 130/287 (45%), Positives = 180/287 (62%), Gaps = 3/287 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F +K  LG GG+G VYKG L     E+AVK  S ES +G  +F+AE+  I RLRHK
Sbjct: 348  ATEGFKDKHLLGIGGFGRVYKGVLTKSKSEVAVKRVSHESRQGMREFIAEVVSIGRLRHK 407

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+L G+C R G+LLLVY++MP+GSLD++L        L W  R  I+ GV   L YLH
Sbjct: 408  NIVQLHGYCRRKGELLLVYDHMPNGSLDKYLHNHDNQQNLDWSQRFHIIKGVASGLLYLH 467

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             ++E+ VVHRD+KASN+++D+  N RLGDFGLAR  D+     T    V GT+GYIAPE 
Sbjct: 468  EDWEKVVVHRDIKASNVLVDAEMNGRLGDFGLARLYDHGSDPQT--THVVGTMGYIAPEL 525

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ---SLVDWVWFLHRDGRILEAVDI 713
               G+A+  +D++AFG  LLEV CG+RP  +         LVD V    R+  +++ VD 
Sbjct: 526  ARMGRASVLTDVFAFGMFLLEVTCGRRPIMQSEEQDCPIMLVDLVLLHWRNESLIDVVDK 585

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
            RL+ ++ ++EA   L LGL CSH + + RP    V+Q + G +  P+
Sbjct: 586  RLQNEYNIDEACLALKLGLLCSHSLPSARPNMRQVMQFLDGDISFPD 632



>gb:AP004301_1839823 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0483E09.>gb:AP006172_1861330 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 657

 Score =  236 bits (602), Expect = 7e-61
 Identities = 129/285 (45%), Positives = 175/285 (61%), Gaps = 2/285 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F  K  LG GG G VYKG L G   EIAVK   + S +    F+AE+  I  L H+
Sbjct: 346  ATEGFQNKNLLGTGGAGRVYKGMLLGSKQEIAVKKIPQNSKESMKQFVAEIVSIGCLDHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+  R G+L+LVYEYM +GSL+++L+       L W  R  I+ G+   L YLH
Sbjct: 406  NLVHLLGYSRRKGELILVYEYMSNGSLEKYLYGQDGRCTLDWGQRFHIIKGIASGLLYLH 465

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+E+ V+HRD+K SNI+LD+  NA++GDFGL+R  D+     T    V GTIGY+APE 
Sbjct: 466  EEWEKVVIHRDVKPSNILLDNKMNAKIGDFGLSRLHDHGANPQT--THVVGTIGYLAPEI 523

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             LTGK T  +D+++FG + LE+ CGQ+P      G  Q+LV WV    + G +++AVD  
Sbjct: 524  ALTGKVTPLADVFSFGILALEITCGQKPMKQNAQGIQQTLVGWVLECWKKGSVVDAVDAN 583

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVP 851
            L+ D+   EA  +L LGL CSHP  + RP    V Q + G +P+P
Sbjct: 584  LQADYDNAEAGLVLKLGLLCSHPSEHSRPNMRQVTQYLNGDMPLP 628



>gb:AP004014_1836378 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1606_D04.>gb:AP006172_1861346 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0088O14.
          Length = 636

 Score =  235 bits (600), Expect = 1e-60
 Identities = 126/287 (43%), Positives = 178/287 (62%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F     +G GG+G VY+G L    L++AVK  S  S +G  +F+AE+  I  L+H+
Sbjct: 347  ATRGFKNNNLVGIGGFGKVYRGVLPISKLQVAVKRVSYGSKQGIKEFIAEVVSIGNLQHR 406

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V+L G+C R  +LLLVY+YM + SLD+HL+       L+W  R KI+  +   L YLH
Sbjct: 407  NIVQLFGYCRRKNELLLVYDYMENESLDKHLYNFHGQPTLNWSQRFKIIKDIASGLLYLH 466

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+++ V+HRD+KASN+++D   NARLGDFGL+R  D+    +T    V GTIGY+APE 
Sbjct: 467  EEWDKVVIHRDVKASNVLIDKEMNARLGDFGLSRLCDHGSNLHT--TNVIGTIGYLAPEL 524

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            + TGKAT  SD++ FG  LLEV CGQ+P      G    LVDWV      G +L+ +D R
Sbjct: 525  VHTGKATTLSDVFGFGIFLLEVSCGQKPIRQNSEGKHLILVDWVVENWHKGSLLDTMDRR 584

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ ++ ++EA   L LGL CSHP +N RP    V+Q + G   +P +
Sbjct: 585  LQGNYNIDEAYLALKLGLLCSHPFSNARPNMRQVLQYLDGDAQLPEL 631



>pir|T01309|T01309 probable serine/threonine-specific protein kinase
            T14P8.3  (EC 2.7.1.-) - Arabidopsis
            thaliana>gb:ATCHRIV6_1546229 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 6.>gb:AY094440_1575739
            Arabidopsis thaliana AT4g02410/T14P8_3 mRNA, complete
            cds.>gb:AY094476_1575770 Arabidopsis thaliana
            AT4g02410/T14P8_3 mRNA, complete cds.>gb:T14P8_1723442
            Arabidopsis thaliana BAC T14P8.
          Length = 674

 Score =  235 bits (600), Expect = 1e-60
 Identities = 132/290 (45%), Positives = 183/290 (63%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K  LG GG+G VY+G +     EIAVK  S ES +G  +F+AE+  I R+ H+
Sbjct: 351  ATKGFKDKDLLGSGGFGRVYRGVMPTTKKEIAVKRVSNESRQGLKEFVAEIVSIGRMSHR 410

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R  +LLLVY+YMP+GSLD++L+   E   L W+ R  ++ GV   L YLH
Sbjct: 411  NLVPLLGYCRRRDELLLVYDYMPNGSLDKYLYDCPEV-TLDWKQRFNVIIGVASGLFYLH 469

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E+EQ V+HRD+KASN++LD+ +N RLGDFGLAR  D+     T    V GT GY+AP+ 
Sbjct: 470  EEWEQVVIHRDIKASNVLLDAEYNGRLGDFGLARLCDHGSDPQT--TRVVGTWGYLAPDH 527

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP-GTRIGGFQS--LVDWVWFLHRDGRILEAVDI 713
            + TG+AT  +D++AFG +LLEV CG+RP    I   +S  LVD V+    +G IL+A D 
Sbjct: 528  VRTGRATTATDVFAFGVLLLEVACGRRPIEIEIESDESVLLVDSVFGFWIEGNILDATDP 587

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
             L   +   E + +L LGL CSH     RP    V+Q + G   +P++ P
Sbjct: 588  NLGSVYDQREVETVLKLGLLCSHSDPQVRPTMRQVLQYLRGDATLPDLSP 637



>pir|B86289|B86289 probable serine/threonine-specific protein kinase -
            Arabidopsis thaliana>gb:AE005172_890542 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC013453_1537937 Arabidopsis thaliana
            chromosome I BAC T16N11 genomic sequence, complete
            sequence.
          Length = 656

 Score =  235 bits (600), Expect = 1e-60
 Identities = 126/281 (44%), Positives = 183/281 (65%), Gaps = 2/281 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F   + LG GG+G VY+G L+    EIAVK  + +S +G  +F+AE+S + RL+HK
Sbjct: 357  ATEVFSNDRLLGSGGFGKVYRGILSNNS-EIAVKCVNHDSKQGLREFMAEISSMGRLQHK 415

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++ GWC R  +L+LVY+YMP+GSL+Q +F     +P+ W  R ++++ V   L YLH
Sbjct: 416  NLVQMRGWCRRKNELMLVYDYMPNGSLNQWIF-DNPKEPMPWRRRRQVINDVAEGLNYLH 474

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            + ++Q V+HRD+K+SNI+LDS    RLGDFGLA+  ++     T    V GT+GY+APE 
Sbjct: 475  HGWDQVVIHRDIKSSNILLDSEMRGRLGDFGLAKLYEHGGAPNT--TRVVGTLGYLAPEL 532

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-LVDWVWFLHRDGRILEAVDIRL 719
                  TE SD+Y+FG V+LEVV G+RP          LVDWV  L+  GR+++A D R+
Sbjct: 533  ASASAPTEASDVYSFGVVVLEVVSGRRPIEYAEEEDMVLVDWVRDLYGGGRVVDAADERV 592

Query: 720  KEDF-VVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS 839
            + +   +EE + LL LGLAC HP   +RP   ++V ++LGS
Sbjct: 593  RSECETMEEVELLLKLGLACCHPDPAKRPNMREIVSLLLGS 633



>gb:AB016890_1513217 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MNC17.
          Length = 584

 Score =  234 bits (597), Expect = 3e-60
 Identities = 128/275 (46%), Positives = 177/275 (64%), Gaps = 2/275 (0%)
 Frame = +3

Query: 39   QGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKHLVKLLGWCHRH 218
            +GG+G VYKG L   G +IAVK     + +G   + AE++ + RLRHK+LV+LLG+C R 
Sbjct: 273  KGGFGKVYKGELPS-GTQIAVKRVYHNAEQGMKQYAAEIASMGRLRHKNLVQLLGYCRRK 331

Query: 219  GKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHNEFEQRVVHRDL 398
            G+LLLVY+YMP+GSLD +LF   +   L+W  R  I+ GV  AL YLH E+EQ V+HRD+
Sbjct: 332  GELLLVYDYMPNGSLDDYLFNKNKLKDLTWSQRVNIIKGVASALLYLHEEWEQVVLHRDI 391

Query: 399  KASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECLLTGKATEQSDI 578
            KASNI+LD++ N RLGDFGLAR   ++R    +   V GTIGY+APE    G AT ++DI
Sbjct: 392  KASNILLDADLNGRLGDFGLARF--HDRGENLQATRVVGTIGYMAPELTAMGVATTKTDI 449

Query: 579  YAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIRLKEDFVVEEAKR 752
            YAFG+ +LEVVCG+RP    R      L+ WV    +   +++ VD +L  DF  +EAK 
Sbjct: 450  YAFGSFILEVVCGRRPVEPDRPPEQMHLLKWVATCGKRDTLMDVVDSKL-GDFKAKEAKL 508

Query: 753  LLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            LL LG+ CS      RP    ++Q + G+  +P++
Sbjct: 509  LLKLGMLCSQSNPESRPSMRHIIQYLEGNATIPSI 543



>gb:OSJN00280_1697870 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0096E05, complete sequence.
          Length = 746

 Score =  234 bits (596), Expect = 3e-60
 Identities = 138/319 (43%), Positives = 198/319 (62%), Gaps = 25/319 (7%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSR-ESIKGQGDFLAELSIINRLRH 179
            AT  F E  KLG+GG G VY G +   G ++A+K F+R  S++G+ ++ +E+++I+RLRH
Sbjct: 375  ATGGFAEIGKLGEGGSGSVYGGHVRELGRDVAIKVFTRGASMEGRKEYRSEVTVISRLRH 434

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE + +GSLD HL+   ET  L+W LR +I++G+  A+ YL
Sbjct: 435  RNLVQLMGWCHGRRRLLLVYELVRNGSLDGHLYSNKET--LTWPLRYQIINGLASAVLYL 492

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E++Q VVH D+K SNIMLD +FNA+LGDFGLAR +D+  +  T    VAGT GY+ PE
Sbjct: 493  HQEWDQCVVHGDIKPSNIMLDESFNAKLGDFGLARLIDHGMSLQTM-TAVAGTPGYLDPE 551

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP---------GTRIGGFQS---------LVDW 665
            C++TGKA+ +SD+Y+FG VLLEV  G+RP          T  GG            LV+W
Sbjct: 552  CVITGKASTESDMYSFGIVLLEVASGRRPMVVTPRAAAATAGGGKDDDDGGGQVFRLVEW 611

Query: 666  VWFLH----RDGRILEAV-DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             W L+     D   L+A+ D RL   F   E +R++ +GL C+HP    RP      + +
Sbjct: 612  AWELYGRGDDDQSSLDAIADTRLGGAFDRWEMERVVGVGLWCAHPDPKARPAIRQAAEAL 671

Query: 831  LG-SVPVPNVPPFRPAFVW 884
                  +P +PP  P  V+
Sbjct: 672  QSRKFRMPVLPPRMPVAVY 690



>gb:ATAC010871_1543204 Arabidopsis thaliana chromosome III BAC T16O11
            genomic sequence, complete sequence.
          Length = 693

 Score =  233 bits (595), Expect = 4e-60
 Identities = 125/287 (43%), Positives = 177/287 (61%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F E + +G GG+G+VY+G L+  G  IAVK  +  S++G  +F+AE+  + RL HK
Sbjct: 364  ATKKFKESEIIGTGGFGIVYRGNLSSSG-PIAVKKITSNSLQGVREFMAEIESLGRLGHK 422

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP--LSWELRCKIVSGVGYALQY 356
            +LV L GWC    +LLL+Y+Y+P+GSLD  L+     +   L W++R +I+ G+   L Y
Sbjct: 423  NLVNLQGWCKHKNELLLIYDYIPNGSLDSLLYQTPRRNGIVLPWDVRFEIIKGIASGLLY 482

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E+EQ VVHRD+K SN+++D + NA+LGDFGLAR    ER + T+   + GT+GY+AP
Sbjct: 483  LHEEWEQIVVHRDVKPSNVLIDEDMNAKLGDFGLARLY--ERGTLTQTTKIVGTLGYMAP 540

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            E    GK +  SD++AFG +LLE+VCG +P      F  L DWV   H +G IL  VD  
Sbjct: 541  ELTRNGKGSTASDVFAFGVLLLEIVCGNKPTNAENFF--LADWVMEFHTNGGILCVVDQN 598

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L   F   EAK  L++GL C H     RP    V++ + G   VP +
Sbjct: 599  LGSSFNGREAKLALVVGLLCCHQKPKFRPSMRMVLRYLNGEENVPQI 645



>gb:OSJN00256_1697499 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0065J03, complete sequence.
          Length = 746

 Score =  233 bits (594), Expect = 6e-60
 Identities = 138/319 (43%), Positives = 197/319 (61%), Gaps = 25/319 (7%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSR-ESIKGQGDFLAELSIINRLRH 179
            AT  F E  KLG+GG G VY G +   G  +A+K F+R  S++G+ ++ +E+++I+RLRH
Sbjct: 375  ATGGFAEIGKLGEGGSGSVYGGHVRELGRNVAIKVFTRGASMEGRKEYRSEVTVISRLRH 434

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
            ++LV+L+GWCH   +LLLVYE + +GSLD HL+   ET  L+W LR +I++G+  A+ YL
Sbjct: 435  RNLVQLMGWCHGRRRLLLVYELVRNGSLDGHLYSNKET--LTWPLRYQIINGLASAVLYL 492

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E++Q VVH D+K SNIMLD +FNA+LGDFGLAR +D+  +  T    VAGT GY+ PE
Sbjct: 493  HQEWDQCVVHGDIKPSNIMLDESFNAKLGDFGLARLIDHGMSLQTM-TAVAGTPGYLDPE 551

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP---------GTRIGGFQS---------LVDW 665
            C++TGKA+ +SD+Y+FG VLLEV  G+RP          T  GG            LV+W
Sbjct: 552  CVITGKASTESDMYSFGIVLLEVASGRRPMVVTPRAAAATAGGGKDDDDGGGQVFRLVEW 611

Query: 666  VWFLH----RDGRILEAV-DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             W L+     D   L+A+ D RL   F   E +R++ +GL C+HP    RP      + +
Sbjct: 612  AWELYGRGDDDQSSLDAIADTRLGGAFDRWEMERVVGVGLWCAHPDPKARPAIRQAAEAL 671

Query: 831  LG-SVPVPNVPPFRPAFVW 884
                  +P +PP  P  V+
Sbjct: 672  QSRKFRMPVLPPRMPVAVY 690



>pir|D85062|D85062 hypothetical protein AT4g04960 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV14_1544340 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            14.>gb:T32N4_1724003 Arabidopsis thaliana BAC T32N4.
          Length = 686

 Score =  232 bits (592), Expect = 1e-59
 Identities = 128/283 (45%), Positives = 182/283 (64%), Gaps = 6/283 (2%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKH 185
            T+ F EK  +G GG G VYKG L G  +E+AVK  S+ES  G  +F+AE+S + RL+H++
Sbjct: 344  TKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRN 403

Query: 186  LVKLLGWCHRH-GKLLLVYEYMPHGSLDQHLFIGGE-TDPLSWELRCKIVSGVGYALQYL 359
            LV L GWC +  G  +LVY+YM +GSLD+ +F   E    LS E R +I+ GV   + YL
Sbjct: 404  LVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLSCEERIRILKGVASGILYL 463

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H  +E +V+HRD+KASN++LD +   RL DFGLAR   +E+   T    V GT GY+APE
Sbjct: 464  HEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRT--TRVVGTAGYLAPE 521

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
             + TG+A+ Q+D++A+G ++LEV+CG+RP     G + L+DWVW L   G IL  +D ++
Sbjct: 522  VVKTGRASTQTDVFAYGILVLEVMCGRRPIEE--GKKPLMDWVWGLMERGEILNGLDPQM 579

Query: 720  K----EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
                    V++EA+R+L LGL C+HP   +RP    VVQ+  G
Sbjct: 580  MMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEG 622



>pir|T47484|T47484 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF9K21_1551402 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F9K21.
          Length = 669

 Score =  232 bits (591), Expect = 1e-59
 Identities = 130/293 (44%), Positives = 181/293 (61%), Gaps = 3/293 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +   LG+GG+G VYKG L  +G +IAVK  S ++ +G   F+AE+  +  L+HK
Sbjct: 338  ATNGFNKDGLLGKGGFGKVYKGTLPSKG-QIAVKRVSHDAEEGMKQFVAEIVSMGNLKHK 396

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            ++V LLG+C R G+LLLV EYMP+GSLDQ+LF   E  P SW  R  I+  +  AL Y+H
Sbjct: 397  NMVPLLGYCRRKGELLLVSEYMPNGSLDQYLF-NDEKPPFSWRRRLLIIKDIATALNYMH 455

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                Q V+HRD+KASN+MLD+ FN RLGDFG+AR  D+ +   T      GTIGY+APE 
Sbjct: 456  TGAPQVVLHRDIKASNVMLDTEFNGRLGDFGMARFHDHGKDPAT--TAAVGTIGYMAPEL 513

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR---PGTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               G  T  +D+Y FGA LLEV CG+R   PG     +  +V WV    +   +L A D 
Sbjct: 514  ATVGACT-ATDVYGFGAFLLEVTCGRRPVEPGLSAERWY-IVKWVCECWKMASLLGARDP 571

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            R++ +   EE + +L LGL C++ + + RP   D+VQ + GS+ +P++ P  P
Sbjct: 572  RMRGEISAEEVEMVLKLGLLCTNGVPDLRPSMEDIVQYLNGSLELPDISPNSP 624



>gb:AB017067_1513421 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MJC20.
          Length = 691

 Score =  231 bits (589), Expect = 2e-59
 Identities = 129/302 (42%), Positives = 182/302 (60%), Gaps = 12/302 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIK--GQGDFLAELSIINR-L 173
            AT  F E   +GQG    VY+G +   G  +AVK F RE      +  F  E + +   L
Sbjct: 362  ATSGFNENAIVGQGASATVYRGSIPSIG-SVAVKRFDREHWPQCNRNPFTTEFTTMTGYL 420

Query: 174  RHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP------LSWELRCKIVSG 335
            RHK+LV+  GWC    +  LV+EY+P+GSL + L     +DP      LSW+ R  I+ G
Sbjct: 421  RHKNLVQFQGWCSEGTETALVFEYLPNGSLSEFLHKKPSSDPSEEIIVLSWKQRVNIILG 480

Query: 336  VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGV-- 509
            V  AL YLH E E++++HRD+K  NIMLD+ FNA+LGDFGLA     E ++   G     
Sbjct: 481  VASALTYLHEECERQIIHRDVKTCNIMLDAEFNAKLGDFGLAEIY--EHSALLAGRAATL 538

Query: 510  -AGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRD 686
             AGT+GY+APE + TG  +E++D+Y+FG V+LEV  G+RP    G    LVD +W     
Sbjct: 539  PAGTMGYLAPEYVYTGVPSEKTDVYSFGVVVLEVCTGRRPVGDDGAV--LVDLMWSHWET 596

Query: 687  GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            G++L+  DI L+E+F  EE +R+L++G+ C+HP + +RPR  D V+II G  P+P +P  
Sbjct: 597  GKVLDGADIMLREEFDAEEMERVLMVGMVCAHPDSEKRPRVKDAVRIIRGEAPLPVLPAR 656

Query: 867  RP 872
            RP
Sbjct: 657  RP 658



>pir|T47481|T47481 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATF18N11_1549193 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F18N11.>gb:AY376441_1603618
            Arabidopsis thaliana salt-responsive receptor protein
            kinase (SR1) mRNA, complete cds.
          Length = 664

 Score =  231 bits (589), Expect = 2e-59
 Identities = 131/292 (44%), Positives = 183/292 (62%), Gaps = 2/292 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +  ++G+GG+G VYKG L G G  IAVK  S ++ +G   F+AE+  +  L+H+
Sbjct: 338  ATNGFRKDCRVGKGGFGEVYKGTLPG-GRHIAVKRLSHDAEQGMKQFVAEVVTMGNLQHR 396

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R  +LLLV EYMP+GSLDQ+LF  G   P SW  R  I+  +  AL YLH
Sbjct: 397  NLVPLLGYCRRKCELLLVSEYMPNGSLDQYLFHEGNPSP-SWYQRISILKDIASALSYLH 455

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
               +Q V+HRD+KASN+MLDS FN RLGDFG+A+   ++R +        GTIGY+APE 
Sbjct: 456  TGTKQVVLHRDIKASNVMLDSEFNGRLGDFGMAKF--HDRGTNLSATAAVGTIGYMAPE- 512

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            L+T   + ++D+YAFGA LLEV+CG+RP       G Q LV WV+   ++  + +  D R
Sbjct: 513  LITMGTSMKTDVYAFGAFLLEVICGRRPVEPELPVGKQYLVKWVYECWKEACLFKTRDPR 572

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            L  +F+ EE + +L LGL C++ +   RP    VVQ +   +P+P   P  P
Sbjct: 573  LGVEFLPEEVEMVLKLGLLCTNAMPESRPAMEQVVQYLNQDLPLPIFSPSTP 624



>pir|T47483|T47483 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF9K21_1551401 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F9K21.
          Length = 613

 Score =  231 bits (589), Expect = 2e-59
 Identities = 130/291 (44%), Positives = 187/291 (64%), Gaps = 3/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F + + LG+GG+G VY+G L      +AVK  S +  +G   F+AE+  +  L+H+
Sbjct: 279  ATKGFHKDRFLGRGGFGEVYRGDLP-LNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHR 337

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLV EYMP+GSLDQHLF   ++  LSW  R  I+ G+  AL YLH
Sbjct: 338  NLVPLLGYCRRKGELLLVSEYMPNGSLDQHLF-DDQSPVLSWSQRFVILKGIASALFYLH 396

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E EQ V+HRD+KASN+MLD+  N RLGDFG+AR  D+   + T      GT+GY+APE 
Sbjct: 397  TEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAAT--TAAVGTVGYMAPE- 453

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP---GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            L+T  A+  +D+YAFG  LLEV CG++P   G ++   + L+ WV    +   +L+A D 
Sbjct: 454  LITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEK-RFLIKWVCECWKKDSLLDAKDP 512

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            RL E+FV EE + ++ LGL C++ +   RP    VV  + G++P+P+  P+
Sbjct: 513  RLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPDFSPY 563



>gb:BT008663_1639865 Arabidopsis thaliana clone RAFL16-97-D11 (R50243)
            putative protein kinase (At4g04960) mRNA, complete cds.
          Length = 686

 Score =  230 bits (587), Expect = 4e-59
 Identities = 127/283 (44%), Positives = 181/283 (63%), Gaps = 6/283 (2%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKH 185
            T+ F EK  +G GG G VYKG L G  +E+AVK  S+ES  G  +F+AE+S + RL+H++
Sbjct: 344  TKGFDEKNVIGIGGNGKVYKGLLQGGVVEVAVKRISQESSDGMREFVAEISSLGRLKHRN 403

Query: 186  LVKLLGWCHRH-GKLLLVYEYMPHGSLDQHLFIGGE-TDPLSWELRCKIVSGVGYALQYL 359
            LV L GWC +  G  +LVY+YM +GSLD+ +F   E    L  E R +I+ GV   + YL
Sbjct: 404  LVSLRGWCKKEVGSFMLVYDYMENGSLDRWIFENDEKITTLRCEERIRILKGVASGILYL 463

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H  +E +V+HRD+KASN++LD +   RL DFGLAR   +E+   T    V GT GY+APE
Sbjct: 464  HEGWESKVLHRDIKASNVLLDRDMIPRLSDFGLARVHGHEQPVRT--TRVVGTAGYLAPE 521

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
             + TG+A+ Q+D++A+G ++LEV+CG+RP     G + L+DWVW L   G IL  +D ++
Sbjct: 522  VVKTGRASTQTDVFAYGILVLEVMCGRRPIEE--GKKPLMDWVWGLMERGEILNGLDPQM 579

Query: 720  K----EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
                    V++EA+R+L LGL C+HP   +RP    VVQ+  G
Sbjct: 580  MMTQGVTEVIDEAERVLQLGLLCAHPDPAKRPSMRQVVQVFEG 622



>gb:AP005091_1847629 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OJ1104_G11.
          Length = 516

 Score =  230 bits (586), Expect = 5e-59
 Identities = 133/289 (46%), Positives = 193/289 (66%), Gaps = 13/289 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLA-GEG-----LEIAVKWFSRESI-KGQGDFLAELSI 161
            AT +F E++KLGQGG+G VY G LA G G      E+AVK FS +S+ +G+ +F AE+ I
Sbjct: 169  ATRDFAEEEKLGQGGFGNVYLGRLAVGTGGGEDHQEVAVKKFSMDSMSQGRREFEAEVRI 228

Query: 162  INRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGV 338
            I++LRH++LV+L GWC     LLLVYE +  GSLD+H++    TD  L+W  R KI+ G+
Sbjct: 229  ISQLRHRNLVQLHGWCDSRKGLLLVYELVAGGSLDKHIY---NTDRILTWPERYKIIMGL 285

Query: 339  GYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGT 518
            G AL+YLH E+EQ ++H D+K SNIM+DS++N +LGDFGLAR +D+ + ++     V GT
Sbjct: 286  GAALRYLHQEWEQCILHGDIKPSNIMVDSSYNTKLGDFGLARLVDHGK-AWQATRSVLGT 344

Query: 519  IGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGR 692
             GYI PE + T + + +SD+Y+FG VLLE+VC + P        S  L+ WVW L+    
Sbjct: 345  AGYIDPEFVNTRRPSTESDVYSFGVVLLEIVCAKPPVVLQENEPSFVLLRWVWNLYSQNA 404

Query: 693  ILEAVDIRLKEDFVVEEAK---RLLLLGLACSHPIANERPRTSDVVQII 830
            IL+AVD RL+   VV + +   R+L++GL C+HP  +ERP  +  + ++
Sbjct: 405  ILDAVDERLRVVGVVRDERQMERVLVVGLWCAHPDLSERPSIARAMNVL 453



>pir|D84869|D84869 probable receptor protein kinase [imported] -
            Arabidopsis thaliana>gb:AC002333_1530355 Arabidopsis
            thaliana chromosome 2 clone F18O19 map CIC10F02, complete
            sequence.>gb:AY074631_1567633 Arabidopsis thaliana
            At2g43700/F18O19.19 mRNA, complete cds.
          Length = 658

 Score =  229 bits (585), Expect = 6e-59
 Identities = 125/281 (44%), Positives = 179/281 (63%), Gaps = 2/281 (0%)
 Frame = +3

Query: 18   GEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKHLVKL 197
            G K+ LG+GG+G V+KG L G   EIAVK  S +S +G  +FLAE+S I RLRH++LV+L
Sbjct: 335  GFKQLLGKGGFGQVFKGTLPGSDAEIAVKRISHDSKQGMQEFLAEISTIGRLRHQNLVRL 394

Query: 198  LGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHNEFEQ 377
             G+C    +L LVY++MP+GSLD++L+     + L+W  R KI+  +  AL YLH+E+ Q
Sbjct: 395  QGYCRYKEELYLVYDFMPNGSLDKYLYHRANQEQLTWNQRFKIIKDIASALCYLHHEWVQ 454

Query: 378  RVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECLLTGK 557
             V+HRD+K +N+++D   NARLGDFGLA+  D      T    VAGT  YIAPE + +G+
Sbjct: 455  VVIHRDIKPANVLIDHQMNARLGDFGLAKLYDQGYDPQT--SRVAGTFWYIAPELIRSGR 512

Query: 558  ATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLV--DWVWFLHRDGRILEAVDIRLKEDF 731
            AT  +D+YAFG  +LEV CG+R   R      +V  +W      +G ILEAV+  ++ + 
Sbjct: 513  ATTGTDVYAFGLFMLEVSCGRRLIERRTASDEVVLAEWTLKCWENGDILEAVNDGIRHED 572

Query: 732  VVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
              E+ + +L LG+ CSH     RP  S VVQI+ G + +P+
Sbjct: 573  NREQLELVLKLGVLCSHQAVAIRPDMSKVVQILGGDLQLPD 613



>pir|T48176|T48176 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550907 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 688

 Score =  229 bits (584), Expect = 8e-59
 Identities = 128/288 (44%), Positives = 177/288 (61%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLE-IAVKWFSRESIKGQGDFLAELSIINRLRH 179
            AT+ F E + +G GG+G V++G L+    + IAVK  +  S++G  +F+AE+  + RLRH
Sbjct: 357  ATDGFKENRIVGTGGFGTVFRGNLSSPSSDQIAVKKITPNSMQGVREFIAEIESLGRLRH 416

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP--LSWELRCKIVSGVGYALQ 353
            K+LV L GWC +   LLL+Y+Y+P+GSLD  L+         LSW  R KI  G+   L 
Sbjct: 417  KNLVNLQGWCKQKNDLLLIYDYIPNGSLDSLLYSRPRQSGVVLSWNARFKIAKGIASGLL 476

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH E+E+ V+HRD+K SN++++ + N RLGDFGLAR    ER S +    V GTIGY+A
Sbjct: 477  YLHEEWEKVVIHRDIKPSNVLIEDDMNPRLGDFGLARLY--ERGSQSNTTVVVGTIGYMA 534

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            PE    GK++  SD++AFG +LLE+V G+RP T  G F  L DWV  LH  G IL AVD 
Sbjct: 535  PELARNGKSSSASDVFAFGVLLLEIVSGRRP-TDSGTF-FLADWVMELHARGEILHAVDP 592

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            RL   +   EA+  L++GL C H     RP    V++ + G   VP +
Sbjct: 593  RLGFGYDGVEARLALVVGLLCCHQRPTSRPSMRTVLRYLNGDDDVPEI 640



>gb:AC009894_1536870 Arabidopsis thaliana chromosome I BAC T6H22
            genomic sequence, complete sequence.
          Length = 1086

 Score =  229 bits (583), Expect = 1e-58
 Identities = 133/288 (46%), Positives = 184/288 (63%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G VYKG L  +G E+AVK  S  S +G+G F+AE+  I+ ++H+
Sbjct: 742  ATQDFDPSNKLGEGGFGPVYKGKL-NDGREVAVKLLSVGSRQGKGQFVAEIVAISAVQHR 800

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C+     LLVYEY+P+GSLDQ LF G +T  L W  R +I  GV   L YLH
Sbjct: 801  NLVKLYGCCYEGEHRLLVYEYLPNGSLDQALF-GEKTLHLDWSTRYEICLGVARGLVYLH 859

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LDS    ++ DFGLA+  D+++T  +    VAGTIGY+APE 
Sbjct: 860  EEARLRIVHRDVKASNILLDSKLVPKVSDFGLAKLYDDKKTHIS--TRVAGTIGYLAPEY 917

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG---GFQSLVDWVWFLHRDGRILEAVDI 713
             + G  TE++D+YAFG V LE+V G RP +        + L++W W LH  GR +E +D 
Sbjct: 918  AMRGHLTEKTDVYAFGVVALELVSG-RPNSDENLEDEKRYLLEWAWNLHEKGREVELIDH 976

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            +L E F +EE KR++ + L C+      RP  S VV ++ G V V +V
Sbjct: 977  QLTE-FNMEEGKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEVSDV 1023



>pir|G96602|G96602 probable receptor protein kinase F14G9.24
            [imported] - Arabidopsis thaliana>gb:AE005173_893496
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC069159_1540695 Arabidopsis thaliana
            chromosome 1 BAC F14G9 genomic sequence, complete
            sequence.
          Length = 2062

 Score =  229 bits (583), Expect = 1e-58
 Identities = 133/288 (46%), Positives = 184/288 (63%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G VYKG L  +G E+AVK  S  S +G+G F+AE+  I+ ++H+
Sbjct: 1718 ATQDFDPSNKLGEGGFGPVYKGKL-NDGREVAVKLLSVGSRQGKGQFVAEIVAISAVQHR 1776

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C+     LLVYEY+P+GSLDQ LF G +T  L W  R +I  GV   L YLH
Sbjct: 1777 NLVKLYGCCYEGEHRLLVYEYLPNGSLDQALF-GEKTLHLDWSTRYEICLGVARGLVYLH 1835

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LDS    ++ DFGLA+  D+++T  +    VAGTIGY+APE 
Sbjct: 1836 EEARLRIVHRDVKASNILLDSKLVPKVSDFGLAKLYDDKKTHIS--TRVAGTIGYLAPEY 1893

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG---GFQSLVDWVWFLHRDGRILEAVDI 713
             + G  TE++D+YAFG V LE+V G RP +        + L++W W LH  GR +E +D 
Sbjct: 1894 AMRGHLTEKTDVYAFGVVALELVSG-RPNSDENLEDEKRYLLEWAWNLHEKGREVELIDH 1952

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            +L E F +EE KR++ + L C+      RP  S VV ++ G V V +V
Sbjct: 1953 QLTE-FNMEEGKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEVSDV 1999



 Score =  213 bits (541), Expect = 8e-54
 Identities = 124/285 (43%), Positives = 180/285 (63%), Gaps = 3/285 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G V+KG L  +G EIAVK  S  S +G+G F+AE++ I+ ++H+
Sbjct: 657  ATQDFDPSNKLGEGGFGPVFKGKL-NDGREIAVKQLSVASRQGKGQFVAEIATISAVQHR 715

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    + +LVYEY+ + SLDQ LF   ++  L W  R +I  GV   L Y+H
Sbjct: 716  NLVKLYGCCIEGNQRMLVYEYLSNKSLDQALF-EEKSLQLGWSQRFEICLGVAKGLAYMH 774

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LDS+   +L DFGLA+  D+++T  +    VAGTIGY++PE 
Sbjct: 775  EESNPRIVHRDVKASNILLDSDLVPKLSDFGLAKLYDDKKTHIS--TRVAGTIGYLSPEY 832

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR---IGGFQSLVDWVWFLHRDGRILEAVDI 713
            ++ G  TE++D++AFG V LE+V G RP +        Q L++W W LH++ R +E VD 
Sbjct: 833  VMLGHLTEKTDVFAFGIVALEIVSG-RPNSSPELDDDKQYLLEWAWSLHQEQRDMEVVDP 891

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
             L E F  EE KR++ +   C+      RP  S VV ++ G V +
Sbjct: 892  DLTE-FDKEEVKRVIGVAFLCTQTDHAIRPTMSRVVGMLTGDVEI 935



>pir|T04606|T04606 protein kinase homolog F20O9.40 - Arabidopsis
            thaliana>gb:ATCHRIV68_1546715 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 68.>gb:ATF20O9_1549534
            Arabidopsis thaliana DNA chromosome 4, BAC clone F20O9
            (ESSA project).
          Length = 649

 Score =  228 bits (582), Expect = 1e-58
 Identities = 122/282 (43%), Positives = 182/282 (64%), Gaps = 6/282 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFS---RESIKGQGDFLAELSIINRL 173
            AT+ F ++  +G GG   VY+G L  EG E+AVK      RES+    +FLAE+S + RL
Sbjct: 313  ATKGFSDENMIGYGGNSKVYRGVL--EGKEVAVKRIMMSPRESVGATSEFLAEVSSLGRL 370

Query: 174  RHKHLVKLLGWCHRHGK-LLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYAL 350
            RHK++V L GW  + G+ L+L+YEYM +GS+D+ +F   E   L+WE R +++  +   +
Sbjct: 371  RHKNIVGLKGWSKKGGESLILIYEYMENGSVDKRIFDCNEM--LNWEERMRVIRDLASGM 428

Query: 351  QYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYI 530
             YLH  +E +V+HRD+K+SN++LD + NAR+GDFGLA+ L N          V GT GY+
Sbjct: 429  LYLHEGWETKVLHRDIKSSNVLLDKDMNARVGDFGLAK-LQNTSKEMVSTTHVVGTAGYM 487

Query: 531  APECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVD 710
            APE + TG+A+ Q+D+Y+FG  +LEVVCG+RP     G + +V+W+W L    ++++ +D
Sbjct: 488  APELVKTGRASAQTDVYSFGVFVLEVVCGRRPIEE--GREGIVEWIWGLMEKDKVVDGLD 545

Query: 711  IRLKED--FVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             R+K +  FVVEE +  L +GL C HP    RP+   VVQI+
Sbjct: 546  ERIKANGVFVVEEVEMALRIGLLCVHPDPRVRPKMRQVVQIL 587



>gb:BT015370_1642198 Arabidopsis thaliana At5g01560 gene, complete
            cds.
          Length = 691

 Score =  227 bits (578), Expect = 4e-58
 Identities = 125/287 (43%), Positives = 173/287 (60%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F E + +G GG+G+VY+G +     +IAVK  +  S++G  +F+AE+  + RLRHK
Sbjct: 359  ATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHK 418

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
            +LV L GWC     LLL+Y+Y+P+GSLD  L+         LSW  R +I  G+   L Y
Sbjct: 419  NLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLY 478

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E+EQ V+HRD+K SN+++DS+ N RLGDFGLAR    ER S +    V GTIGY+AP
Sbjct: 479  LHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLY--ERGSQSCTTVVVGTIGYMAP 536

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            E    G ++  SD++AFG +LLE+V G++P T  G F  + DWV  L   G IL A+D R
Sbjct: 537  ELARNGNSSSASDVFAFGVLLLEIVSGRKP-TDSGTF-FIADWVMELQASGEILSAIDPR 594

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L   +   EA+  L +GL C H     RP    V++ +     VP +
Sbjct: 595  LGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRDEDVPEI 641



>pir|T48177|T48177 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550908 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA project).
          Length = 685

 Score =  227 bits (578), Expect = 4e-58
 Identities = 125/287 (43%), Positives = 173/287 (60%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F E + +G GG+G+VY+G +     +IAVK  +  S++G  +F+AE+  + RLRHK
Sbjct: 353  ATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHK 412

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
            +LV L GWC     LLL+Y+Y+P+GSLD  L+         LSW  R +I  G+   L Y
Sbjct: 413  NLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLY 472

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E+EQ V+HRD+K SN+++DS+ N RLGDFGLAR    ER S +    V GTIGY+AP
Sbjct: 473  LHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLY--ERGSQSCTTVVVGTIGYMAP 530

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            E    G ++  SD++AFG +LLE+V G++P T  G F  + DWV  L   G IL A+D R
Sbjct: 531  ELARNGNSSSASDVFAFGVLLLEIVSGRKP-TDSGTF-FIADWVMELQASGEILSAIDPR 588

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L   +   EA+  L +GL C H     RP    V++ +     VP +
Sbjct: 589  LGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRDEDVPEI 635



>gb:AE016959_1023607 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC092389_1735360 Oryza sativa
            chromosome 10 BAC OSJNBa0053C23 genomic sequence,
            complete sequence.>gb:AE017115_1753426 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 69 of 77
            of the complete sequence.
          Length = 674

 Score =  226 bits (577), Expect = 5e-58
 Identities = 132/288 (45%), Positives = 178/288 (61%), Gaps = 5/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F   + LG GG+G VY+G L   G  +AVK  S    +G  +F+AE++ + R+RH+
Sbjct: 352  ATKGFKNSELLGAGGFGEVYRGVLRRSGDVVAVKRISSNGRQGMREFVAEVASLGRMRHR 411

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG----GETDPLSWELRCKIVSGVGYAL 350
            +LV+L GWC R   LLLVYE+MP+GSLD  LF G         L+WE R +I+ GV   L
Sbjct: 412  NLVELRGWCKRGHDLLLVYEFMPNGSLDALLFGGAPATATATALTWEQRVRILRGVASGL 471

Query: 351  QYLHNEFEQRVVHRDLKASNIMLDSNFN-ARLGDFGLARALDNERTSYTEGEGVAGTIGY 527
             YLH E+EQ VVHRD+KASN++L ++ + ARLGDFGLAR  ++     T    V GT+GY
Sbjct: 472  VYLHEEWEQVVVHRDVKASNVLLGADASAARLGDFGLARLYEHGGDPAT--TRVVGTLGY 529

Query: 528  IAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAV 707
            +APE  +TGKAT  +D++A+GA+LLE  CG+RP     G  +L+ WV      G ++ AV
Sbjct: 530  MAPELTVTGKATTATDVFAYGALLLEAACGRRPIDPATGV-NLLRWVREHGARGELVHAV 588

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVP 851
            D RL   +  EEA+ +L LGLACS      RP    V Q + G   VP
Sbjct: 589  DERLDGRYDKEEARLVLWLGLACSQARPEARPSMRQVCQYLDGEEDVP 636



>gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0078K05.
          Length = 776

 Score =  224 bits (572), Expect = 2e-57
 Identities = 135/293 (46%), Positives = 184/293 (62%), Gaps = 3/293 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGV-VYKGWLAGEGLEIAVKWFSRESIKGQGDFLAEL-SIINRLR 176
            AT+ F     +G GG G  VY+G L   G  +AVK F       +  F +EL +++N   
Sbjct: 466  ATKGFDSGNVIGVGGSGATVYEGVLPS-GSRVAVKRFQAIGSCTKA-FDSELKAMLNCPH 523

Query: 177  HKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF-IGGETDPLSWELRCKIVSGVGYALQ 353
            H +LV L GWC    +L+LVYE+MP+G+LD  L  +GG T P  WE R + V GV  AL 
Sbjct: 524  HPNLVPLAGWCRSKDELVLVYEFMPNGNLDSALHTLGGATLP--WEARFRAVYGVASALA 581

Query: 354  YLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIA 533
            YLH+E E R++HRD+K+SN+MLD+ FNARLGDFGLAR + +     T     AGT+GY+A
Sbjct: 582  YLHDECENRIIHRDVKSSNVMLDAEFNARLGDFGLARTVSHGGLPLTTQP--AGTLGYLA 639

Query: 534  PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
            PE + TG ATE+SD+Y+FG + LEV  G+RP  R  G  S+V+WVW L    R+++A D 
Sbjct: 640  PEYVHTGVATERSDVYSFGVLALEVATGRRPAER--GI-SVVNWVWTLWGRRRLVDAADR 696

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            RL+  FV +E +R+LL+GL C HP   +RP    VV ++ G+ P+  VP   P
Sbjct: 697  RLQGRFVADEMRRVLLVGLCCVHPDCRKRPGMRRVVSMLDGTAPLILVPDKMP 749



>pir|T48175|T48175 receptor like protein kinase - Arabidopsis
            thaliana>gb:ATF7A7_1550906 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F7A7 (ESSA
            project).>gb:BT000489_1634767 Arabidopsis thaliana
            receptor like protein kinase (At5g01540/F7A7_60) mRNA,
            complete cds.>gb:AF361597_1791343 Arabidopsis thaliana
            AT5g01540/F7A7_60 mRNA, complete cds.
          Length = 682

 Score =  224 bits (571), Expect = 3e-57
 Identities = 126/287 (43%), Positives = 172/287 (59%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +   +G GG+G V+KG L      IAVK     S +G  +F+AE+  + +LRHK
Sbjct: 363  ATDGFKKTGIIGTGGFGTVFKGKLPNSD-PIAVKKIIPSSRQGVREFVAEIESLGKLRHK 421

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP--LSWELRCKIVSGVGYALQY 356
            +LV L GWC     LLL+Y+Y+P+GSLD  L+         LSW  R +I  G+   L Y
Sbjct: 422  NLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRRSGAVLSWNARFQIAKGIASGLLY 481

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E+E+ V+HRD+K SN+++DS  N RLGDFGLAR    ER + +E   + GTIGY+AP
Sbjct: 482  LHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLARLY--ERGTLSETTALVGTIGYMAP 539

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
            E    G  +  SD++AFG +LLE+VCG++P T  G F  LVDWV  LH +G IL A+D R
Sbjct: 540  ELSRNGNPSSASDVFAFGVLLLEIVCGRKP-TDSGTF-FLVDWVMELHANGEILSAIDPR 597

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L   +   EA+  L +GL C H     RP    V++ + G   VP +
Sbjct: 598  LGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRYLNGEENVPEI 644



>pir|F96602|F96602 hypothetical protein T6H22.8.2 [imported] -
            Arabidopsis thaliana>gb:AE005173_893495 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC009894_1536871 Arabidopsis thaliana
            chromosome I BAC T6H22 genomic sequence, complete
            sequence.
          Length = 1029

 Score =  224 bits (570), Expect = 3e-57
 Identities = 132/296 (44%), Positives = 185/296 (62%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G VYKG L  +G  +AVK  S  S +G+G F+AE+  I+ + H+
Sbjct: 687  ATQDFDPSNKLGEGGFGPVYKGNL-NDGRVVAVKLLSVGSRQGKGQFVAEIVAISSVLHR 745

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      +LVYEY+P+GSLDQ LF G +T  L W  R +I  GV   L YLH
Sbjct: 746  NLVKLYGCCFEGEHRMLVYEYLPNGSLDQALF-GDKTLHLDWSTRYEICLGVARGLVYLH 804

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LDS    ++ DFGLA+  D+++T  +    VAGTIGY+APE 
Sbjct: 805  EEASVRIVHRDVKASNILLDSRLVPQISDFGLAKLYDDKKTHIS--TRVAGTIGYLAPEY 862

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
             + G  TE++D+YAFG V LE+V G RP +     +    L++W W LH   R +E +D 
Sbjct: 863  AMRGHLTEKTDVYAFGVVALELVSG-RPNSDENLEEEKKYLLEWAWNLHEKSRDIELIDD 921

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            +L  DF +EEAKR++ + L C+      RP  S VV ++ G V + +V   +P +V
Sbjct: 922  KL-TDFNMEEAKRMIGIALLCTQTSHALRPPMSRVVAMLSGDVEIGDVTS-KPGYV 975



>gb:AP004688_1843412 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0036C11.
          Length = 434

 Score =  223 bits (569), Expect = 4e-57
 Identities = 121/292 (41%), Positives = 177/292 (60%), Gaps = 5/292 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT++F +  KLG+GG+G VY+G L G G EIAVK  S  S +G  +F  E+ +I +L+H+
Sbjct: 104 ATDSFSKANKLGEGGFGPVYRGVLPGGGAEIAVKRLSARSRQGAAEFRNEVELIAKLQHR 163

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           +LV+LLGWC    + LLVYE++P+GSLD  LF  G++  L W  R  I+ G+   L YLH
Sbjct: 164 NLVRLLGWCAERDEKLLVYEFLPNGSLDAFLFNEGKSAQLGWATRHNIIVGIARGLLYLH 223

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +   +VVHRDLKASN++LD   + ++ DFG+A+  ++E      G  V GT GY+APE 
Sbjct: 224 EDSLLKVVHRDLKASNVLLDDKMSPKISDFGMAKIFEDECNEVNTGR-VVGTYGYMAPEF 282

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI--GGFQSLVDWVWFLHRDGRILEAVDIR 716
            L G  + +SD+++FG +LLE++ GQR G        QSL+   W L  +G   E +D  
Sbjct: 283 ALEGVYSVKSDVFSFGVLLLEILSGQRNGALYLEEHQQSLIQDAWKLWTEGLAAEFMDPA 342

Query: 717 LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVPP 863
           L   +  EEA R   +GL C    A+ RP  S+V+  ++    ++P P+ PP
Sbjct: 343 LGRGYAAEEAWRCYHVGLLCVQEDADARPTMSNVLLALISDHMNLPEPSRPP 394



>gb:AB015471_1512521 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K9B18.
          Length = 675

 Score =  223 bits (569), Expect = 4e-57
 Identities = 130/290 (44%), Positives = 180/290 (62%), Gaps = 3/290 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +  +LG+GG+G VY+G L   G +IAVK    ++ +G   F+AE+  +  L+H+
Sbjct: 344  ATNRFDKDGRLGKGGFGEVYRGNLPHVG-DIAVKRVCHDAKQGMKQFVAEVVTMGSLKHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLV EYM +GSLDQ+LF   E   LSW  R  I+  +  AL YLH
Sbjct: 403  NLVPLLGYCRRKGELLLVSEYMSNGSLDQYLF-HREKPALSWSQRLVILKDIASALSYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALD-NERTSYTEGEGVAGTIGYIAPE 539
                Q V+HRD+KASN+MLDS FN RLGDFG+AR  D  +    T      GT+GY+APE
Sbjct: 462  TGANQVVLHRDIKASNVMLDSEFNGRLGDFGMARFEDYGDSVPVT---AAVGTMGYMAPE 518

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP-GTRI-GGFQSLVDWVWFLHRDGRILEAVDI 713
                G +T ++D+YAFG ++LEV CG+RP   +I    + L+ WV    R   I++A+D 
Sbjct: 519  LTTMGTST-RTDVYAFGVLMLEVTCGRRPLDPKIPSEKRHLIKWVCDCWRRDSIVDAIDT 577

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP 863
            RL   + VEE   +L LGL C++ +A  RP    V+Q I  ++P+PN  P
Sbjct: 578  RLGGQYSVEETVMVLKLGLICTNIVAESRPTMEQVIQYINQNLPLPNFSP 627



>pir|E96602|E96602 hypothetical protein T6H22.9 [imported] -
            Arabidopsis thaliana>gb:AE005173_893494 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC009894_1536872 Arabidopsis thaliana
            chromosome I BAC T6H22 genomic sequence, complete
            sequence.
          Length = 858

 Score =  221 bits (564), Expect = 2e-56
 Identities = 126/284 (44%), Positives = 177/284 (62%), Gaps = 2/284 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G VYKG L  +G E+AVK  S  S +G+G F+AE+  I+ + H+
Sbjct: 517  ATQDFDLSNKLGEGGFGAVYKGNL-NDGREVAVKQLSIGSRQGKGQFVAEIIAISSVLHR 575

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEY+P+GSLDQ LF G ++  L W  R +I  GV   L YLH
Sbjct: 576  NLVKLYGCCFEGDHRLLVYEYLPNGSLDQALF-GDKSLHLDWSTRYEICLGVARGLVYLH 634

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R++HRD+KASNI+LDS    ++ DFGLA+  D+++T  +    VAGTIGY+APE 
Sbjct: 635  EEASVRIIHRDVKASNILLDSELVPKVSDFGLAKLYDDKKTHIS--TRVAGTIGYLAPEY 692

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  TE++D+YAFG V LE+V G++        G + L++W W LH   R +E +D  
Sbjct: 693  AMRGHLTEKTDVYAFGVVALELVSGRKNSDENLEEGKKYLLEWAWNLHEKNRDVELIDDE 752

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
            L E + +EE KR++ + L C+      RP  S VV ++ G   V
Sbjct: 753  LSE-YNMEEVKRMIGIALLCTQSSYALRPPMSRVVAMLSGDAEV 795



>pir|C96729|C96729 hypothetical protein F24J13.10 [imported] -
            Arabidopsis thaliana>gb:AE005173_894637 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010796_1537112 Arabidopsis thaliana
            chromosome 1 BAC F24J13 genomic sequence, complete
            sequence.
          Length = 646

 Score =  221 bits (564), Expect = 2e-56
 Identities = 120/290 (41%), Positives = 180/290 (62%), Gaps = 2/290 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +K KLGQGG G VYKG L   G  +AVK     + +    F  E+++I+++ HK
Sbjct: 319  ATDYFSDKNKLGQGGSGSVYKGVLTN-GKTVAVKRLFFNTKQWVDHFFNEVNLISQVDHK 377

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG      + LLVYEY+ + SL  +LF+  +  PL+W  R KI+ G    + YLH
Sbjct: 378  NLVKLLGCSITGPESLLVYEYIANQSLHDYLFVRKDVQPLNWAKRFKIILGTAEGMAYLH 437

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R++HRD+K SNI+L+ +F  R+ DFGLAR    ++T  +    +AGT+GY+APE 
Sbjct: 438  EESNLRIIHRDIKLSNILLEDDFTPRIADFGLARLFPEDKTHIS--TAIAGTLGYMAPEY 495

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLK 722
            ++ GK TE++D+Y+FG +++EV+ G+R    +    S++  VW L+R   + EAVD  L 
Sbjct: 496  VVRGKLTEKADVYSFGVLMIEVITGKRNNAFVQDAGSILQSVWSLYRTSNVEEAVDPILG 555

Query: 723  EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV--PNVPPF 866
            ++F   EA RLL +GL C     ++RP  S VV+++ GS+ +  P  PPF
Sbjct: 556  DNFNKIEASRLLQIGLLCVQAAFDQRPAMSVVVKMMKGSLEIHTPTQPPF 605



>gb:AP005156_1848351 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1729_E01.
          Length = 633

 Score =  221 bits (563), Expect = 2e-56
 Identities = 116/279 (41%), Positives = 177/279 (63%), Gaps = 2/279 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E KKLG+GG+G VYKG L G+  E+AVK  ++ S +G  +   EL ++ +L HK
Sbjct: 353  ATDNFDESKKLGEGGFGAVYKGHLFGQ--EVAVKRMAKGSNQGLEELKNELVLVTKLHHK 410

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G+C   G+ LLVYEYMP+ SLD  LF   +   L W  R +I+ GV   LQYLH
Sbjct: 411  NLVRLVGFCLEDGERLLVYEYMPNKSLDTFLFDVEQRRQLDWATRFRIIEGVARGLQYLH 470

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + ++++VHRD+KASN++LD++ N ++GDFGLAR    ++T       + GT GY+APE 
Sbjct: 471  QDSQKKIVHRDMKASNVLLDADLNPKIGDFGLARLFGQDQTRDVTNR-IVGTFGYMAPEY 529

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            ++ G+ + +SD+++FG ++LE+V GQR        Q+  LV  VW    +G I+E VD  
Sbjct: 530  VIRGQYSTKSDVFSFGILILEIVTGQRNSGPYFAEQNEDLVSLVWRHWTEGNIVEMVDYS 589

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIIL 833
            L  ++   E  + + +GL C      +RP  +DV+ ++L
Sbjct: 590  LDRNYPEAEVLKCVNIGLLCVQQNPVDRPTMADVMILLL 628



>gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC
            clone:OJ1014_H11.>gb:AP004157_1838353 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OJ1114_D06.>gb:AP005442_1851845 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OSJNBa0073I05.
          Length = 976

 Score =  221 bits (562), Expect = 3e-56
 Identities = 125/296 (42%), Positives = 185/296 (62%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF  +  +G+GGYG VYKG L  +G  IAVK  S+ S +G+ +F+ E++ I+ ++H+
Sbjct: 638  ATENFSSQNMVGEGGYGQVYKGKLP-DGRVIAVKQLSQSSHQGKSEFVTEVATISAVQHR 696

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEY+ +GSLD+ LF G ++  L W  R +IV GV   L YLH
Sbjct: 697  NLVKLHGCCIDSNTPLLVYEYLENGSLDRALF-GSKSFNLDWPTRFEIVLGVARGLTYLH 755

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASN++LD++   ++ DFGLA+  D ++T  +    +AGT+GY+APE 
Sbjct: 756  EESSVRIVHRDIKASNVLLDTDLTPKISDFGLAKLYDEKKTHIS--TKIAGTLGYLAPEY 813

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
             + G  TE++D++AFG V LE V G RP T     +    L +W W L+  G+ L  VD 
Sbjct: 814  AMRGHLTEKADVFAFGVVALETVAG-RPNTDNSREEDKIYLFEWAWTLYESGQALGIVDP 872

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            +LKE F  +EA R++   L C+    ++RP  S V+ I+ G + V  V   +P+++
Sbjct: 873  KLKE-FNEKEALRVICAALLCTQGSPHQRPSMSRVMAILAGDIEVTEVVT-KPSYI 926



>gb:AY572461_1615703 Oryza sativa putative cytokinin receptor mRNA,
            complete cds.
          Length = 948

 Score =  221 bits (562), Expect = 3e-56
 Identities = 125/299 (41%), Positives = 185/299 (61%), Gaps = 23/299 (7%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSR------ESIKGQGDFLAELSII 164
            AT NF ++ KLGQGG+G VYKG+L  + L +A+K  SR      +S +G  +F AE+ ++
Sbjct: 656  ATGNFADENKLGQGGFGPVYKGYLRDQDLHVAIKVLSRRQSCQEQSAQGLREFKAEVKVM 715

Query: 165  NRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP---LSWELRC----- 320
             +LRH+++VKL+GW     +LLLVYE M  GSLD+HL+     DP   L+W+ R      
Sbjct: 716  TQLRHRNIVKLVGWSDSKKQLLLVYELMAQGSLDKHLY-----DPEKILTWQQRYQIKFA 770

Query: 321  -------KIVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNE 479
                   KIV  +G AL YLH++ E+ +VH D+K +N+MLD + NA+LGDFGLAR +++ 
Sbjct: 771  NLFNSTDKIVLDLGSALLYLHHDCEKCIVHGDIKPANVMLDVSHNAKLGDFGLARLVEHG 830

Query: 480  RTSYTEGEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQS 653
                T  + VAGT GYI PE +       + D+Y+FG VLLE+ CG+RP +R    G  S
Sbjct: 831  GEPQTT-QVVAGTPGYIDPEFINNRWPRTELDVYSFGIVLLEIACGKRPASRQLPNGASS 889

Query: 654  LVDWVWFLHRDGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            L+ WV  L+  G+IL+A D RL  +F  ++ +R++++GL CSH    +RP     + ++
Sbjct: 890  LLAWVRDLYDQGKILDAADQRLNGEFNQQQMERVIVMGLCCSHQDPIQRPSIVQAMDVL 948



>pir|T47482|T47482 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATF18N11_1549194 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F18N11.
          Length = 667

 Score =  221 bits (562), Expect = 3e-56
 Identities = 128/306 (41%), Positives = 180/306 (58%), Gaps = 9/306 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +   +G+GG+G VYKG L G G  IAVK  S ++ +G   F+AE+  +  ++H+
Sbjct: 346  ATNGFVKDALVGKGGFGKVYKGTLPG-GRHIAVKRLSHDAEQGMKQFVAEVVTMGNIQHR 404

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLV EYM +GSLDQ+LF      P SW  R  I+  +  AL YLH
Sbjct: 405  NLVPLLGYCRRKGELLLVSEYMSNGSLDQYLFYNQNPSP-SWLQRISILKDIASALNYLH 463

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +     V+HRD+KASN+MLDS +N RLGDFG+A+  D +           GTIGY+APE 
Sbjct: 464  SGANPAVLHRDIKASNVMLDSEYNGRLGDFGMAKFQDPQ--GNLSATAAVGTIGYMAPEL 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            + TG  ++++D+YAFG  LLEV CG+RP       Q   LV WV    +   +LE  D +
Sbjct: 522  IRTG-TSKETDVYAFGIFLLEVTCGRRPFEPELPVQKKYLVKWVCECWKQASLLETRDPK 580

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN-------VPPFRPA 875
            L  +F+ EE + +L LGL C++ +   RP    V+Q +    P+P+       +  F P 
Sbjct: 581  LGREFLSEEVEMVLKLGLLCTNDVPESRPDMGQVMQYLSQKQPLPDFSADSPGIGGFMPV 640

Query: 876  FVWPSA 893
             V PS+
Sbjct: 641  SVEPSS 646



>gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0458H05.
          Length = 696

 Score =  219 bits (559), Expect = 6e-56
 Identities = 125/294 (42%), Positives = 178/294 (60%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E  KLG+GG+GVVYKG L   G EIAVK  S+ S++G G+   EL ++ +L+HK
Sbjct: 360  ATDNFSENNKLGEGGFGVVYKGSLP-HGEEIAVKRLSQSSVQGMGELKNELVLVAKLQHK 418

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G C    + +LVYEYMP+ SLD  LF   ++  L W  R KI++GV   +QYLH
Sbjct: 419  NLVRLVGVCLEEHERMLVYEYMPNRSLDTILFDAEKSSLLDWGRRLKIINGVARGMQYLH 478

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + ++VHRDLKASN++LDS++N ++ DFGLAR    ++T       V GT GY+APE 
Sbjct: 479  EDSQLKIVHRDLKASNVLLDSDYNPKISDFGLARLFGGDQTQDVTNR-VVGTYGYMAPEY 537

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG ++LE+V G+R        QS  L+  +W     G I+E VD  
Sbjct: 538  AMRGHYSVKSDVFSFGVLVLEIVTGRRNSGSYYSEQSGDLLSIIWEHWTMGTIMEMVDRS 597

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            + E     E  R + +GL C       RP  S  V ++L S  V    P RPAF
Sbjct: 598  MGERAAGGEIARCIHVGLLCVQENPASRPAMS-AVNVMLSSGTVSLKAPSRPAF 650



>gb:AY056317_1563628 Arabidopsis thaliana putative receptor protein
            kinase (At5g60300) mRNA, complete cds.
          Length = 718

 Score =  219 bits (559), Expect = 6e-56
 Identities = 125/290 (43%), Positives = 180/290 (62%), Gaps = 2/290 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F + + LG+GG+G VY+G L  +G EIAVK  S    +G   F+AE+  +  L+H+
Sbjct: 340  ATKGFSKDEFLGKGGFGEVYRGNLP-QGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHR 398

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L G+C R  +LLLV EYMP+GSLD+HLF   +   LSW  R  +V G+  AL YLH
Sbjct: 399  NLVPLFGYCRRKRELLLVSEYMPNGSLDEHLF-DDQKPVLSWSQRLVVVKGIASALWYLH 457

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
               +Q V+HRD+KASNIMLD+ F+ RLGDFG+AR  ++   + T      GT+GY+APE 
Sbjct: 458  TGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAAT--TAAVGTVGYMAPE- 514

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            L+T  A+  +D+YAFG  +LEV CG+RP       +   ++ WV    +   +L+A D R
Sbjct: 515  LITMGASTGTDVYAFGVFMLEVTCGRRPVKPQLQVEKRHMIKWVCECWKKDSLLDATDPR 574

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            L   FV EE + ++ LGL CS+ +   RP    VV  +  ++P+P+  P+
Sbjct: 575  LGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPY 624



>gb:AB026632_1517030 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F15L12.>gb:AY120738_1579620 Arabidopsis
            thaliana tRNA intron endonuclease-like protein
            (At5g60300) mRNA, complete cds.>gb:AY139978_1582420
            Arabidopsis thaliana unknown protein mRNA, complete
            cds.>gb:BT000349_1634627 Arabidopsis thaliana tRNA intron
            endonuclease-like protein (At5g60300) mRNA, complete cds.
          Length = 718

 Score =  219 bits (559), Expect = 6e-56
 Identities = 125/290 (43%), Positives = 180/290 (62%), Gaps = 2/290 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F + + LG+GG+G VY+G L  +G EIAVK  S    +G   F+AE+  +  L+H+
Sbjct: 340  ATKGFSKDEFLGKGGFGEVYRGNLP-QGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHR 398

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L G+C R  +LLLV EYMP+GSLD+HLF   +   LSW  R  +V G+  AL YLH
Sbjct: 399  NLVPLFGYCRRKRELLLVSEYMPNGSLDEHLF-DDQKPVLSWSQRLVVVKGIASALWYLH 457

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
               +Q V+HRD+KASNIMLD+ F+ RLGDFG+AR  ++   + T      GT+GY+APE 
Sbjct: 458  TGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAAT--TAAVGTVGYMAPE- 514

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            L+T  A+  +D+YAFG  +LEV CG+RP       +   ++ WV    +   +L+A D R
Sbjct: 515  LITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPR 574

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            L   FV EE + ++ LGL CS+ +   RP    VV  +  ++P+P+  P+
Sbjct: 575  LGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPY 624



>pir|C96574|C96574 hypothetical protein T3F20.25 [imported] -
            Arabidopsis thaliana>gb:AE005173_893245 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:T3F20_1724051 Sequence of BAC T3F20 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 942

 Score =  219 bits (557), Expect = 1e-55
 Identities = 125/289 (43%), Positives = 178/289 (61%), Gaps = 7/289 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF  + K+G+GG+G VYKG LA +G+ IAVK  S +S +G  +F+ E+ +I+ L+H 
Sbjct: 569  ATNNFDPENKIGEGGFGPVYKGVLA-DGMTIAVKQLSSKSKQGNREFVTEIGMISALQHP 627

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPL--SWELRCKIVSGVGYALQY 356
            +LVKL G C    +LLLVYEY+ + SL + LF G E   L   W  R KI  G+   L Y
Sbjct: 628  NLVKLYGCCIEGKELLLVYEYLENNSLARALF-GTEKQRLHLDWSTRNKICIGIAKGLAY 686

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E   ++VHRD+KA+N++LD + NA++ DFGLA+  D+E T  +    +AGTIGY+AP
Sbjct: 687  LHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHIS--TRIAGTIGYMAP 744

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQ-----RPGTRIGGFQSLVDWVWFLHRDGRILE 701
            E  + G  T+++D+Y+FG V LE+V G+     RP      F  L+DW + L   G +LE
Sbjct: 745  EYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEE---FVYLLDWAYVLQEQGSLLE 801

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
             VD  L   F  +EA R+L + L C++P    RP  S VV ++ G + V
Sbjct: 802  LVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKV 850



>pir|T47473|T47473 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATF18N11_1549185 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F18N11.
          Length = 682

 Score =  218 bits (555), Expect = 2e-55
 Identities = 130/292 (44%), Positives = 174/292 (59%), Gaps = 2/292 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F +  +LG+GG+G VYKG L   G +IAVK  S ++ +G   F+AE+  +  L+HK
Sbjct: 344  ATRGFNKDGRLGRGGFGEVYKGTLPILG-DIAVKRLSHDAEQGMKQFVAEVVTMGSLQHK 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV LLG+C R G+LLLV +YM  GS+DQ+LF  G+  PLSW  R  I+  +  AL YLH
Sbjct: 403  NLVPLLGYCRRKGELLLVSKYMEGGSVDQYLF-HGDKPPLSWSQRVSILRDIASALCYLH 461

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                Q V+HRD+KASN+ML+ N    LGDFG+AR   ++  S        GTIGY+A E 
Sbjct: 462  TGASQVVLHRDIKASNVMLNGNLQGFLGDFGMARF--DDHGSNLSATAAVGTIGYMALEL 519

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
              TG +T ++D+YAFGA +LEV CG+RP       +   LV WV    R+G ++ AVD R
Sbjct: 520  TSTGTST-RTDVYAFGAFMLEVTCGRRPFDPAMPVEKRHLVKWVCECWREGSLVNAVDTR 578

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            L+  FV  E + +L LGL C+  I   RP    VVQ I     +P   P  P
Sbjct: 579  LRGKFVPGEVEMVLKLGLLCTSIIPEARPNMEQVVQYINRHQRLPEFSPNTP 630



>gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome 3,
            BAC clone: T21E2.
          Length = 1042

 Score =  216 bits (551), Expect = 5e-55
 Identities = 119/281 (42%), Positives = 175/281 (62%), Gaps = 3/281 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF    K+G+GG+G V+KG +  +G  IAVK  S +S +G  +FL E+++I+ L+H 
Sbjct: 690  ATDNFDPANKIGEGGFGPVHKGIMT-DGTVIAVKQLSAKSKQGNREFLNEIAMISALQHP 748

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD-PLSWELRCKIVSGVGYALQYL 359
            HLVKL G C    +LLLVYEY+ + SL + LF   ET  PL+W +R KI  G+   L YL
Sbjct: 749  HLVKLYGCCVEGDQLLLVYEYLENNSLARALFGPQETQIPLNWPMRQKICVGIARGLAYL 808

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H E   ++VHRD+KA+N++LD   N ++ DFGLA+ LD E  ++     VAGT GY+APE
Sbjct: 809  HEESRLKIVHRDIKATNVLLDKELNPKISDFGLAK-LDEEENTHISTR-VAGTYGYMAPE 866

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDI 713
              + G  T+++D+Y+FG V LE+V G+   +      +  L+DWV  L     +LE VD 
Sbjct: 867  YAMRGHLTDKADVYSFGVVALEIVHGKSNTSSRSKADTFYLLDWVHVLREQNTLLEVVDP 926

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
            RL  D+  +EA  ++ +G+ C+ P   +RP  S VV ++ G
Sbjct: 927  RLGTDYNKQEALMMIQIGMLCTSPAPGDRPSMSTVVSMLEG 967



>gb:OSJN00093_1694776 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 1028

 Score =  216 bits (551), Expect = 5e-55
 Identities = 127/296 (42%), Positives = 180/296 (60%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF     LG+GGYG VYKG L  +G  +AVK  S+ S +G+  F AE+  I+R++H+
Sbjct: 698  ATENFSSSNLLGEGGYGAVYKGKLT-DGRVVAVKQLSQTSHQGKVQFAAEIQTISRVQHR 756

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEYM +GSLD+ LF  G+ + + W  R  I  G+   L YLH
Sbjct: 757  NLVKLYGCCLESNNPLLVYEYMDNGSLDKALFGTGKLN-IDWPARFGICLGIARGLAYLH 815

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   RVVHRD+KASN++LD+  N ++ DFGLA+  D+++T  +    VAGT GY+APE 
Sbjct: 816  EESSIRVVHRDIKASNVLLDAYLNPKISDFGLAKLYDDKKTHVS--TKVAGTFGYLAPEY 873

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
             + G+ TE+ D++AFG VLLE + G RP       +    + +W W L+ +   L  VD 
Sbjct: 874  AMRGRLTEKVDVFAFGVVLLETLAG-RPNYDDALEEDKIYIFEWAWELYENNYPLGVVDP 932

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            RL E +  EEA R + + L C+    ++RP  S VV ++ G V VP V   +P+++
Sbjct: 933  RLTE-YDGEEALRAIRVALLCTQGSPHQRPSMSRVVTMLAGDVEVPEVVT-KPSYI 986



>pir|D96574|D96574 hypothetical protein T3F20.24 [imported] -
            Arabidopsis thaliana>gb:AE005173_893246 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:T3F20_1724050 Sequence of BAC T3F20 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 979

 Score =  216 bits (551), Expect = 5e-55
 Identities = 124/289 (42%), Positives = 178/289 (61%), Gaps = 7/289 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF  + K+G+GG+G VYKG LA +G+ IAVK  S +S +G  +F+ E+ +I+ L+H 
Sbjct: 607  ATNNFDPENKIGEGGFGPVYKGVLA-DGMTIAVKQLSSKSKQGNREFVTEIGMISALQHP 665

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPL--SWELRCKIVSGVGYALQY 356
            +LVKL G C    +LLLVYEY+ + SL + LF G E   L   W  R K+  G+   L Y
Sbjct: 666  NLVKLYGCCIEGKELLLVYEYLENNSLARALF-GTEKQRLHLDWSTRNKVCIGIAKGLAY 724

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E   ++VHRD+KA+N++LD + NA++ DFGLA+ LD E  ++     +AGTIGY+AP
Sbjct: 725  LHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAK-LDEEENTHISTR-IAGTIGYMAP 782

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQ-----RPGTRIGGFQSLVDWVWFLHRDGRILE 701
            E  + G  T+++D+Y+FG V LE+V G+     RP      F  L+DW + L   G +LE
Sbjct: 783  EYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEE---FIYLLDWAYVLQEQGSLLE 839

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
             VD  L   F  +EA R+L + L C++P    RP  S VV ++ G + V
Sbjct: 840  LVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQGKIKV 888



>gb:AE016959_1020597 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC069324_1540827 Oryza sativa
            chromosome 10 clone OSJNBa0071K19, complete
            sequence.>gb:AE017048_1750416 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 2 of 77 of the
            complete sequence.
          Length = 568

 Score =  216 bits (549), Expect = 9e-55
 Identities = 120/289 (41%), Positives = 171/289 (59%), Gaps = 11/289 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F     LGQGG+G VYKG LAG G E+AVK     S +G+ +F AE+ II+R+ H+
Sbjct: 229  ATSGFSAANLLGQGGFGYVYKGVLAGNGKEVAVKQLKSGSGQGEREFQAEVDIISRVHHR 288

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD-PLSWELRCKIVSGVGYALQYL 359
            HLV L+G+C    + +LVYE++P+G+L+ HL+ GG  D  L W  R +I  G    L YL
Sbjct: 289  HLVSLVGYCIAANQRMLVYEFVPNGTLEHHLYRGGNGDRVLDWSARHRIALGSAKGLAYL 348

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H +   R++HRD+KA+NI+LD+N+ A + DFGLA+   +  T  +    V GT GY+APE
Sbjct: 349  HEDCHPRIIHRDIKAANILLDANYEAMVADFGLAKLTTDTNTHVS--TRVMGTFGYLAPE 406

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ-SLVDW---------VWFLHRDG 689
               TGK TE+SD+++FG +LLE++ G+RP       + SLVDW         V      G
Sbjct: 407  YASTGKLTEKSDVFSFGVMLLELLTGRRPVDTSNYMEDSLVDWARPVLARLLVAGGEEGG 466

Query: 690  RILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
             I E VD RL  ++   E +R+     A     A +RP+ S +V+ + G
Sbjct: 467  LIRELVDSRLGGEYSAVEVERMAACAAASIRHSARQRPKMSQIVRALEG 515



>gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1014_H11.
          Length = 1023

 Score =  214 bits (544), Expect = 4e-54
 Identities = 120/287 (41%), Positives = 174/287 (60%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENFG +  LG+GGYG VYKG L  +G  +AVK  S+ S +G+  F+ E++ I+ ++H+
Sbjct: 686  ATENFGSQNILGEGGYGPVYKGILT-DGRVVAVKQLSQSSQQGKSQFVTEVATISSVQHR 744

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEY+ +GSLDQ LF  G  + L W  R +I+ G+   L YLH
Sbjct: 745  NLVKLYGCCIDSNTPLLVYEYLENGSLDQALFGDGRFN-LGWSTRFEIILGIARGLSYLH 803

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LD +   ++ DFGLA+  D ++T       VAGT GY+APE 
Sbjct: 804  EEANVRIVHRDIKASNILLDPDLTPKISDFGLAKLYDEKKTHV--NTKVAGTFGYLAPEY 861

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQ--RPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  TE+ D+++FG V LE V G+     + +   + L +W W L+   + L  VD R
Sbjct: 862  AMRGHLTEKVDVFSFGVVALETVAGRSNTDYSLVEDKKYLFEWAWGLYEREQALGIVDPR 921

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L E+   EE  R++ +   C+    ++RP  S VV ++ G +PV +V
Sbjct: 922  L-EEINEEEVLRVIRMSFLCTQGSPHQRPPMSRVVAMLTGDIPVSDV 967



>gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18
            genomic sequence, complete sequence.
          Length = 1013

 Score =  214 bits (544), Expect = 4e-54
 Identities = 120/287 (41%), Positives = 179/287 (62%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF +  KLG+GG+G V+KG L+ +G  IAVK  S +S +G  +F+ E+ +I+ L H 
Sbjct: 667  ATNNFDQANKLGEGGFGSVFKGELS-DGTIIAVKQLSSKSSQGNREFVNEIGMISGLNHP 725

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    +LLLVYEYM + SL   LF G  +  L W  R KI  G+   L++LH
Sbjct: 726  NLVKLYGCCVERDQLLLVYEYMENNSLALALF-GQNSLKLDWAARQKICVGIARGLEFLH 784

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +    R+VHRD+K +N++LD++ NA++ DFGLAR  + E T  +    VAGTIGY+APE 
Sbjct: 785  DGSAMRMVHRDIKTTNVLLDTDLNAKISDFGLARLHEAEHTHIS--TKVAGTIGYMAPEY 842

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ--SLVDWVWFLHRDGRILEAVDIR 716
             L G+ TE++D+Y+FG V +E+V G+    + G     SL++W   L + G ILE VD  
Sbjct: 843  ALWGQLTEKADVYSFGVVAMEIVSGKSNTKQQGNADSVSLINWALTLQQTGDILEIVDRM 902

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ +F   EA R++ + L C++   + RP  S+ V+++ G + +  V
Sbjct: 903  LEGEFNRSEAVRMIKVALVCTNSSPSLRPTMSEAVKMLEGEIEITQV 949



>pir|F86420|F86420 probable receptor-like serine/threonine kinase -
            Arabidopsis thaliana>gb:AE005172_891822 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC079288_1732516 Arabidopsis thaliana
            chromosome 1 BAC T3M22 genomic sequence, complete
            sequence.
          Length = 920

 Score =  214 bits (544), Expect = 4e-54
 Identities = 120/287 (41%), Positives = 179/287 (62%), Gaps = 2/287 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF +  KLG+GG+G V+KG L+ +G  IAVK  S +S +G  +F+ E+ +I+ L H 
Sbjct: 570  ATNNFDQANKLGEGGFGSVFKGELS-DGTIIAVKQLSSKSSQGNREFVNEIGMISGLNHP 628

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    +LLLVYEYM + SL   LF G  +  L W  R KI  G+   L++LH
Sbjct: 629  NLVKLYGCCVERDQLLLVYEYMENNSLALALF-GQNSLKLDWAARQKICVGIARGLEFLH 687

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +    R+VHRD+K +N++LD++ NA++ DFGLAR  + E T  +    VAGTIGY+APE 
Sbjct: 688  DGSAMRMVHRDIKTTNVLLDTDLNAKISDFGLARLHEAEHTHIS--TKVAGTIGYMAPEY 745

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ--SLVDWVWFLHRDGRILEAVDIR 716
             L G+ TE++D+Y+FG V +E+V G+    + G     SL++W   L + G ILE VD  
Sbjct: 746  ALWGQLTEKADVYSFGVVAMEIVSGKSNTKQQGNADSVSLINWALTLQQTGDILEIVDRM 805

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            L+ +F   EA R++ + L C++   + RP  S+ V+++ G + +  V
Sbjct: 806  LEGEFNRSEAVRMIKVALVCTNSSPSLRPTMSEAVKMLEGEIEITQV 852



>pir|C84869|C84869 probable receptor protein kinase [imported] -
            Arabidopsis thaliana>gb:AC002333_1530356 Arabidopsis
            thaliana chromosome 2 clone F18O19 map CIC10F02, complete
            sequence.
          Length = 664

 Score =  213 bits (543), Expect = 5e-54
 Identities = 116/281 (41%), Positives = 172/281 (61%), Gaps = 2/281 (0%)
 Frame = +3

Query: 18   GEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKHLVKL 197
            G K+ LG+GG+G V+KG L+G   +IAVK  S +S +G  + LAE+S I RLRH +LV+L
Sbjct: 336  GFKQLLGEGGFGPVFKGTLSGSNAKIAVKRVSHDSSQGMRELLAEISTIGRLRHPNLVRL 395

Query: 198  LGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHNEFEQ 377
            LG+C    +L LVY+++P+GSLD++L+   +   LSW  R KI+  V  AL YLH+ +  
Sbjct: 396  LGYCRYKEELYLVYDFLPNGSLDKYLYGTSDQKQLSWSQRFKIIKDVASALSYLHHGWIH 455

Query: 378  RVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECLLTGK 557
             V+HRD+K +N+++D   NA LGDFGLA+  D      T    VAGT GY+APE + TG+
Sbjct: 456  VVIHRDIKPANVLIDDKMNASLGDFGLAKVYDQGYDPQT--SRVAGTFGYMAPEIMRTGR 513

Query: 558  ATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIRLKEDF 731
             T  +D+YAFG  +LEV C ++        +   L +W      +G I+EA   R+++D 
Sbjct: 514  PTMGTDVYAFGMFMLEVSCDRKLFEPRAESEEAILTNWAINCWENGDIVEAATERIRQDN 573

Query: 732  VVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPN 854
               + + +L LG+ CSH     RP  + VV+I+ G   +P+
Sbjct: 574  DKGQLELVLKLGVLCSHEAEEVRPDMATVVKILNGVSELPD 614



>gb:AC009894_1536869 Arabidopsis thaliana chromosome I BAC T6H22
            genomic sequence, complete sequence.
          Length = 889

 Score =  213 bits (541), Expect = 8e-54
 Identities = 124/285 (43%), Positives = 180/285 (63%), Gaps = 3/285 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F    KLG+GG+G V+KG L  +G EIAVK  S  S +G+G F+AE++ I+ ++H+
Sbjct: 560  ATQDFDPSNKLGEGGFGPVFKGKL-NDGREIAVKQLSVASRQGKGQFVAEIATISAVQHR 618

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    + +LVYEY+ + SLDQ LF   ++  L W  R +I  GV   L Y+H
Sbjct: 619  NLVKLYGCCIEGNQRMLVYEYLSNKSLDQALF-EEKSLQLGWSQRFEICLGVAKGLAYMH 677

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASNI+LDS+   +L DFGLA+  D+++T  +    VAGTIGY++PE 
Sbjct: 678  EESNPRIVHRDVKASNILLDSDLVPKLSDFGLAKLYDDKKTHIS--TRVAGTIGYLSPEY 735

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR---IGGFQSLVDWVWFLHRDGRILEAVDI 713
            ++ G  TE++D++AFG V LE+V G RP +        Q L++W W LH++ R +E VD 
Sbjct: 736  VMLGHLTEKTDVFAFGIVALEIVSG-RPNSSPELDDDKQYLLEWAWSLHQEQRDMEVVDP 794

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
             L E F  EE KR++ +   C+      RP  S VV ++ G V +
Sbjct: 795  DLTE-FDKEEVKRVIGVAFLCTQTDHAIRPTMSRVVGMLTGDVEI 838



>gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0696F12.
          Length = 638

 Score =  211 bits (538), Expect = 2e-53
 Identities = 121/292 (41%), Positives = 176/292 (60%), Gaps = 2/292 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F E  KLG+GG+G VYKG L  +G EIAVK  S+ S +G  +   EL+++ +L+HK
Sbjct: 322  ATGDFAESNKLGEGGFGAVYKGVLP-DGYEIAVKRLSKSSTQGVEELKNELALVAKLKHK 380

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L+G C    + LLVYE++P+ SLD  LF   +++ L WE R KI++G+   LQYLH
Sbjct: 381  NLVSLVGVCLEQQERLLVYEFVPNRSLDLILFDTEKSEQLDWEKRYKIINGIARGLQYLH 440

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +VVHRDLKASNI+LD N N ++ DFGLAR    ++T     + V GT GY+APE 
Sbjct: 441  EDSQLKVVHRDLKASNILLDVNMNPKISDFGLARIFGRDQTQAVT-KNVIGTYGYMAPEY 499

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
            L  G  + +SD+++FG ++LE+V G++        QS  L+  +W     G +LE VD  
Sbjct: 500  LTRGNYSVKSDVFSFGVMVLEIVTGRKNNHSYNSQQSEDLLTMIWEQWVAGTVLEMVDPS 559

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            +   F   +  R + +GL C       RP  S VV ++LG+  V    P +P
Sbjct: 560  MNSFFSESDVMRCIHIGLLCVQGDPANRPVMSSVV-LMLGTDTVELHAPAKP 610



>gb:AP003811_1833701 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1131_E05.>gb:AP006753_1862872 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0039D04.
          Length = 656

 Score =  211 bits (538), Expect = 2e-53
 Identities = 114/294 (38%), Positives = 176/294 (59%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF     LG+GG+G VYKG L  +G E+A+K    +S +G  +F  E+ ++ +L+HK
Sbjct: 338  ATDNFSANNILGEGGFGPVYKG-LFPDGQELAIKKLGAQSRQGLVEFKNEIQLVAKLQHK 396

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + +L+YEY+P+ SLD  L        L+W+ R KIV G+   L YLH
Sbjct: 397  NLVRLLGCCVHEEQKILIYEYLPNKSLDHFLVDPIRRTSLNWKTRRKIVEGIAQGLLYLH 456

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                 R++HRDLKASNI+LDS  N ++ DFG+AR   ++  S  +   + GT GY+APE 
Sbjct: 457  KHSRLRIIHRDLKASNILLDSELNPKISDFGMARIFPSD-ASRAKASRLVGTFGYMAPEY 515

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
               G  + +SD+++FG +LLE++ G R       G FQ+L+++ W + +DGR  + +D  
Sbjct: 516  ASEGLISIKSDVFSFGVLLLEIMSGTRSAGFQHYGEFQNLLEYAWGMWKDGRWCDFIDQS 575

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
              +++   E  + L++ L C    + ERP  SDVV  +L S  +P   P +PA+
Sbjct: 576  FGDEYEPGEMMKCLVVALMCVQEKSAERPTMSDVV-AMLSSDDIPLTEPKQPAY 628



>gb:AE005173_894228 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC007234_1535642 Genomic sequence
            for Arabidopsis thaliana BAC F1E22, complete sequence.
          Length = 1662

 Score =  211 bits (538), Expect = 2e-53
 Identities = 121/301 (40%), Positives = 178/301 (59%), Gaps = 9/301 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G+VYKG L  +G EIAVK  S+ S +G  +F+ E+ +I +L+H 
Sbjct: 1334 ATNNFSTDNKLGQGGFGIVYKGMLL-DGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHI 1392

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF    +  L+W+ R  I++G+   L YLH
Sbjct: 1393 NLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLH 1452

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD N   ++ DFG+AR    E T       V GT GY++PE 
Sbjct: 1453 QDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETE-ANTRRVVGTYGYMSPEY 1511

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-----LVDWVWFLHRDGRILEAV 707
             + G  + +SD+++FG +LLE++ G+R     G + S     L+ +VW   ++G+ LE V
Sbjct: 1512 AMDGIFSMKSDVFSFGVLLLEIISGKR---NKGFYNSNRDLNLLGFVWRHWKEGKELEIV 1568

Query: 708  D----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
            D      L  +F   E  R + +GL C    A +RP  S V+ ++LGS       P RP 
Sbjct: 1569 DPINIDALSSEFPTHEILRCIQIGLLCVQERAEDRPVMSSVM-VMLGSETTAIPQPKRPG 1627

Query: 876  F 878
            F
Sbjct: 1628 F 1628



 Score =  209 bits (532), Expect = 9e-53
 Identities = 121/301 (40%), Positives = 176/301 (58%), Gaps = 9/301 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G+VYKG L  +G EIAVK  S+ S +G  +F+ E+ +I +L+H 
Sbjct: 515  ATNNFSNDNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHI 573

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF    +  L+W+ R  I++G+   L YLH
Sbjct: 574  NLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLH 633

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD N   ++ DFG+AR    E T       V GT GY++PE 
Sbjct: 634  QDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETE-ANTRRVVGTYGYMSPEY 692

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-----LVDWVWFLHRDGRILEAV 707
             + G  + +SD+++FG +LLE++ G+R     G + S     L+ +VW   ++G  LE V
Sbjct: 693  AMDGIFSMKSDVFSFGVLLLEIISGKR---NKGFYNSNRDLNLLGFVWRHWKEGNELEIV 749

Query: 708  D----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
            D      L   F   E  R + +GL C    A +RP  S V+ ++LGS       P RP 
Sbjct: 750  DPINIDSLSSKFPTHEILRCIQIGLLCVQERAEDRPVMSSVM-VMLGSETTAIPQPKRPG 808

Query: 876  F 878
            F
Sbjct: 809  F 809



>pir|F85057|F85057 receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV13_1544301 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            13.>gb:AY127017_1580471 Arabidopsis thaliana
            AT4g04570/F4H6_9 mRNA, complete cds.>gb:AF074021_1765944
            Arabidopsis thaliana BAC F4H6, chromosome IV, complete
            sequence.
          Length = 654

 Score =  211 bits (538), Expect = 2e-53
 Identities = 118/294 (40%), Positives = 183/294 (62%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F  +  LGQGG+G VYKG     G E+AVK  ++ S +G  +F  E+S++ RL+HK
Sbjct: 344  ATDDFSSENTLGQGGFGTVYKGTFPN-GQEVAVKRLTKGSGQGDMEFKNEVSLLTRLQHK 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG+C+   + +LVYE++P+ SLD  +F   +   L+WE+R +I+ G+   L YLH
Sbjct: 403  NLVKLLGFCNEGDEEILVYEFVPNSSLDHFIFDEDKRSLLTWEVRFRIIEGIARGLLYLH 462

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +++HRDLKASNI+LD+  N ++ DFG AR  D++ T   E + +AGT GY+APE 
Sbjct: 463  EDSQLKIIHRDLKASNILLDAEMNPKVADFGTARLFDSDETR-AETKRIAGTRGYMAPEY 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLK 722
            L  G+ + +SD+Y+FG +LLE++ G+R  +  G  + L  + W    +G+    +D  L 
Sbjct: 522  LNHGQISAKSDVYSFGVMLLEMISGERNNSFEG--EGLAAFAWKRWVEGKPEIIIDPFLI 579

Query: 723  EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            E+    E  +L+ +GL C    + +RP  S V+ I LGS  +    P  PAF W
Sbjct: 580  EN-PRNEIIKLIQIGLLCVQENSTKRPTMSSVI-IWLGSETIIIPLPKAPAFTW 631



>pir|E96641|E96641 hypothetical protein T25B24.4 [imported] -
            Arabidopsis thaliana>gb:AE005173_893831 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533092 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.
          Length = 842

 Score =  211 bits (538), Expect = 2e-53
 Identities = 119/296 (40%), Positives = 179/296 (60%), Gaps = 4/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F E+ KLGQGG+G VYKG  + EG EIAVK  S +S +G  +F  E+ +I +L+H+
Sbjct: 521  ATGDFAEENKLGQGGFGTVYKGNFS-EGREIAVKRLSGKSKQGLEEFKNEILLIAKLQHR 579

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + +L+YEYMP+ SLD+ LF   +   L W  R +++ G+   L YLH
Sbjct: 580  NLVRLLGCCIEDNEKMLLYEYMPNKSLDRFLFDESKQGSLDWRKRWEVIGGIARGLLYLH 639

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRDLKASNI+LD+  N ++ DFG+AR + N R  +     V GT GY+APE 
Sbjct: 640  RDSRLKIIHRDLKASNILLDTEMNPKISDFGMAR-IFNYRQDHANTIRVVGTYGYMAPEY 698

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR----PGTRIGGFQSLVDWVWFLHRDGRILEAVD 710
             + G  +E+SD+Y+FG ++LE+V G++     GT  G   SL+ + W L   G+  E +D
Sbjct: 699  AMEGIFSEKSDVYSFGVLILEIVSGRKNVSFRGTDHG---SLIGYAWHLWSQGKTKEMID 755

Query: 711  IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
              +K+   V EA R + +G+ C+      RP    V+ ++L S      PP +P F
Sbjct: 756  PIVKDTRDVTEAMRCIHVGMLCTQDSVIHRPNMGSVL-LMLESQTSQLPPPRQPTF 810



>gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1058_A12.>gb:AP005810_1858249 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0696F12.
          Length = 624

 Score =  211 bits (537), Expect = 2e-53
 Identities = 123/294 (41%), Positives = 177/294 (60%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E+ KLG+GG+G VYKG L  +G EIAVK  S+ S +G G+   EL+++ +L+HK
Sbjct: 303  ATGCFAERNKLGEGGFGAVYKGTLP-DGDEIAVKRLSKSSAQGVGELKNELALVAKLQHK 361

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G C    + LLVYE++P+ SLDQ LF   +   L W  R KI++G+   LQYLH
Sbjct: 362  NLVRLVGVCLEQEERLLVYEFVPNRSLDQILFDADKRQQLDWGKRYKIINGIARGLQYLH 421

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +VVHRDLKASNI+LD N N ++ DFGLAR    ++T       V GT GY++PE 
Sbjct: 422  EDSQLKVVHRDLKASNILLDMNMNPKISDFGLARLFGRDQTQGVTNL-VIGTYGYMSPEY 480

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG ++LE+V G++        QS  L+  VW       + EAVD  
Sbjct: 481  AMRGNYSLKSDVFSFGVMVLEIVTGKKNNDCYNSLQSEDLLTLVWEQWTARAVSEAVDPV 540

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +   F   +  R + +GL C      +RP  S VV ++LGS  V    P +PAF
Sbjct: 541  MGGGFSWSDVMRCIHIGLLCVQENPADRPVMSSVV-MMLGSDTVSLRAPSKPAF 593



>gb:OSJN00093_1694777 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 1030

 Score =  211 bits (537), Expect = 2e-53
 Identities = 125/288 (43%), Positives = 173/288 (60%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    +LG+GGYG VYKG L  +G  +AVK  S+ S +G+  F  E+  I+R++H+
Sbjct: 690  ATENFSSSNRLGEGGYGTVYKGKLT-DGRVVAVKQLSQTSHQGKKQFATEIETISRVQHR 748

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEYM +GSLD+ LF G E   + W  R +I  G+   L YLH
Sbjct: 749  NLVKLYGCCLEGNNPLLVYEYMENGSLDKALF-GTEKLTIDWPARFEICLGIARGLAYLH 807

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E    VVHRD+KASN+++D+N N ++ DFGLA+  D+++T  +    VAGT GY+APE 
Sbjct: 808  EESSICVVHRDIKASNVLIDANLNPKISDFGLAKLYDDKKTHVS--TKVAGTFGYLAPEY 865

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG---TRIGGFQSLVDWVWFLHRDGRILEAVDI 713
             + G  TE+ D++AFG VLLE + G RP    T       + D  W L+ +   L  VD 
Sbjct: 866  AMRGHMTEKVDVFAFGVVLLETLAG-RPNYDDTLEEDKIYIFDMAWELYENNNPLGLVDP 924

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            +LKE F  EE  R + + L C+    ++R   S VV ++ G V VP+V
Sbjct: 925  KLKE-FNREEVLRAIRVALLCTQWSPHQRAPMSRVVSMLAGDVEVPDV 971



>gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 1025

 Score =  211 bits (537), Expect = 2e-53
 Identities = 125/296 (42%), Positives = 176/296 (59%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    +LG+GGYG VYKG L  +G  +AVK  S+ S +G+  F  E+  I+R++H+
Sbjct: 692  ATENFSSSNRLGEGGYGAVYKGKL-NDGRVVAVKQLSQTSHQGKKQFATEIETISRVQHR 750

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEYM +GSLD+ LF G E   + W  R  I  G+   L YLH
Sbjct: 751  NLVKLYGCCLEGNNPLLVYEYMENGSLDKALF-GIEKLNIDWPARFDICLGIARGLAYLH 809

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   RVVHRD+KASN++LD+N N ++ DFGLA+  D+++T  +    VAGT GY+APE 
Sbjct: 810  EESSIRVVHRDIKASNVLLDANLNPKISDFGLAKLYDDKKTHVS--TKVAGTFGYLAPEY 867

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG---TRIGGFQSLVDWVWFLHRDGRILEAVDI 713
             + G  TE+ D++AFG VLLE + G RP    T       + +W W L+ +   L  VD 
Sbjct: 868  AMRGHMTEKVDVFAFGVVLLETLAG-RPNYDDTLEEDKIYIFEWAWELYENNNPLGIVDP 926

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
             L+E F   E  R + + L C+    ++RP  S VV ++ G   V +V   +P+++
Sbjct: 927  NLRE-FNRAEVLRAIHVALLCTQGSPHQRPPMSRVVSMLTGDTEVTDV-LMKPSYI 980



>gb:AY085009_1570091 Arabidopsis thaliana clone 124301 mRNA,
           complete sequence.
          Length = 393

 Score =  211 bits (537), Expect = 2e-53
 Identities = 116/280 (41%), Positives = 172/280 (61%), Gaps = 4/280 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT++F    ++G GGYGVV+KG L  +G ++AVK  S ES +G  +FL E+++I+ + H 
Sbjct: 42  ATDSFHPTNRIGGGGYGVVFKGVLR-DGTQVAVKSLSAESKQGTREFLTEINLISNIHHP 100

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
           +LVKL+G C      +LVYEY+ + SL   L +G  +   PL W  R  I  G    L +
Sbjct: 101 NLVKLIGCCIEGNNRILVYEYLENNSLASVL-LGSRSRYVPLDWSKRAAICVGTASGLAF 159

Query: 357 LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
           LH E E  VVHRD+KASNI+LDSNF+ ++GDFGLA+   +  T  +    VAGT+GY+AP
Sbjct: 160 LHEEVEPHVVHRDIKASNILLDSNFSPKIGDFGLAKLFPDNVTHVS--TRVAGTVGYLAP 217

Query: 537 ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG--FQSLVDWVWFLHRDGRILEAVD 710
           E  L G+ T+++D+Y+FG ++LEV+ G        G  +  LV+WVW L  + R+LE VD
Sbjct: 218 EYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWVWKLREERRLLECVD 277

Query: 711 IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             L + F  +E  R + + L C+   A +RP    V++++
Sbjct: 278 PELTK-FPADEVTRFIKVALFCTQAAAQKRPNMKQVMEML 316



>gb:ATAC009326_1542913 Arabidopsis thaliana chromosome III P1 MZB10
           genomic sequence, complete sequence.
          Length = 383

 Score =  211 bits (537), Expect = 2e-53
 Identities = 116/280 (41%), Positives = 172/280 (61%), Gaps = 4/280 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT++F    ++G GGYGVV+KG L  +G ++AVK  S ES +G  +FL E+++I+ + H 
Sbjct: 32  ATDSFHPTNRIGGGGYGVVFKGVLR-DGTQVAVKSLSAESKQGTREFLTEINLISNIHHP 90

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
           +LVKL+G C      +LVYEY+ + SL   L +G  +   PL W  R  I  G    L +
Sbjct: 91  NLVKLIGCCIEGNNRILVYEYLENNSLASVL-LGSRSRYVPLDWSKRAAICVGTASGLAF 149

Query: 357 LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
           LH E E  VVHRD+KASNI+LDSNF+ ++GDFGLA+   +  T  +    VAGT+GY+AP
Sbjct: 150 LHEEVEPHVVHRDIKASNILLDSNFSPKIGDFGLAKLFPDNVTHVS--TRVAGTVGYLAP 207

Query: 537 ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG--FQSLVDWVWFLHRDGRILEAVD 710
           E  L G+ T+++D+Y+FG ++LEV+ G        G  +  LV+WVW L  + R+LE VD
Sbjct: 208 EYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWVWKLREERRLLECVD 267

Query: 711 IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             L + F  +E  R + + L C+   A +RP    V++++
Sbjct: 268 PELTK-FPADEVTRFIKVALFCTQAAAQKRPNMKQVMEML 306



>pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_889771 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:F24B9_1677985
            Arabidopsis thaliana chromosome 1 BAC F24B9 sequence,
            complete sequence.
          Length = 554

 Score =  211 bits (536), Expect = 3e-53
 Identities = 121/285 (42%), Positives = 173/285 (60%), Gaps = 7/285 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF   +K+G+GG+G VYKG L+ EG  IAVK  S +S +G  +F+ E+ +I+ L+H 
Sbjct: 214  ATDNFDVTRKIGEGGFGSVYKGELS-EGKLIAVKQLSAKSRQGNREFVNEIGMISALQHP 272

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
            +LVKL G C    +L+LVYEY+ +  L + LF   E+    L W  R KI  G+   L +
Sbjct: 273  NLVKLYGCCVEGNQLILVYEYLENNCLSRALFGKDESSRLKLDWSTRKKIFLGIAKGLTF 332

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E   ++VHRD+KASN++LD + NA++ DFGLA+  D+  T  +    +AGTIGY+AP
Sbjct: 333  LHEESRIKIVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNTHIS--TRIAGTIGYMAP 390

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQ-----RPGTRIGGFQSLVDWVWFLHRDGRILE 701
            E  + G  TE++D+Y+FG V LE+V G+     RP      F  L+DW + L   G +LE
Sbjct: 391  EYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRP---TEDFVYLLDWAYVLQERGSLLE 447

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
             VD  L  D+  EEA  +L + L C++     RP  S VV +I G
Sbjct: 448  LVDPTLASDYSEEEAMLMLNVALMCTNASPTLRPTMSQVVSLIEG 492



>gb:AP003736_1832651 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005786_1857849 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0458H05.
          Length = 711

 Score =  210 bits (535), Expect = 4e-53
 Identities = 125/294 (42%), Positives = 177/294 (60%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E+ KLG+GG+G+VYKG L  EG EIAVK  S+ S +G  +   EL ++ +LRHK
Sbjct: 371  ATDNFAERNKLGEGGFGIVYKGVLP-EGREIAVKRLSQSSRQGIEELKTELVLVAKLRHK 429

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L+G C   G+ LLVYEY+P+ SLD  LF   ++  L W  R  IVSGV   LQYLH
Sbjct: 430  NLVSLVGVCLEEGEKLLVYEYLPNKSLDTILFDYEKSKDLDWGKRLNIVSGVARGLQYLH 489

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + RVVHRDLKASN++LD + N ++ DFGLA+  + ++T       +AGT GY+APE 
Sbjct: 490  EDSQLRVVHRDLKASNVLLDFDHNPKISDFGLAKLFEWDQTQDVTSH-IAGTYGYMAPEY 548

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD ++FG +++E+V G+R  +     QS  L+  VW     G I E +D  
Sbjct: 549  AMRGQYSVKSDAFSFGVLIIEIVTGRRNSSFSNSEQSIDLLSLVWEHWTTGTIEELLDPA 608

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +     V    +L+ +GL C      +RP  S  V ++L S  V    P RP F
Sbjct: 609  IGSR-AVNVLLKLINIGLLCVQDNPADRPAMS-AVNVMLSSDTVSLQAPSRPTF 660



>gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0700A11.
          Length = 494

 Score =  210 bits (535), Expect = 4e-53
 Identities = 116/289 (40%), Positives = 174/289 (60%), Gaps = 13/289 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLA---------GEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT NF  +  LG+GG+G V+KGW+          G GL +AVK  + + ++G  +++AE+
Sbjct: 136 ATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWVAEV 195

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
             +  L+H HLVKL+G+C    + LLVYE+MP GSL+ HLF    + PL W +R +I  G
Sbjct: 196 DFLGNLQHPHLVKLVGYCIEDDQRLLVYEFMPRGSLENHLF--RRSLPLPWAIRMRIALG 253

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLAR-ALDNERTSYTEGEGVA 512
               L +LH E E+ V++RD K SNI+LD+++NA+L DFGLA+   + ++T  +    V 
Sbjct: 254 AAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDGPEGDKTHVS--TRVM 311

Query: 513 GTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHR 683
           GT GY APE ++TG  T +SD+Y+FG VLLE++ G+R     R  G  +LV+W   +L  
Sbjct: 312 GTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMMSGRRSMDKNRPNGEHNLVEWARPYLGE 371

Query: 684 DGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             R    VD RL+ +F +  A++   L  AC +     RP  S VV+++
Sbjct: 372 RRRFYRLVDPRLEGNFSIRGAQKTAQLACACLNRDPKARPLMSQVVEVL 420



>gb:AF084036_1767053 Arabidopsis thaliana receptor-like protein kinase
            (RKS2) gene, complete cds.
          Length = 830

 Score =  210 bits (535), Expect = 4e-53
 Identities = 118/295 (40%), Positives = 174/295 (58%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G VYKG L  EGL+IAVK  SR S +G  +F+ E+ +I++L+H+
Sbjct: 508  ATNNFSITNKLGQGGFGAVYKGRLQ-EGLDIAVKRLSRTSGQGVEEFVNEVFVISKLQHR 566

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYE+MP   LD +LF   +   L W+ R  I+ G+   L YLH
Sbjct: 567  NLVRLLGFCIEGEERMLVYEFMPENCLDAYLFDPVKQRLLDWKTRFNIIDGICRGLMYLH 626

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRDLKASNI+LD N N ++ DFGLAR         +    V GT GY+APE 
Sbjct: 627  RDSRLKIIHRDLKASNILLDENLNPKISDFGLARIFQGNEDEVSTVR-VVGTYGYMAPEY 685

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  +E+SD+++ G +LLE+V G+R  +    G   +L  + W L   G  +  VD  
Sbjct: 686  AMGGLFSEKSDVFSLGVILLEIVSGRRNSSFYNDGQNPNLSAYAWKLWNTGEDIALVDPV 745

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIIL---GSVPVPNVPPFRP 872
            + E+    E +R + +GL C    AN+RP  + V+ ++     ++P P  P F P
Sbjct: 746  IFEECFENEIRRCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQPAFIP 800



>gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.
          Length = 658

 Score =  210 bits (535), Expect = 4e-53
 Identities = 113/291 (38%), Positives = 179/291 (61%), Gaps = 5/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F E  K+GQGG+G VYKG L+ +G E+AVK  S+ S +G+ +F  E+ ++ +L+H+
Sbjct: 333  ATDDFVESNKIGQGGFGEVYKGTLS-DGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHR 391

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYEY+P+ SLD  LF   +   L W  R KI+ GV   + YLH
Sbjct: 392  NLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLH 451

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKASNI+LD++ N ++ DFG+AR    ++T       + GT GY++PE 
Sbjct: 452  QDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSR-IVGTYGYMSPEY 510

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD+Y+FG ++LE++ G++  +  +  G   LV + W L  +GR LE VD  
Sbjct: 511  AMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPA 570

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVP 860
            + E+    E  R + +GL C      ERP  S +V ++     ++PVP  P
Sbjct: 571  IVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 621



>gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complete
            cds.>gb:AK117765_1815781 Arabidopsis thaliana At4g23180
            mRNA for putative receptor-like protein kinase 4 (RLK4),
            complete cds, clone: RAFL17-45-D12.
          Length = 669

 Score =  210 bits (535), Expect = 4e-53
 Identities = 113/291 (38%), Positives = 179/291 (61%), Gaps = 5/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F E  K+GQGG+G VYKG L+ +G E+AVK  S+ S +G+ +F  E+ ++ +L+H+
Sbjct: 344  ATDDFVESNKIGQGGFGEVYKGTLS-DGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHR 402

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYEY+P+ SLD  LF   +   L W  R KI+ GV   + YLH
Sbjct: 403  NLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLH 462

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKASNI+LD++ N ++ DFG+AR    ++T       + GT GY++PE 
Sbjct: 463  QDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSR-IVGTYGYMSPEY 521

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD+Y+FG ++LE++ G++  +  +  G   LV + W L  +GR LE VD  
Sbjct: 522  AMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPA 581

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVP 860
            + E+    E  R + +GL C      ERP  S +V ++     ++PVP  P
Sbjct: 582  IVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 632



>gb:ATF8D20_1551119 Arabidopsis thaliana DNA chromosome 4, BAC clone
           F8D20 (ESSAII project).
          Length = 356

 Score =  210 bits (535), Expect = 4e-53
 Identities = 120/299 (40%), Positives = 177/299 (59%), Gaps = 15/299 (5%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LGQGG+G VY+GW+          G G+ +A+K  + ES++G  ++ +E+
Sbjct: 19  ATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIKRLNSESVQGFAEWRSEV 78

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + +  L H++LVKLLG+C    +LLLVYE+MP GSL+ HLF     DP  W+LR KIV G
Sbjct: 79  NFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLF--RRNDPFPWDLRIKIVIG 136

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH+  ++ V++RD KASNI+LDSN++A+L DFGLA+    +  S+     + G
Sbjct: 137 AARGLAFLHS-LQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTR-IMG 194

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCG--QRPGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG    +SD++AFG VLLE++ G       R  G +SLVDW+   L   
Sbjct: 195 TYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNK 254

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQI---ILGSVPVPN 854
            R+ + +D  +K  +  + A  +  + L+C  P    RP   +VV++   I G   VPN
Sbjct: 255 HRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPN 313



>pir|T04835|T04835 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F21P8.70 - Arabidopsis
            thaliana>gb:ATCHRIV58_1546155 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549620
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 633

 Score =  210 bits (535), Expect = 4e-53
 Identities = 113/291 (38%), Positives = 179/291 (61%), Gaps = 5/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F E  K+GQGG+G VYKG L+ +G E+AVK  S+ S +G+ +F  E+ ++ +L+H+
Sbjct: 308  ATDDFVESNKIGQGGFGEVYKGTLS-DGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHR 366

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYEY+P+ SLD  LF   +   L W  R KI+ GV   + YLH
Sbjct: 367  NLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLH 426

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKASNI+LD++ N ++ DFG+AR    ++T       + GT GY++PE 
Sbjct: 427  QDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSR-IVGTYGYMSPEY 485

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD+Y+FG ++LE++ G++  +  +  G   LV + W L  +GR LE VD  
Sbjct: 486  AMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPA 545

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVP 860
            + E+    E  R + +GL C      ERP  S +V ++     ++PVP  P
Sbjct: 546  IVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 596



>pir|A85041|A85041 probable receptor kinase [imported] - Arabidopsis
            thaliana>gb:AC005275_1532354 Arabidopsis thaliana BAC
            F4C21 from chromosome IV, top arm, near 17 cM, complete
            sequence.>gb:ATCHRIV8_1547304 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 8.
          Length = 852

 Score =  210 bits (535), Expect = 4e-53
 Identities = 126/300 (42%), Positives = 174/300 (58%), Gaps = 7/300 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G VYKG   G+  EIAVK  SR S +G  +F  E+ +I +L+H+
Sbjct: 528  ATSNFSNANKLGQGGFGPVYKGMFPGDQ-EIAVKRLSRCSGQGLEEFKNEVVLIAKLQHR 586

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + LL+YEYMPH SLD  +F       L W++RC I+ G+   L YLH
Sbjct: 587  NLVRLLGYCVAGEEKLLLYEYMPHKSLDFFIFDRKLCQRLDWKMRCNIILGIARGLLYLH 646

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD   N ++ DFGLAR      TS      V GT GY++PE 
Sbjct: 647  QDSRLRIIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSANTNR-VVGTYGYMSPEY 705

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ------SLVDWVWFLHRDGRILEA 704
             L G  + +SD+++FG V++E + G+R      GF       SL+   W L +  R +E 
Sbjct: 706  ALEGLFSFKSDVFSFGVVVIETISGKRN----TGFHEPEKSLSLLGHAWDLWKAERGIEL 761

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP-PFRPAFV 881
            +D  L+E    E   + L +GL C     N+RP  S+VV  +LGS     +P P +PAFV
Sbjct: 762  LDQALQESCETEGFLKCLNVGLLCVQEDPNDRPTMSNVV-FMLGSSEAATLPTPKQPAFV 820



>pir|T04665|T04665 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F8D20.110 - Arabidopsis thaliana (fragment)
          Length = 356

 Score =  210 bits (535), Expect = 4e-53
 Identities = 120/299 (40%), Positives = 177/299 (59%), Gaps = 15/299 (5%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LGQGG+G VY+GW+          G G+ +A+K  + ES++G  ++ +E+
Sbjct: 19  ATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIKRLNSESVQGFAEWRSEV 78

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + +  L H++LVKLLG+C    +LLLVYE+MP GSL+ HLF     DP  W+LR KIV G
Sbjct: 79  NFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLF--RRNDPFPWDLRIKIVIG 136

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH+  ++ V++RD KASNI+LDSN++A+L DFGLA+    +  S+     + G
Sbjct: 137 AARGLAFLHS-LQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTR-IMG 194

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCG--QRPGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG    +SD++AFG VLLE++ G       R  G +SLVDW+   L   
Sbjct: 195 TYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNK 254

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQI---ILGSVPVPN 854
            R+ + +D  +K  +  + A  +  + L+C  P    RP   +VV++   I G   VPN
Sbjct: 255 HRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPN 313



>pir|C85420|C85420 protein kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV83_1547520 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 83.
          Length = 415

 Score =  210 bits (535), Expect = 4e-53
 Identities = 120/299 (40%), Positives = 177/299 (59%), Gaps = 15/299 (5%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LGQGG+G VY+GW+          G G+ +A+K  + ES++G  ++ +E+
Sbjct: 78  ATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIKRLNSESVQGFAEWRSEV 137

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + +  L H++LVKLLG+C    +LLLVYE+MP GSL+ HLF     DP  W+LR KIV G
Sbjct: 138 NFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLF--RRNDPFPWDLRIKIVIG 195

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH+  ++ V++RD KASNI+LDSN++A+L DFGLA+    +  S+     + G
Sbjct: 196 AARGLAFLHS-LQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTR-IMG 253

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCG--QRPGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG    +SD++AFG VLLE++ G       R  G +SLVDW+   L   
Sbjct: 254 TYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNK 313

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQI---ILGSVPVPN 854
            R+ + +D  +K  +  + A  +  + L+C  P    RP   +VV++   I G   VPN
Sbjct: 314 HRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPN 372



>sp|P27450|CX32_ARATH Probable serine/threonine-protein kinase Cx32
           (EC 2.7.1.37).>gb:AY065403_1566514 Arabidopsis thaliana
           putative protein kinase (At4g35600) mRNA, complete
           cds.>gb:AY096501_1576043 Arabidopsis thaliana putative
           protein kinase (At4g35600) mRNA, complete cds.
          Length = 419

 Score =  210 bits (535), Expect = 4e-53
 Identities = 120/299 (40%), Positives = 177/299 (59%), Gaps = 15/299 (5%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LGQGG+G VY+GW+          G G+ +A+K  + ES++G  ++ +E+
Sbjct: 82  ATKNFKPDSMLGQGGFGKVYRGWVDATTLAPSRVGSGMIVAIKRLNSESVQGFAEWRSEV 141

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + +  L H++LVKLLG+C    +LLLVYE+MP GSL+ HLF     DP  W+LR KIV G
Sbjct: 142 NFLGMLSHRNLVKLLGYCREDKELLLVYEFMPKGSLESHLF--RRNDPFPWDLRIKIVIG 199

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH+  ++ V++RD KASNI+LDSN++A+L DFGLA+    +  S+     + G
Sbjct: 200 AARGLAFLHS-LQREVIYRDFKASNILLDSNYDAKLSDFGLAKLGPADEKSHVTTR-IMG 257

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCG--QRPGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG    +SD++AFG VLLE++ G       R  G +SLVDW+   L   
Sbjct: 258 TYGYAAPEYMATGHLYVKSDVFAFGVVLLEIMTGLTAHNTKRPRGQESLVDWLRPELSNK 317

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQI---ILGSVPVPN 854
            R+ + +D  +K  +  + A  +  + L+C  P    RP   +VV++   I G   VPN
Sbjct: 318 HRVKQIMDKGIKGQYTTKVATEMARITLSCIEPDPKNRPHMKEVVEVLEHIQGLNVVPN 376



>gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0073I05.
          Length = 864

 Score =  210 bits (534), Expect = 5e-53
 Identities = 120/297 (40%), Positives = 183/297 (61%), Gaps = 4/297 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  +  LG+GGYG+VYKG L  +G  +AVK  S  S +G+ +F+ E++ I+ ++H+
Sbjct: 514  ATDNFSTQNILGRGGYGLVYKGKLL-DGRMVAVKQLSATSHQGKREFMTEIATISAVQHR 572

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEYM +GSLD+ + +G  +  L W  R +I  G+   L YLH
Sbjct: 573  NLVKLHGCCIESDAPLLVYEYMENGSLDRAI-LGKASLKLDWRTRFEICVGIARGLAYLH 631

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+K SN++LD+N N ++ DFGLAR  ++  T  +   GVAGT+GY+APE 
Sbjct: 632  EESSTRIVHRDIKTSNVLLDANLNPKISDFGLARHYNDSMTHVS--TGVAGTLGYLAPEY 689

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG---TRIGGFQSLVDWVWFLHRDGRILEAVDI 713
             + G  TE++D++AFG V +E++ G RP    +     + L+ W W LH + + LE +D 
Sbjct: 690  AMMGHLTEKADVFAFGIVAMEIIAG-RPNFDDSVEDDKKYLLGWAWCLHENKQPLEILDP 748

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPP-FRPAFV 881
            +L E F  EE  R++ + L C+  + ++RP  S VV I+   +    V    RP+++
Sbjct: 749  KLTE-FNQEEVMRVINVILLCTMGLPHQRPPMSKVVSILTEDIETVEVEANARPSYI 804



>gb:AP000420_1820165 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MZN14.
          Length = 483

 Score =  210 bits (534), Expect = 5e-53
 Identities = 121/307 (39%), Positives = 180/307 (58%), Gaps = 19/307 (6%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLA---------GEGLEIAVKWFSRESIKGQGDFLAEL 155
            AT NF  +  LG+GG+G V+KGW+          G GL +AVK  + + ++G  ++LAE+
Sbjct: 122  ATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEI 181

Query: 156  SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
            + +  L H  LVKL+G+C    + LLVYE+MP GSL+ HLF    T PL W +R KI  G
Sbjct: 182  NFLGNLVHPSLVKLVGYCMEEDQRLLVYEFMPRGSLENHLF--RRTLPLPWSVRMKIALG 239

Query: 336  VGYALQYLHNEFEQRVVHRDLKASNIMLD-------SNFNARLGDFGLARALDNERTSYT 494
                L +LH E E+ V++RD K SNI+LD         +NA+L DFGLA+   +E+ S+ 
Sbjct: 240  AAKGLAFLHEEAEKPVIYRDFKTSNILLDGKKMLPLQEYNAKLSDFGLAKDAPDEKKSHV 299

Query: 495  EGEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWV 668
                V GT GY APE ++TG  T +SD+Y+FG VLLE++ G+R    +R  G Q+LV+WV
Sbjct: 300  STR-VMGTYGYAAPEYVMTGHLTTKSDVYSFGVVLLEILTGRRSVDKSRPNGEQNLVEWV 358

Query: 669  W-FLHRDGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVP 845
               L    R    +D RL+  + ++ A++   +   C +  +  RP+ S+VV+ +    P
Sbjct: 359  RPHLLDKKRFYRLLDPRLEGHYSIKGAQKATQVAAQCLNRDSKARPKMSEVVEAL---KP 415

Query: 846  VPNVPPF 866
            +PN+  F
Sbjct: 416  LPNLKDF 422



>gb:ITU20948_1683300 Ipomoea trifida receptor protein kinase (IRK1)
            mRNA, complete cds.
          Length = 853

 Score =  210 bits (534), Expect = 5e-53
 Identities = 122/301 (40%), Positives = 178/301 (59%), Gaps = 10/301 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF +  KLGQGG+G VYKG + GE  EIAVK  S+ S +G  +F  EL +I RL+H+
Sbjct: 530  ATDNFADVNKLGQGGFGCVYKGMVEGE--EIAVKRLSKNSGQGVEEFKNELRLIARLQHR 587

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + +L+YEYM + SLD  LF    +  L+W+ R  I+ G+   L YLH
Sbjct: 588  NLVRLLGCCVDMEEKILIYEYMENKSLDSTLFNKQRSSLLNWQTRFNIICGIARGLLYLH 647

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASNI+LD   N ++ DFG+AR    + T     + V GT GY++PE 
Sbjct: 648  QDSRFRIIHRDLKASNILLDKEMNPKISDFGMARIFGGDETDANNTKRVVGTYGYMSPEY 707

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQ--RPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG ++LE+V G+  R        Q+L+   W L R+ R  E +D  
Sbjct: 708  AMDGLFSVKSDVFSFGVLVLEIVTGKKNRGFYNQNNQQNLLGHAWRLWRERRGSELLDSA 767

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF----RP 872
            + E + + E  R + +GL C    A +RP  + VV ++LGS    +P P  P F    RP
Sbjct: 768  IGESYSLCEVMRCIQVGLLCVQEQAEDRPNMATVV-LMLGSESATLPQPKHPGFCLGSRP 826

Query: 873  A 875
            A
Sbjct: 827  A 827



>pir|T47793|T47793 receptor-like protein kinase - Arabidopsis
            thaliana>gb:ATF17J16_1548972 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F17J16.
          Length = 512

 Score =  210 bits (534), Expect = 5e-53
 Identities = 120/279 (43%), Positives = 167/279 (59%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F  +  +G+GGYGVVYKG L   G ++AVK       + + +F  E+  I  +RHK
Sbjct: 186  ATNRFAAENVIGEGGYGVVYKGRLIN-GNDVAVKKLLNNLGQAEKEFRVEVEAIGHVRHK 244

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C      +LVYEY+  G+L+Q L    G+   L+WE R KI+ G   AL YL
Sbjct: 245  NLVRLLGYCIEGVNRMLVYEYVNSGNLEQWLHGAMGKQSTLTWEARMKILVGTAQALAYL 304

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H   E +VVHRD+KASNI++D +FNA+L DFGLA+ LD+  +  T    V GT GY+APE
Sbjct: 305  HEAIEPKVVHRDIKASNILIDDDFNAKLSDFGLAKLLDSGESHIT--TRVMGTFGYVAPE 362

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG   E+SDIY+FG +LLE + G+ P    R     +LV+W+  +    R  E VD 
Sbjct: 363  YANTGLLNEKSDIYSFGVLLLETITGRDPVDYERPANEVNLVEWLKMMVGTRRAEEVVDS 422

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            R++        KR LL+ L C  P A +RP+ S VV+++
Sbjct: 423  RIEPPPATRALKRALLVALRCVDPEAQKRPKMSQVVRML 461



>pir|H86246|H86246 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890135 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535685 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 820

 Score =  210 bits (534), Expect = 5e-53
 Identities = 121/295 (41%), Positives = 178/295 (60%), Gaps = 2/295 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF  + KLGQGG+G VYKG L  EG EIAVK  SR S +G  + + E+ +I++L+H+
Sbjct: 505  ATNNFSLRNKLGQGGFGPVYKGKLQ-EGQEIAVKRLSRASGQGLEELVNEVVVISKLQHR 563

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG C    + +LVYE+MP  SLD +LF       L W+ R  I++G+   L YLH
Sbjct: 564  NLVKLLGCCIAGEERMLVYEFMPKKSLDYYLFDSRRAKLLDWKTRFNIINGICRGLLYLH 623

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
             +   R++HRDLKASNI+LD N   ++ DFGLAR    NE  + T    V GT GY+APE
Sbjct: 624  RDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDEANT--RRVVGTYGYMAPE 681

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
              + G  +E+SD+++ G +LLE++ G+R         +L+ +VW +  +G I   VD  +
Sbjct: 682  YAMGGLFSEKSDVFSLGVILLEIISGRRNSN-----STLLAYVWSIWNEGEINSLVDPEI 736

Query: 720  KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP-PFRPAFV 881
             +    +E  + + +GL C    AN+RP  S V  ++  S  + ++P P +PAF+
Sbjct: 737  FDLLFEKEIHKCIHIGLLCVQEAANDRPSVSTVCSML--SSEIADIPEPKQPAFI 789



>sp|Q06548|APKA_ARATH Protein kinase APK1A (EC
           2.7.1.-).>pir|S28615|S28615
           serine/threonine/tyrosine-specific protein kinase APK1
           (EC 2.7.1.-) [validated] - Arabidopsis
           thaliana>gb:ATHAPK1A_1553000 Arabidopsis thaliana APK1
           gene for protein tyrosine-serine-threonine
           kinase.>gb:BT004055_1637164 Arabidopsis thaliana clone
           RAFL15-21-H23 (R20468) putative protein kinase APK1A
           (At1g07570) mRNA, complete cds.>gb:BT005112_1638058
           Arabidopsis thaliana clone U20468 putative protein
           kinase APK1A (At1g07570) mRNA, complete cds.
          Length = 410

 Score =  210 bits (534), Expect = 5e-53
 Identities = 122/286 (42%), Positives = 171/286 (59%), Gaps = 13/286 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT NF     LG+GG+G V+KGW+          G GL IAVK  +++  +G  ++LAE+
Sbjct: 64  ATRNFRPDSVLGEGGFGCVFKGWIDEKSLTASRPGTGLVIAVKKLNQDGWQGHQEWLAEV 123

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGG-ETDPLSWELRCKIVS 332
           + + +  H+HLVKL+G+C      LLVYE+MP GSL+ HLF  G    PLSW+LR K+  
Sbjct: 124 NYLGQFSHRHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGLYFQPLSWKLRLKVAL 183

Query: 333 GVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVA 512
           G    L +LH+  E RV++RD K SNI+LDS +NA+L DFGLA+       S+     V 
Sbjct: 184 GAAKGLAFLHSS-ETRVIYRDFKTSNILLDSEYNAKLSDFGLAKDGPIGDKSHVSTR-VM 241

Query: 513 GTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHR 683
           GT GY APE L TG  T +SD+Y+FG VLLE++ G+R     R  G ++LV+W   +L  
Sbjct: 242 GTHGYAAPEYLATGHLTTKSDVYSFGVVLLELLSGRRAVDKNRPSGERNLVEWAKPYLVN 301

Query: 684 DGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVV 821
             +I   +D RL++ + +EEA ++  L L C       RP  S+VV
Sbjct: 302 KRKIFRVIDNRLQDQYSMEEACKVATLSLRCLTTEIKLRPNMSEVV 347



>gb:AP003811_1833703 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1131_E05.>gb:AP006753_1862874 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBa0039D04.
          Length = 674

 Score =  209 bits (533), Expect = 7e-53
 Identities = 121/294 (41%), Positives = 178/294 (60%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF +  KLGQGG+G VYKG L  +GLEIA+K  S  S++G  +F  E+ +I +L+H 
Sbjct: 352  ATDNFSDACKLGQGGFGPVYKGQLP-DGLEIAIKRLSSCSVQGLMEFKTEIQLIAKLQHT 410

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C +  + +L+YEYM + SLD  +F   +   L+W+ R +I+ G+   L YLH
Sbjct: 411  NLVRLLGCCVQADEKMLIYEYMHNKSLDCFIFDTEKGAMLNWDKRFRIIDGIAQGLLYLH 470

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                 RV+HRDLKASNI+LD   N ++ DFG+AR   +  T       V GT GYIAPE 
Sbjct: 471  KHSRLRVIHRDLKASNILLDREMNPKISDFGMARIFCSNVTE-ANTTRVVGTHGYIAPEY 529

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
               G  + +SD+++FG +LLE++ G+R     + G F +L  + + L ++G+  E VD  
Sbjct: 530  ASEGLFSIKSDVFSFGVLLLEIISGKRTAGFYQYGKFFNLTGYAYQLWQEGQWHELVDQA 589

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L EDF   E  + + + L C    A++RP  SDV+  +LGS  V    P +PA+
Sbjct: 590  LGEDFPAMEVMKCVQVALLCVQDSADDRPNMSDVI-AMLGSEGVTMPEPRQPAY 642



>gb:AF024649_1762137 Arabidopsis thaliana receptor-like
            serine/threonine kinase (RKF2) mRNA, complete cds.
          Length = 617

 Score =  209 bits (533), Expect = 7e-53
 Identities = 117/297 (39%), Positives = 176/297 (59%), Gaps = 4/297 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE+F +  KLGQGG G VYKG L  +G  +AVK     + +    F  E+++I+ ++HK
Sbjct: 315  ATESFHDSMKLGQGGAGSVYKGILP-DGRIVAVKKLFFNTREWADQFFNEVNLISGVQHK 373

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG      K LLVYEY+ + SLDQ LF+      LSW+ R  I+ G+   L+YLH
Sbjct: 374  NLVRLLGCSIEGPKSLLVYEYVHNRSLDQILFMKNTVHILSWKQRFNIIIGISEGLEYLH 433

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
               E +++HRD+K SNI+LD N + ++ DFGL R++  ++T      G+AGT+GY+APE 
Sbjct: 434  RGSEVKIIHRDIKTSNILLDRNLSPKIADFGLIRSMGTDKTQ--TNTGIAGTLGYLAPEY 491

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLK 722
            L+ G+ TE++D+YAFG +++E+V G++      G  S++  VW   +   +  ++D RLK
Sbjct: 492  LIKGQLTEKADVYAFGVLIIEIVTGKKNNAFTQGTSSVLYSVWEHFKANTLDRSIDPRLK 551

Query: 723  EDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIIL----GSVPVPNVPPFRPAFV 881
              FV EEA ++L +GL C       RP +   +  +L         P  PPF  A V
Sbjct: 552  GSFVEEEALKVLQIGLLCVQSSVELRPSSMSEIVFMLQNKDSKFEYPKQPPFLSASV 608



>gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,
           complete cds.>gb:AF367265_1791718 Arabidopsis thaliana
           At1g01540/F22L4_6 mRNA, complete cds.
          Length = 479

 Score =  209 bits (533), Expect = 7e-53
 Identities = 110/279 (39%), Positives = 176/279 (63%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT    E+  +G+GGYG+VY+G L  +G ++AVK       + + +F  E+ +I R+RHK
Sbjct: 150 ATNGLCEENVIGEGGYGIVYRGILT-DGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHK 208

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
           +LV+LLG+C      +LVY+++ +G+L+Q +    G+  PL+W++R  I+ G+   L YL
Sbjct: 209 NLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYL 268

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H   E +VVHRD+K+SNI+LD  +NA++ DFGLA+ L +E +  T    V GT GY+APE
Sbjct: 269 HEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVT--TRVMGTFGYVAPE 326

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TG   E+SDIY+FG +++E++ G+ P   +R  G  +LVDW+  +  + R  E VD 
Sbjct: 327 YACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLKSMVGNRRSEEVVDP 386

Query: 714 RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
           ++ E    +  KR+LL+ L C  P AN+RP+   ++ ++
Sbjct: 387 KIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHML 425



>gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding
           ACS1 locus.>gb:AF332429_1787241 Arabidopsis thaliana
           clone C00102 (h) putative protein serine/threonine
           kinase (At1g01540) mRNA, complete cds.
          Length = 472

 Score =  209 bits (533), Expect = 7e-53
 Identities = 110/279 (39%), Positives = 176/279 (63%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT    E+  +G+GGYG+VY+G L  +G ++AVK       + + +F  E+ +I R+RHK
Sbjct: 150 ATNGLCEENVIGEGGYGIVYRGILT-DGTKVAVKNLLNNRGQAEKEFKVEVEVIGRVRHK 208

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
           +LV+LLG+C      +LVY+++ +G+L+Q +    G+  PL+W++R  I+ G+   L YL
Sbjct: 209 NLVRLLGYCVEGAYRMLVYDFVDNGNLEQWIHGDVGDVSPLTWDIRMNIILGMAKGLAYL 268

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H   E +VVHRD+K+SNI+LD  +NA++ DFGLA+ L +E +  T    V GT GY+APE
Sbjct: 269 HEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVT--TRVMGTFGYVAPE 326

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TG   E+SDIY+FG +++E++ G+ P   +R  G  +LVDW+  +  + R  E VD 
Sbjct: 327 YACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETNLVDWLKSMVGNRRSEEVVDP 386

Query: 714 RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
           ++ E    +  KR+LL+ L C  P AN+RP+   ++ ++
Sbjct: 387 KIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHML 425



>gb:AB006705_1509998 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MTH12.>gb:AY099606_1576631 Arabidopsis thaliana
            serine/threonine-specific protein kinase-like (At5g59670)
            mRNA, complete cds.>gb:BT008803_1639999 Arabidopsis
            thaliana At5g59670 gene, complete cds.
          Length = 868

 Score =  209 bits (533), Expect = 7e-53
 Identities = 109/272 (40%), Positives = 168/272 (61%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKH 185
            T+NF  ++ LG+GG+G+VY G + G   ++AVK  S+ S +G  +F AE+ ++ R+ H +
Sbjct: 563  TKNF--QRVLGKGGFGMVYHGTVKGSE-QVAVKVLSQSSTQGSKEFKAEVDLLLRVHHTN 619

Query: 186  LVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHN 365
            LV L+G+C     L LVYE++P+G L QHL   G    ++W +R +I       L+YLH 
Sbjct: 620  LVSLVGYCCEGDYLALVYEFLPNGDLKQHLSGKGGNSIINWSIRLRIALEAALGLEYLHI 679

Query: 366  EFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECL 545
                 +VHRD+K +NI+LD NF A+L DFGL+R+   E  S  E   +AGT+GY+ PEC 
Sbjct: 680  GCTPPMVHRDVKTANILLDENFKAKLADFGLSRSFQGEGES-QESTTIAGTLGYLDPECY 738

Query: 546  LTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLKE 725
             +G+  E+SD+Y+FG VLLE++  Q    +  G   +  WV F    G ILE +D  L++
Sbjct: 739  HSGRLGEKSDVYSFGIVLLEMITNQPVINQTSGDSHITQWVGFQMNRGDILEIMDPNLRK 798

Query: 726  DFVVEEAKRLLLLGLACSHPIANERPRTSDVV 821
            D+ +  A R L L ++C++P +++RP  S V+
Sbjct: 799  DYNINSAWRALELAMSCAYPSSSKRPSMSQVI 830



>gb:AP004260_1839289 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0011H09.>gb:AP004306_1839942 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0506F02.
          Length = 670

 Score =  209 bits (532), Expect = 9e-53
 Identities = 122/295 (41%), Positives = 176/295 (59%), Gaps = 3/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E  KLG+GG+G VYKG   G G  IAVK  S+ S +G G+   EL +I +L+HK
Sbjct: 334  ATDNFAENNKLGEGGFGEVYKGSFPG-GQTIAVKRLSQSSGQGIGELKNELVLIAKLQHK 392

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G C    + LLVYEYMP+ SLD  LF   +   + W  R  I+ G+   LQYLH
Sbjct: 393  NLVRLVGVCLEQEEKLLVYEYMPNKSLDTFLFDPEKRKQIDWAKRFMIIKGITGGLQYLH 452

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +++HRDLKASN++LD+N N ++ DFGLAR   ++++  T    V GT GY+APE 
Sbjct: 453  EDSQLKIIHRDLKASNVLLDANMNPKISDFGLARLFGDDQSQETTNR-VVGTYGYMAPEY 511

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             L G+ + +SD+Y+FG +LLE++ G++        Q+  L+  VW       I E VD  
Sbjct: 512  ALRGQYSIKSDVYSFGVLLLEIITGRKNSDSYNSEQAVDLLSLVWEHWAMKTITEMVDPY 571

Query: 717  LKED-FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            L+ D   ++E  R + +GL C      +RP T  ++ I+L    V    P RPAF
Sbjct: 572  LRSDSSSLDEILRCIHVGLVCVQEDPMDRP-TLSMINIMLDGNTVSAKAPSRPAF 625



>gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005786_1857851 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0458H05.
          Length = 698

 Score =  209 bits (532), Expect = 9e-53
 Identities = 124/294 (42%), Positives = 178/294 (60%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF ++ KLG+GG+G VYKG L+ EG EIAVK  S+ S +G  +   EL ++ +LRHK
Sbjct: 366  ATDNFADRNKLGEGGFGAVYKGVLS-EGQEIAVKRLSQSSRQGIEELKTELVLVAKLRHK 424

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L+G C    + LLVYEYMP+ SLD  LF   ++  L W  R KIVSGV   LQYLH
Sbjct: 425  NLVSLVGVCLEGDEKLLVYEYMPNKSLDTILFDYEKSKDLDWGKRLKIVSGVARGLQYLH 484

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + RVVHRDLKASN++LD + N ++ DFGLA+  + ++T       +AGT GY+APE 
Sbjct: 485  EDSQLRVVHRDLKASNVLLDFDHNPKISDFGLAKLFEWDQTQDVTSH-IAGTYGYMAPEY 543

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD ++FG ++LE+V G+R  +     QS  L+  VW     G I E +D  
Sbjct: 544  AMRGQYSVKSDAFSFGVMILEIVTGRRNSSFSNSEQSIDLLSLVWEHWTTGTIEELLDPA 603

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            ++     ++  +L+ +GL C      +RP T   V ++L S       P RP F
Sbjct: 604  MR-GRSADDLLKLINIGLLCVQDNPADRP-TMSAVSVMLSSETFSIQAPSRPTF 655



>gb:AC137001_1743353 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0012L23, complete sequence.
          Length = 471

 Score =  209 bits (532), Expect = 9e-53
 Identities = 120/291 (41%), Positives = 172/291 (59%), Gaps = 6/291 (2%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT+ F +   LGQGG+G V++G L   G EIAVK     S +G+ +F AE+ II+R+ HK
Sbjct: 93  ATDGFSDANLLGQGGFGYVHRGVLP-TGKEIAVKQLKVGSGQGEREFQAEVEIISRVHHK 151

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           HLV L+G+C   GK LLVYE++P+ +L+ HL  G     + W  R KI  G    L YLH
Sbjct: 152 HLVSLVGYCISGGKRLLVYEFVPNNTLEFHLH-GKGRPTMEWPTRLKIALGAAKGLAYLH 210

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +   +++HRD+KASNI+LD  F +++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 211 EDCHPKIIHRDIKASNILLDFKFESKVADFGLAKFTSDNNTHVS--TRVMGTFGYLAPEY 268

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGF--QSLVDWVWFL----HRDGRILEA 704
             +GK TE+SD++++G +LLE++ G+RP      +   SLVDW   L      +G   E 
Sbjct: 269 ASSGKLTEKSDVFSYGVMLLELITGRRPVDTSQTYMDDSLVDWARPLLMQALENGNYEEL 328

Query: 705 VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
           VD RL +DF   E  R++    AC    A  RPR S VV+ + G V + ++
Sbjct: 329 VDPRLGKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDL 379



>gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isolate
           20960 putative receptor protein kinase mRNA, partial
           cds.
          Length = 394

 Score =  209 bits (532), Expect = 9e-53
 Identities = 120/291 (41%), Positives = 172/291 (59%), Gaps = 6/291 (2%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT+ F +   LGQGG+G V++G L   G EIAVK     S +G+ +F AE+ II+R+ HK
Sbjct: 16  ATDGFSDANLLGQGGFGYVHRGVLP-TGKEIAVKQLKVGSGQGEREFQAEVEIISRVHHK 74

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           HLV L+G+C   GK LLVYE++P+ +L+ HL  G     + W  R KI  G    L YLH
Sbjct: 75  HLVSLVGYCISGGKRLLVYEFVPNNTLEFHLH-GKGRPTMEWPTRLKIALGAAKGLAYLH 133

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +   +++HRD+KASNI+LD  F +++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 134 EDCHPKIIHRDIKASNILLDFKFESKVADFGLAKFTSDNNTHVS--TRVMGTFGYLAPEY 191

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGF--QSLVDWVWFL----HRDGRILEA 704
             +GK TE+SD++++G +LLE++ G+RP      +   SLVDW   L      +G   E 
Sbjct: 192 ASSGKLTEKSDVFSYGVMLLELITGRRPVDTSQTYMDDSLVDWARPLLMQALENGNYEEL 251

Query: 705 VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
           VD RL +DF   E  R++    AC    A  RPR S VV+ + G V + ++
Sbjct: 252 VDPRLGKDFNPNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLEDL 302



>gb:AB026632_1517029 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F15L12.>gb:BT010577_1640523 Arabidopsis
            thaliana At5g60280 gene, complete cds.
          Length = 657

 Score =  209 bits (532), Expect = 9e-53
 Identities = 124/292 (42%), Positives = 177/292 (60%), Gaps = 2/292 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +   LG+GG+G VYKG L  E  +IAVK FS    +G   F+AE++ +  L H+
Sbjct: 335  ATKGFHKDGFLGKGGFGEVYKGTLPQE--DIAVKRFSHHGERGMKQFVAEIASMGCLDHR 392

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L G+C R G+ LLV +YMP+GSLDQ LF   E   L+W  R  I+ G+  AL+YLH
Sbjct: 393  NLVPLFGYCRRKGEFLLVSKYMPNGSLDQFLFHNREPS-LTWSKRLGILKGIASALKYLH 451

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E  Q V+HRD+KASN+MLD++F  +LGDFG+AR  D+     T   G  GT+GY+ PE 
Sbjct: 452  TEATQVVLHRDIKASNVMLDTDFTGKLGDFGMARFHDHGANPTT--TGAVGTVGYMGPEL 509

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGF--QSLVDWVWFLHRDGRILEAVDIR 716
               G +T ++D+YAFGA++LEV CG+RP         Q LV WV    +   ++ A D +
Sbjct: 510  TSMGAST-KTDVYAFGALILEVTCGRRPVEPNLPIEKQLLVKWVCDCWKRKDLISARDPK 568

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            L  + ++ + + +L LGL C++ +   RP    VVQ +   V +P+  P  P
Sbjct: 569  LSGE-LIPQIEMVLKLGLLCTNLVPESRPDMVKVVQYLDRQVSLPDFSPDSP 619



>gb:AB026632_1517028 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F15L12.>gb:AK175514_1817502 Arabidopsis
            thaliana mRNA for receptor like protein kinase, complete
            cds, clone: RAFL21-93-M15.
          Length = 668

 Score =  209 bits (532), Expect = 9e-53
 Identities = 126/295 (42%), Positives = 177/295 (60%), Gaps = 5/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWL--AGEGLEIAVKWFSRESIKGQGDFLAELSIINRLR 176
            AT+ F   + LG+GG+G VYKG L  + E  E+AVK  S +   G   F+AE+  +  L+
Sbjct: 337  ATKGFNRSEFLGRGGFGEVYKGTLPRSRELREVAVKRVSHDGEHGMKQFVAEIVSMRSLK 396

Query: 177  HKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQY 356
            H+ LV LLG+C R  +LLLV EYMP+GSLD +LF   +   L W  R  I+  +  AL Y
Sbjct: 397  HRSLVPLLGYCRRKHELLLVSEYMPNGSLDHYLF-NHDRLSLPWWRRLAILRDIASALSY 455

Query: 357  LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
            LH E +Q V+HRD+KA+N+MLD+ FN RLGDFG++R  D  R +        GT+GY+AP
Sbjct: 456  LHTEADQVVIHRDIKAANVMLDAEFNGRLGDFGMSRLYD--RGADPSTTAAVGTVGYMAP 513

Query: 537  ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIG---GFQSLVDWVWFLHRDGRILEAV 707
            E L T  A+  +D+YAFG  LLEV CG+RP    G     + L+ WV    +   +++A 
Sbjct: 514  E-LTTMGASTGTDVYAFGVFLLEVTCGRRP-VEPGLPEAKRFLIKWVSECWKRSSLIDAR 571

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRP 872
            D RL E F  +E +++L LGL C++   + RP    VVQ + G++ +P   P  P
Sbjct: 572  DPRLTE-FSSQEVEKVLKLGLLCANLAPDSRPAMEQVVQYLNGNLALPEFWPNSP 625



>pir|C85057|C85057 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:ATCHRIV12_1544298 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            12.>gb:AF076243_1766171 Arabidopsis thaliana BAC T26N6
            from chromosome IV at 19.3 cM, complete sequence.
          Length = 659

 Score =  209 bits (532), Expect = 9e-53
 Identities = 116/296 (39%), Positives = 184/296 (62%), Gaps = 8/296 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  +  LGQGG+G VYKG L   G E+AVK  ++ S +G  +F  E+S++ RL+H+
Sbjct: 349  ATDEFSSENTLGQGGFGTVYKGTLLN-GQEVAVKRLTKGSGQGDIEFKNEVSLLTRLQHR 407

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG+C+   + +LVYE++P+ SLD  +F   +   L+WE+R +I+ G+   L YLH
Sbjct: 408  NLVKLLGFCNEGDEQILVYEFVPNSSLDHFIFDDEKRSLLTWEMRYRIIEGIARGLLYLH 467

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +++HRDLKASNI+LD+  N ++ DFG AR  D++ T   E + +AGT GY+APE 
Sbjct: 468  EDSQLKIIHRDLKASNILLDAEMNPKVADFGTARLFDSDETR-AETKRIAGTRGYMAPEY 526

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLK 722
            L  G+ + +SD+Y+FG +LLE++ G+R  +  G  + L  + W    +G+    +D    
Sbjct: 527  LNHGQISAKSDVYSFGVMLLEMISGERNNSFEG--EGLAAFAWKRWVEGKPEIIID---- 580

Query: 723  EDFVVEEAK----RLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
              F++E+ +    +L+ +GL C      +RP  S V+ I LGS    +P+P  P F
Sbjct: 581  -PFLIEKPRNEIIKLIQIGLLCVQENPTKRPTMSSVI-IWLGSETNIIPLPKAPAF 634



>pir|S70769|S70769 S-receptor kinase (EC 2.7.1.-) Ark1 precursor -
            Arabidopsis thaliana>gb:ATHDNA_1553150 Arabidopsis
            thaliana receptor kinase (Ark1) gene, exons 1-7.
          Length = 843

 Score =  209 bits (532), Expect = 9e-53
 Identities = 121/301 (40%), Positives = 176/301 (58%), Gaps = 9/301 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G+VYKG L  +G EIAVK  S+ S +G  +F+ E+ +I +L+H 
Sbjct: 515  ATNNFSNDNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKMSSQGTDEFMNEVRLIAKLQHI 573

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF    +  L+W+ R  I++G+   L YLH
Sbjct: 574  NLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDQTRSSNLNWQKRFDIINGIARGLLYLH 633

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD N   ++ DFG+AR    E T       V GT GY++PE 
Sbjct: 634  QDSRCRIIHRDLKASNVLLDKNMTPKISDFGMARIFGREETE-ANTRRVVGTYGYMSPEY 692

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-----LVDWVWFLHRDGRILEAV 707
             + G  + +SD+++FG +LLE++ G+R     G + S     L+ +VW   ++G  LE V
Sbjct: 693  AMDGIFSMKSDVFSFGVLLLEIISGKR---NKGFYNSNRDLNLLGFVWRHWKEGNELEIV 749

Query: 708  D----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPA 875
            D      L   F   E  R + +GL C    A +RP  S V+ ++LGS       P RP 
Sbjct: 750  DPINIDSLSSKFPTHEILRCIQIGLLCVQERAEDRPVMSSVM-VMLGSETTAIPQPKRPG 808

Query: 876  F 878
            F
Sbjct: 809  F 809



>gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1014_H11.
          Length = 1024

 Score =  209 bits (531), Expect = 1e-52
 Identities = 121/288 (42%), Positives = 175/288 (60%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  +  LG+GGYG VYKG L  +G  IAVK  S+ S +G+  F+ E++ I+ ++H+
Sbjct: 687  ATDNFSSQNILGEGGYGPVYKGVLP-DGRVIAVKQLSQSSHQGKSQFVTEVATISAVQHR 745

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEY+ +GSLD+ LF G  +  L W  R +I+ G+   L YLH
Sbjct: 746  NLVKLHGCCIDSNTPLLVYEYLKNGSLDKALF-GNGSIKLDWATRFEIILGIARGLTYLH 804

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASN++LD++   ++ DFGLA+  D ++T  +   G+AGT GY+APE 
Sbjct: 805  EESSVRIVHRDIKASNVLLDTDLTPKISDFGLAKLYDEKKTHVS--TGIAGTFGYLAPEY 862

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
             +    TE+ D++AFG V LE+V G R  T     +S   L +W W L+   + L  VD 
Sbjct: 863  AMRRHLTEKVDVFAFGVVALEIVAG-RSNTDNSLEESKIYLFEWAWSLYEKEQALGIVDP 921

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            RL E+F  +E  R++ + L C+     +RP  S VV ++ G V V  V
Sbjct: 922  RL-EEFSRDEVYRVIHVALICTQGSPYQRPPMSKVVAMLTGDVEVAEV 968



>gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0439B06.
          Length = 698

 Score =  209 bits (531), Expect = 1e-52
 Identities = 117/281 (41%), Positives = 173/281 (61%), Gaps = 6/281 (2%)
 Frame = +3

Query: 6    TENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHKH 185
            T  F  K  LG+GG+G VYKG LA +G E+AVK       +G+ +F AE+ II+R+ H+H
Sbjct: 357  TNGFAAKNLLGEGGFGSVYKGCLA-DGREVAVKKLKGGGGQGEREFQAEVEIISRVHHRH 415

Query: 186  LVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLHN 365
            LV L+G+C    + LLVY+++P+ +L  HL  G     L W  R KI +G    + YLH 
Sbjct: 416  LVSLVGYCISGDQRLLVYDFVPNDTLHHHLH-GRGMPVLEWSARVKIAAGSARGIAYLHE 474

Query: 366  EFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPECL 545
            +   R++HRD+K+SNI+LD+NF A++ DFGLAR   +  T  T    V GT GY+APE  
Sbjct: 475  DCHPRIIHRDIKSSNILLDNNFEAQVADFGLARLAMDAVTHVT--TRVMGTFGYLAPEYA 532

Query: 546  LTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRD----GRILEAV 707
             +GK TE+SD+++FG VLLE++ G++P   ++  G +SLV+W   L  +    G + E +
Sbjct: 533  SSGKLTERSDVFSFGVVLLELITGRKPVDASKPLGDESLVEWARPLLTEAIETGNVGELI 592

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            D RL ++F   E  R++    AC    A+ RPR S VV+++
Sbjct: 593  DSRLDKNFNEAEMFRMIEAAAACIRHSASRRPRMSQVVRVL 633



>gb:AJ704376_1813563 Senecio squalidus mRNA for S-receptor kinase-like
            protein 1 (rlk1 gene).
          Length = 637

 Score =  208 bits (530), Expect = 1e-52
 Identities = 119/294 (40%), Positives = 176/294 (59%), Gaps = 6/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F  + KLGQGG+G VYKG L+ +G EIA+K  SR S +G  +F  EL +I +L+H 
Sbjct: 316  ATNDFSVENKLGQGGFGPVYKGKLS-DGREIAIKRLSRTSGQGLVEFKNELILIAKLQHT 374

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEYMP+ SLD  LF       L W  R  I+ G+   L YLH
Sbjct: 375  NLVRVLGCCIHGEEKMLIYEYMPNKSLDFFLFDENRKAELDWPKRFNIIEGIAQGLLYLH 434

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
                 RV+HRDLKA+NI+LD N N ++ DFG+AR   +NE  + T    V GT GY++PE
Sbjct: 435  KYSRMRVIHRDLKANNILLDENLNPKISDFGMARIFKENETEAMT--NRVVGTYGYMSPE 492

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDI 713
              + G  + +SDI++FG ++LE+V G++  +   +    +L+ + W L + G  LE  D 
Sbjct: 493  YAMEGTFSIKSDIFSFGVLMLEIVTGRKNTSFVHLDRTFNLIGYAWELWQQGDTLELKDP 552

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVPPF 866
             L E   +++  R + + L C    A +RP TSD++ ++L    S+P PN P F
Sbjct: 553  TLGETCGIQQFLRSVHVALLCVQESATDRPTTSDMISMLLNDTISLPTPNKPAF 606



>gb:AF403127_1796415 Oryza sativa S-locus receptor-like kinase RLK13
            (RLK13) mRNA, complete cds.
          Length = 813

 Score =  208 bits (530), Expect = 1e-52
 Identities = 112/299 (37%), Positives = 174/299 (58%), Gaps = 5/299 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF +   LG+GG+G VYKG L G G E+AVK  S+ S +G  +F  E+ +I +L+H+
Sbjct: 493  ATNNFSDHNMLGKGGFGKVYKGVLEG-GKEVAVKRLSKGSQQGVEEFRNEVVLIAKLQHR 551

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+ +C    + LL+YEY+P+ SLD  LF       L W  R  I+ G+   L YLH
Sbjct: 552  NLVRLISYCIHEDEKLLIYEYLPNKSLDTFLFDAKRKSVLDWTTRFMIIKGIARGLLYLH 611

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKASNI+LD+N + ++ DFG+AR  +  +        V GT GY++PE 
Sbjct: 612  QDSRLTIIHRDLKASNILLDTNMSPKISDFGMARIFEGNKQQENTTR-VVGTYGYMSPEY 670

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             L G  + +SD Y+FG +LLE+V G +  +   I  FQ+L+ + W L +DG  ++ VD  
Sbjct: 671  ALEGSFSVKSDTYSFGVLLLELVSGLKISSPHLIMDFQNLITFAWSLWKDGNAMDLVDSS 730

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII---LGSVPVPNVPPFRPAFVW 884
            ++E  ++ E  R + + L+C       RP  S +V ++     ++P P  P +  A V+
Sbjct: 731  IRESCLLHEVLRCIQIALSCVQDDPTARPLMSSIVFMLENETAALPTPKEPAYLTAMVY 789



>gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 670

 Score =  208 bits (529), Expect = 2e-52
 Identities = 119/294 (40%), Positives = 175/294 (59%), Gaps = 2/294 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF +  KLG+GG+G VYKG L  +  EIAVK  S+ S +G  +   EL ++ +L+HK
Sbjct: 356  ATNNFDDSNKLGEGGFGAVYKGVLPSDQ-EIAVKRLSQSSRQGIEELKNELVLVAKLQHK 414

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + LLVYEYMP+ SLD  LF    ++ L W  R KIV+ +   LQYLH
Sbjct: 415  NLVRLLGVCLEEHEKLLVYEYMPNKSLDTILFDPDRSNVLDWWKRLKIVNAIARGLQYLH 474

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + +++HRDLKASN++LDS+FN ++ DFGLAR   N+++       V GT GY+APE 
Sbjct: 475  EDSQLKIIHRDLKASNVLLDSDFNPKISDFGLARLFGNDQSQDVTNR-VVGTYGYMAPEY 533

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG ++LE+V G++        QS  L+  VW     G ++E  D  
Sbjct: 534  AMRGHYSIKSDVFSFGVLILEIVTGRKNNVSYDSEQSVDLLTLVWEHWLAGTVVELADSS 593

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            +      ++  + + +GL C      ERP  S +V ++L S  V    P RPAF
Sbjct: 594  MAGHCPGDQILKCVHIGLLCVQEDPTERPMMS-MVNVMLSSSTVSLQAPSRPAF 646



>pir|T10567|T10567 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F25E4.90 - Arabidopsis
            thaliana>gb:ATCHRIV32_1544912 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549984
            Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
            (ESSA project).
          Length = 666

 Score =  208 bits (529), Expect = 2e-52
 Identities = 117/296 (39%), Positives = 175/296 (59%), Gaps = 8/296 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF    KLGQGG+G VYKG L  E  EIAVK  S  S +G  +F  E+ I+ +L+HK
Sbjct: 335  ATDNFSRNNKLGQGGFGEVYKGMLPNE-TEIAVKRLSSNSGQGTQEFKNEVVIVAKLQHK 393

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYE++ + SLD  LF       L W+ R  I+ GV   L YLH
Sbjct: 394  NLVRLLGFCIERDEQILVYEFVSNKSLDYFLFDPKMKSQLDWKRRYNIIGGVTRGLLYLH 453

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRD+KASNI+LD++ N ++ DFG+AR    ++T    G  V GT GY+ PE 
Sbjct: 454  QDSRLTIIHRDIKASNILLDADMNPKIADFGMARNFRVDQTEDQTGR-VVGTFGYMPPEY 512

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI-----GGFQSLVDWVWFLHRDGRILEAV 707
            +  G+ + +SD+Y+FG ++LE+VCG++  +       GG  +LV  VW L  +   L+ +
Sbjct: 513  VTHGQFSTKSDVYSFGVLILEIVCGKKNSSFFQMDDSGG--NLVTHVWRLWNNDSPLDLI 570

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS---VPVPNVPPF 866
            D  +KE +  +E  R + +G+ C      +RP  S + Q++  S   +PVP  P F
Sbjct: 571  DPAIKESYDNDEVIRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGF 626



>pir|T04837|T04837 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) F21P8.90 - Arabidopsis
            thaliana>gb:ATCHRIV58_1546157 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549622
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 648

 Score =  208 bits (529), Expect = 2e-52
 Identities = 113/298 (37%), Positives = 179/298 (60%), Gaps = 3/298 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF +  KLGQGG+G VYKG L   G E+AVK  S+ S +G  +F  E+ ++ +L+H+
Sbjct: 321  ATENFAKTNKLGQGGFGEVYKGTLVN-GTEVAVKRLSKTSEQGAQEFKNEVVLVAKLQHR 379

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG+C    + +LVYE++P+ SLD  LF   +   L W  R  I+ G+   + YLH
Sbjct: 380  NLVKLLGYCLEPEEKILVYEFVPNKSLDYFLFDPTKQGQLDWTKRYNIIGGITRGILYLH 439

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKASNI+LD++   ++ DFG+AR +     S    + +AGT GY+ PE 
Sbjct: 440  QDSRLTIIHRDLKASNILLDADMIPKIADFGMAR-ISGIDQSVANTKRIAGTFGYMPPEY 498

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG---FQSLVDWVWFLHRDGRILEAVDI 713
            ++ G+ + +SD+Y+FG ++LE++CG++  +        ++LV +VW L  +G  LE VD+
Sbjct: 499  VIHGQFSMKSDVYSFGVLILEIICGKKNRSFYQADTKAENLVTYVWRLWTNGSPLELVDL 558

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVWP 887
             + E+   EE  R + + L C      +RP  S ++ ++  S  + +VP   P F  P
Sbjct: 559  TISENCQTEEVIRCIHIALLCVQEDPKDRPNLSTIMMMLTNSSLILSVPQ-PPGFFVP 615



>pir|JQ1677|JQ1677 S-receptor kinase (EC 2.7.1.-) precursor -
            rape>gb:BNA245479_1633290 Brassica napus subsp. napus
            Sll3, slk, srk, CePP, Fmt, SIAH1, AtPP, SIAH2, & ClpP
            genes.>gb:BNASTKR_1633495 Brassica napus ssp. oleifera
            serine/threonine kinase receptor mRNA, complete cds.
          Length = 858

 Score =  208 bits (529), Expect = 2e-52
 Identities = 120/301 (39%), Positives = 176/301 (58%), Gaps = 13/301 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G G+F+ E+ +I RL+H 
Sbjct: 525  ATENFSNCNKLGQGGFGIVYKGRLL-DGQEIAVKRLSKTSVQGTGEFMNEVRLIARLQHI 583

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +LVYEY+ + SLD +LF    +  L+W+ R  I +GV   L YLH
Sbjct: 584  NLVRILGCCIEADEKMLVYEYLENLSLDSYLFGNKRSSTLNWKDRFNITNGVARGLLYLH 643

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRD+K SNI+LD N   ++ DFG+AR    + T       V GT GY++PE 
Sbjct: 644  QDSRFRIIHRDMKVSNILLDKNMTPKISDFGMARIFARDETE-ANTRKVVGTYGYMSPEY 702

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVD-- 710
             + G  +E+SD+++FG ++LE+V G+R      +    +L+ +VW    +GR LE VD  
Sbjct: 703  AMDGVFSEKSDVFSFGVIVLEIVSGKRNRGFYNLNHENNLLSYVWSHWTEGRALEIVDPV 762

Query: 711  -----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPP 863
                   L   F  +E  + + +GL C    A  RP  S VV  +LGS    +P P  P 
Sbjct: 763  IVDSLSSLPATFQPKEVLKCIQIGLLCVQERAEHRPTMSSVVW-MLGSEATEIPQPTPPG 821

Query: 864  F 866
            +
Sbjct: 822  Y 822



>gb:AC135205_1742004 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1012B02, complete sequence.
          Length = 392

 Score =  207 bits (528), Expect = 3e-52
 Identities = 116/280 (41%), Positives = 168/280 (60%), Gaps = 4/280 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT NF     +G+GG+G VYKG L  +G +IA+K  S ES +G  +FL E+++I+ +RH 
Sbjct: 51  ATRNFHMMNCVGRGGFGAVYKGNLK-DGTQIAIKKLSAESKQGANEFLTEINVISNVRHP 109

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELRCKIVSGVGYALQY 356
           +LVKL+G C      LLVYEY  + SL  H  +G  +   PL+W+ R  I  G    L +
Sbjct: 110 NLVKLIGCCVEGTNRLLVYEYAENNSL-AHALLGPRSRCIPLNWQKRAAICIGTASGLAF 168

Query: 357 LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAP 536
           LH E + R+VHRD+KASNI+LD     ++GDFGLA+   +  T  +    VAGT+GY+AP
Sbjct: 169 LHEEAQPRIVHRDIKASNILLDKKLLPKIGDFGLAKLFPDTITHIS--TRVAGTMGYLAP 226

Query: 537 ECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG--FQSLVDWVWFLHRDGRILEAVD 710
           E  L G+ T+++DIY+FG ++LEV+ G+       G     LV+W W L   GR+LE VD
Sbjct: 227 EYALLGQLTKKADIYSFGVLVLEVISGESSSKSTWGQDMNVLVEWTWKLREQGRLLEIVD 286

Query: 711 IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
             L E++  EE  R + + L C+   + +RP    VV ++
Sbjct: 287 PEL-EEYPEEEMLRFIKVALVCTQATSQQRPSMKQVVDML 325



>pir|A86247|A86247 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890136 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535684 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 820

 Score =  207 bits (528), Expect = 3e-52
 Identities = 117/294 (39%), Positives = 173/294 (58%), Gaps = 4/294 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF    KLGQGG+G VYKG L  EG EIAVK  S+ S +G  + + E+ +I++L+H+
Sbjct: 505  ATDNFSLSNKLGQGGFGPVYKGMLL-EGQEIAVKRLSQASGQGLEELVTEVVVISKLQHR 563

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    + +LVYE+MP  SLD ++F   E   L W  R +I++G+   L YLH
Sbjct: 564  NLVKLFGCCIAGEERMLVYEFMPKKSLDFYIFDPREAKLLDWNTRFEIINGICRGLLYLH 623

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
             +   R++HRDLKASNI+LD N   ++ DFGLAR    NE  + T    V GT GY+APE
Sbjct: 624  RDSRLRIIHRDLKASNILLDENLIPKISDFGLARIFPGNEDEANT--RRVVGTYGYMAPE 681

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
              + G  +E+SD+++ G +LLE++ G+R         +L+  VW +  +G I   VD  +
Sbjct: 682  YAMGGLFSEKSDVFSLGVILLEIISGRR-----NSHSTLLAHVWSIWNEGEINGMVDPEI 736

Query: 720  KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII---LGSVPVPNVPPFRP 872
             +    +E ++ + + L C    AN+RP  S V  ++   +  +P P  P F P
Sbjct: 737  FDQLFEKEIRKCVHIALLCVQDAANDRPSVSTVCMMLSSEVADIPEPKQPAFMP 790



>gb:AP004768_1844703 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0010C01.>gb:AP005513_1853210 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0014E22.
          Length = 447

 Score =  207 bits (527), Expect = 3e-52
 Identities = 117/296 (39%), Positives = 169/296 (57%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT NF +  K+G+GG+G VYKG    +G   A K  S ES +G  +FL E+  I   +H 
Sbjct: 35  ATNNFDDGNKIGRGGFGTVYKGTFE-DGTAFAAKVLSAESEQGINEFLTEIESITEAKHA 93

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHL--FIGGETDPLSWELRCKIVSGVGYALQY 356
           +LV+LLG C +    +L+YEY+ + SLD  L     G TD LSW  R  I  GV   L Y
Sbjct: 94  NLVRLLGCCVQRQNRILIYEYVENNSLDNALQGSAAGVTD-LSWSTRSDICMGVAKGLSY 152

Query: 357 LHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIA 533
           LH E E  +VHRD+KASN++LD N+  ++GDFG+A+   DN     T    V GT GY+A
Sbjct: 153 LHEEHEPSIVHRDIKASNVLLDRNYIPKIGDFGIAKLFPDNVSHVSTR---VIGTTGYMA 209

Query: 534 PECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
           PE ++ G+ T+++D+Y+FG ++LE++ G+R    I     LV   W LH  G +L+ VD 
Sbjct: 210 PEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGMFLVRQAWMLHEQGSLLDMVDP 269

Query: 714 RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            +K  +  EEA + + + LAC+      RP    VV+++   V +  +    P FV
Sbjct: 270 SMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKLLSRPVCLEELEMLCPGFV 325



>gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005156_1848347 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OJ1729_E01.
          Length = 657

 Score =  207 bits (527), Expect = 3e-52
 Identities = 109/290 (37%), Positives = 180/290 (62%), Gaps = 2/290 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E KKLG+GG+G VYKG L G+  E+AVK  ++ S +G  +   EL ++ +L HK
Sbjct: 347  ATDNFHESKKLGEGGFGAVYKGLLFGQ--EVAVKRLAKGSNQGLEELKNELVLVAKLHHK 404

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G+C   G+ LLVY+Y+P+ SLD  LF   ++  L W  R KI+ G+   LQYLH
Sbjct: 405  NLVRLVGFCLEEGERLLVYKYIPNKSLDIFLFDSEQSRQLDWATRFKIIEGIARGLQYLH 464

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + +++++HRD+KASN++LD++ N ++GDFGLAR    ++T       + GT GY++PE 
Sbjct: 465  QDSQKKIIHRDMKASNVLLDADMNPKIGDFGLARLFGQDQTRDVTNR-IVGTFGYMSPEY 523

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTR--IGGFQSLVDWVWFLHRDGRILEAVDIR 716
            ++ G+ + +SD+++FG +++E+V G+R      +   + L+  V     +G I+E  D  
Sbjct: 524  VIRGQYSTKSDVFSFGILVIEIVTGRRNSGPHFLEQNEDLISIVRRHWEEGNIVEMTDHS 583

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF 866
            L  ++   E  + + +GL C      +RP  +DV+ ++L S     +P F
Sbjct: 584  LGRNYPEAELLKCVSIGLLCVQQNPVDRPTMADVM-VLLNSDATSTLPAF 632



>gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0452F10.
          Length = 597

 Score =  207 bits (527), Expect = 3e-52
 Identities = 117/291 (40%), Positives = 172/291 (59%), Gaps = 6/291 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F +   LGQGG+G V+KG L   G E+AVK     S +G+ +F AE+ II+R+ HK
Sbjct: 219  ATDGFSDANLLGQGGFGYVHKGVLPN-GTEVAVKQLRDGSGQGEREFQAEVEIISRVHHK 277

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            HLV L+G+C   GK LLVYEY+P+ +L+ HL  G     + W  R +I  G    L YLH
Sbjct: 278  HLVTLVGYCISGGKRLLVYEYVPNNTLELHLH-GRGRPTMEWPTRLRIALGAAKGLAYLH 336

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRD+K++NI+LD+ F A++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 337  EDCHPKIIHRDIKSANILLDARFEAKVADFGLAKLTSDNNTHVS--TRVMGTFGYLAPEY 394

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFL----HRDGRILEA 704
              +G+ TE+SD+++FG +LLE++ G+RP    +     SLVDW   L      DG     
Sbjct: 395  ASSGQLTEKSDVFSFGVMLLELITGRRPVRSNQSQMDDSLVDWARPLMMRASDDGNYDAL 454

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            VD RL +++   E  R++    AC    A  RPR S VV+ + G V + ++
Sbjct: 455  VDPRLGQEYNGNEMARMIACAAACVRHSARRRPRMSQVVRALEGDVSLDDL 505



>pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 -
            turnip>gb:AB008191_1510363 Brassica rapa mRNA for SRK29,
            complete cds.
          Length = 854

 Score =  207 bits (527), Expect = 3e-52
 Identities = 117/298 (39%), Positives = 179/298 (60%), Gaps = 10/298 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE+F +  K+G+GG+GVVYKG L  +G EIAVK  S  S +G  +F+ E+ +I +L+H 
Sbjct: 529  ATEHFSDFNKVGKGGFGVVYKGRLV-DGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHN 587

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF G  +  L+W++R  I++G+   L YLH
Sbjct: 588  NLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDGSRSCKLNWQMRFDIINGIARGLLYLH 647

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD +   ++ DFG+AR    + T   +   V GT GY++PE 
Sbjct: 648  QDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE-ADTRKVVGTYGYMSPEY 706

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG +LLE++ G+R         S  L+  VW   ++G+ LE VD  
Sbjct: 707  AMNGTFSMKSDVFSFGVLLLEIISGKRNKGFCDSDSSLNLLGCVWRNWKEGQGLEIVDRV 766

Query: 717  LKED----FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
            + +     F   E  R L +GL C      +RP  S VV ++LGS    +P P  P +
Sbjct: 767  IIDSSSPTFRPSEISRCLQIGLLCVQERVEDRPMMSSVV-LMLGSEAALIPQPKQPGY 823



>pir|S51527|S51527 S-receptor kinase (EC 2.7.1.-) A14 precursor -
            rape>gb:BNU00443_1633646 Brassica napus cultivar T2
            S-receptor kinase mRNA, complete cds.
          Length = 849

 Score =  207 bits (527), Expect = 3e-52
 Identities = 115/294 (39%), Positives = 175/294 (59%), Gaps = 8/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 521  ATENFSNCNKLGQGGFGIVYKGRLL-DGQEIAVKRLSKTSVQGTDEFMNEVTLIARLQHI 579

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+++G C    + +LVYEY+ + SLD +LF       L+W+ R  I++GV   L YLH
Sbjct: 580  NLVQIIGCCIEADEKMLVYEYLENLSLDSYLFGKTRRSKLNWKERFDIINGVARGLLYLH 639

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T     + V GT GY++PE 
Sbjct: 640  QDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFARDETEANTVK-VVGTYGYMSPEY 698

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVD---- 710
             +    +E+SD+++FG ++LE+V G++    +    +L+ + W    +GR LE +D    
Sbjct: 699  AMHEIFSEKSDVFSFGVIVLEIVSGKKNSYNLNYKNNLLSYAWSQWEEGRALEIIDPVIV 758

Query: 711  IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVP 860
              L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P  P
Sbjct: 759  DSLPSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVW-MLGSEAKEIPQPKQP 811



>gb:AP003990_1836012 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1073_F05.>gb:AP004000_1836159 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1115_B01.
          Length = 377

 Score =  207 bits (526), Expect = 4e-52
 Identities = 114/281 (40%), Positives = 168/281 (59%), Gaps = 3/281 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT NF    KLG+GG+G VY G L  +G +IAVK     S K + +F  E+ ++  +RHK
Sbjct: 37  ATNNFNYDNKLGEGGFGSVYWGQL-WDGSQIAVKRLKSWSNKAETEFAIEVEVLATVRHK 95

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD-PLSWELRCKIVSGVGYALQYL 359
            L+ L G+C    + L+VY+YMP+ SL  HL      +  L WE R KI       + YL
Sbjct: 96  SLLSLRGYCAEGQERLIVYDYMPNLSLHSHLHGQHAAECHLGWERRMKIAIDSAEGIAYL 155

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H++    ++HRD+K+SN++LD NF AR+ DFG A+ + +  T  T    V GT+GY+APE
Sbjct: 156 HHQATPHIIHRDIKSSNVLLDKNFQARVADFGFAKLIPDGATHVT--TKVKGTLGYLAPE 213

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSL--VDWVWFLHRDGRILEAVDI 713
             + GKA+E  D+++FG +LLE+  G+RP  ++     L   +W   L RD +  E  D 
Sbjct: 214 YAMLGKASESCDVFSFGVLLLELASGKRPVEKLNPTTKLTITEWALPLARDKKFKEIADP 273

Query: 714 RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG 836
           +LK+ FV  E KR++L+GLACS     +RP  S+VV+++ G
Sbjct: 274 KLKDVFVEAELKRMVLVGLACSQNKQEQRPIMSEVVELLKG 314



>gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0022B03, complete
            sequence.>gb:AC137615_1743589 Genomic sequence for Oryza
            sativa, Nipponbare strain, clone OSJNBa0053F13, from
            chromosome 5, complete sequence.
          Length = 870

 Score =  207 bits (526), Expect = 4e-52
 Identities = 122/296 (41%), Positives = 181/296 (61%), Gaps = 3/296 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  +  LG+GG+G VYKG L  E + IAVK  S+ S +G   F+ E++ I+ ++H+
Sbjct: 565  ATDNFNSQNILGEGGFGPVYKGKLPDERV-IAVKQLSQSSHQGTSQFVTEVATISAVQHR 623

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L G C      LLVYEY+ +GSLD+ +F G     L W +R +I+ G+   L YLH
Sbjct: 624  NLVILHGCCIDSKTPLLVYEYLENGSLDRAIF-GDSNLNLDWVMRFEIILGIARGLIYLH 682

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   R+VHRD+KASN++LD+N   ++ DFGLA+  D  +T  +    +AGT+GY+APE 
Sbjct: 683  EESSIRIVHRDIKASNVLLDTNLVPKISDFGLAKLYDENQTHVS--TRIAGTLGYLAPEY 740

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS---LVDWVWFLHRDGRILEAVDI 713
             + G  +E++DI+AFG V+LE V G RP T     +S   L++W W L+   + L  VD 
Sbjct: 741  AMRGHLSEKADIFAFGVVMLETVAG-RPNTDNSLEESKICLLEWAWGLYEKDQALGIVDP 799

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
             LKE F  +EA R + + L C+    ++RP  S VV ++ G V V  V   +P+++
Sbjct: 800  SLKE-FGKDEAFRAICVALVCTQGSPHQRPPMSKVVAMLTGDVDVAKVVT-KPSYI 853



>gb:AB006702_1509943 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MPO12.
          Length = 651

 Score =  207 bits (526), Expect = 4e-52
 Identities = 120/338 (35%), Positives = 188/338 (55%), Gaps = 6/338 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+ F  KK LGQGG G V+ G L   G  +AVK     +     +F  E+++I+ ++HK
Sbjct: 311  ATDYFSHKKMLGQGGNGTVFLGILPN-GKNVAVKRLVFNTRDWVEEFFNEVNLISGIQHK 369

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKLLG      + LLVYEY+P+ SLDQ LF   ++  L+W  R  I+ G    L YLH
Sbjct: 370  NLVKLLGCSIEGPESLLVYEYVPNKSLDQFLFDESQSKVLNWSQRLNIILGTAEGLAYLH 429

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                 R++HRD+K SN++LD   N ++ DFGLAR    ++T  +   G+AGT+GY+APE 
Sbjct: 430  GGSPVRIIHRDIKTSNVLLDDQLNPKIADFGLARCFGLDKTHLS--TGIAGTLGYMAPEY 487

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVDIRLK 722
            ++ G+ TE++D+Y+FG ++LE+ CG R    +     L+  VW L+   R++EA+D  LK
Sbjct: 488  VVRGQLTEKADVYSFGVLVLEIACGTRINAFVPETGHLLQRVWNLYTLNRLVEALDPCLK 547

Query: 723  EDFV-----VEEAKRLLLLGLACSHPIANERPRTSDVVQIIL-GSVPVPNVPPFRPAFVW 884
            ++F+       EA ++L +GL C+    + RP   +V++++     P+P+  P  P F+ 
Sbjct: 548  DEFLQVQGSEAEACKVLRVGLLCTQASPSLRPSMEEVIRMLTERDYPIPS--PTSPPFLR 605

Query: 885  PSALXXXXXXXXXXXXXXXXXXXFNSGWSQIDTGHTNS 998
             S+L                   FN+        +T+S
Sbjct: 606  VSSLTTDLEGSSTISHSTNSTTTFNTMVKTDQASYTSS 643



>gb:AE016959_1022495 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC021893_1538815
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0060A14, from chromosome 10, complete
           sequence.>gb:AC090487_1734358 Genomic Sequence for Oryza
           sativa, Nipponbare strain, clone OSJNBb0044I14, from
           Chromosome 10, complete sequence.>gb:AE017092_1752314
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 46 of 77 of the complete sequence.
          Length = 428

 Score =  207 bits (526), Expect = 4e-52
 Identities = 116/286 (40%), Positives = 172/286 (60%), Gaps = 12/286 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LG+GG+G VYKGW+          G G+ +AVK    E  +G  ++L E+
Sbjct: 81  ATKNFKPDSLLGEGGFGYVYKGWIDEQTLAPARPGSGMVVAVKKLKPEGFQGHKEWLTEV 140

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
             + +L H++LVKL+G+C      LLVYEYMP GSL+ HLF  G  DPLSW +R K+  G
Sbjct: 141 DYLGQLHHENLVKLIGYCSDGDNRLLVYEYMPKGSLENHLFRRG-ADPLSWGIRLKVAIG 199

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH + E +V++RD KASNI+LDS FNA+L DFGLA+A      ++   + V G
Sbjct: 200 AARGLSFLH-DAENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQ-VMG 257

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG+ + ++D+Y+FG VLLE++ G+R    ++    Q+LVDW   +L   
Sbjct: 258 TRGYAAPEYVATGRLSVKADVYSFGVVLLELLTGRRALDKSKPASEQNLVDWTRPYLGDK 317

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQ 824
            R+   +D++L   +  + A  +  + L C    A  RP+ S+V++
Sbjct: 318 RRLYRIMDMKLGGQYPKKGAHAIATIALQCIRSEAKMRPQMSEVLE 363



>gb:AY303171_1597401 Solanum bulbocastanum chromosome 8 clone 177O13,
            complete sequence.
          Length = 711

 Score =  206 bits (525), Expect = 6e-52
 Identities = 115/294 (39%), Positives = 176/294 (59%), Gaps = 6/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLG+GG+G VYKG    +G E+A+K  SR S +G  +F  EL +I +++H+
Sbjct: 389  ATNNFSSDNKLGEGGFGPVYKGQFP-DGREVAIKRLSRTSGQGLAEFKNELILIAKVQHR 447

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEYMP+ SLD  LF       L W+ R +I+ G+   L YLH
Sbjct: 448  NLVRVLGCCIHGDEKMLIYEYMPNKSLDFFLFDPERKKLLDWQKRFEIIEGIAQGLLYLH 507

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
                 RV+HRDLKASN++LD N N ++ DFGLAR    NE  + T    V GT GY+APE
Sbjct: 508  KYSRMRVIHRDLKASNVLLDENMNPKIADFGLARIFKQNETEAVT--RRVVGTYGYMAPE 565

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDI 713
              + G  + +SD+++FG ++LE++ G+R  +  +     +L+ + W L ++G  LE  D 
Sbjct: 566  FAMEGAFSIKSDVFSFGVLMLEILSGRRNASLQQFNRPLNLIGYAWELWKEGCGLELKDP 625

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVPPF 866
             L++ +  E+  R++ +GL C    A +RP  SDV+ ++     S+P+   P F
Sbjct: 626  DLEDLYDTEQFLRVIHVGLLCVQEGATDRPTMSDVISMLCNGSMSLPIAKQPAF 679



>pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 precursor
            - Arabidopsis thaliana>gb:ATCHRIV33_1544955 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            33.>gb:ATT26M18_1555502 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T26M18 (ESSA project).
          Length = 849

 Score =  206 bits (525), Expect = 6e-52
 Identities = 115/292 (39%), Positives = 176/292 (60%), Gaps = 4/292 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F  KKKLG+GG+G VYKG L   G+E+A+K  S++S +G  +F  E+ +I +L+HK
Sbjct: 533  ATNSFSRKKKLGEGGFGPVYKGKLPN-GMEVAIKRLSKKSSQGLTEFKNEVVLIIKLQHK 591

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + LL+YEYM + SLD  LF   ++  L WE R KIV+G    LQYLH
Sbjct: 592  NLVRLLGYCVEGDEKLLIYEYMSNKSLDGLLFDSLKSRELDWETRMKIVNGTTRGLQYLH 651

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                 R++HRDLKASNI+LD   N ++ DFG AR    ++      + + GT GY++PE 
Sbjct: 652  EYSRLRIIHRDLKASNILLDDEMNPKISDFGTARIFGCKQID-DSTQRIVGTFGYMSPEY 710

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ--SLVDWVWFLHRDGRILEAVDIR 716
             L G  +E+SDIY+FG +LLE++ G++    +   Q  SL+ + W    + + +  +D  
Sbjct: 711  ALGGVISEKSDIYSFGVLLLEIISGKKATRFVHNDQKHSLIAYEWESWCETKGVSIIDEP 770

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIIL--GSVPVPNVPPF 866
            +   + +EEA R + + L C      +RP  S +V ++    ++P+P  P F
Sbjct: 771  MCCSYSLEEAMRCIHIALLCVQDHPKDRPMISQIVYMLSNDNTLPIPKQPTF 822



>gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0489D11.
          Length = 804

 Score =  206 bits (524), Expect = 7e-52
 Identities = 113/295 (38%), Positives = 172/295 (58%), Gaps = 3/295 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF E  K+GQGG+G VYKG L G+  E+A+K  SR S +G  +F  E+ +I +L+H+
Sbjct: 482  ATNNFSEAYKIGQGGFGKVYKGMLGGQ--EVAIKRLSRNSQQGTKEFRNEVILIAKLQHR 539

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG+C    + LL+YEY+P+ SLD  LF G     L W  R  I+ GV   L YLH
Sbjct: 540  NLVRILGFCVEGDEKLLIYEYLPNKSLDATLFNGSRKLLLDWTTRFNIIKGVARGLLYLH 599

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
             +    ++HRDLKA NI+LD+    ++ DFG+AR   DN++ + T  + V GT GY+APE
Sbjct: 600  QDSRLTIIHRDLKAGNILLDAEMKPKIADFGMARIFGDNQQNANT--QRVVGTYGYMAPE 657

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              + G  + +SD+Y+FG +LLEV+ G R    + I GF +L+ + W + ++G+  +  D 
Sbjct: 658  YAMEGIFSTKSDVYSFGVLLLEVITGMRRNSVSNIMGFPNLIVYAWNMWKEGKTEDLADS 717

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
             + +  + +E    + L L C     ++RP    VV I+          P RP +
Sbjct: 718  SIMDSCLQDEVLLCIHLALLCVQENPDDRPLMPFVVFILENGSSTALPTPSRPTY 772



>gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1038_A06.>gb:AP004161_1838418 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1311_H06.
          Length = 426

 Score =  206 bits (524), Expect = 7e-52
 Identities = 113/292 (38%), Positives = 170/292 (58%), Gaps = 5/292 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT  F ++ KLG+GG+G VY+G L G G EIAVK  S  S +G  +F  E+ +I +L+H+
Sbjct: 97  ATNQFSKENKLGEGGFGPVYRGVLGG-GAEIAVKRLSARSRQGAAEFRNEVELIAKLQHR 155

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           +LV+LLG C    + +L+YEY+P+ SLD  LF   +   L W+ R  I+ G+   L YLH
Sbjct: 156 NLVRLLGCCVEKEEKMLIYEYLPNRSLDAFLFDSRKRAQLDWKTRQSIILGIARGLLYLH 215

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
            +   +V+HRDLKASN++LD+  N ++ DFG+A+  + E      G  V GT GY+APE 
Sbjct: 216 EDSCLKVIHRDLKASNVLLDNKMNPKISDFGMAKIFEEESNEVNTGH-VVGTYGYMAPEY 274

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI--GGFQSLVDWVWFLHRDGRILEAVDIR 716
            + G  + +SD+++ G ++LE++ GQR G        Q+L+   W L  + +  E +D  
Sbjct: 275 AMEGVFSVKSDVFSLGVLVLEILSGQRNGAMYLQNNQQTLIQDAWKLWNEDKAAEFMDAS 334

Query: 717 LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVPP 863
           L  D+  EEA R   +GL C       RP  S+VV +++     +P P  PP
Sbjct: 335 LAGDYSKEEAWRCFHVGLLCVQESPELRPTMSNVVLMLISDQMQLPEPAQPP 386



>gb:AP003856_1834380 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0697D09.
          Length = 690

 Score =  206 bits (524), Expect = 7e-52
 Identities = 110/293 (37%), Positives = 176/293 (60%), Gaps = 5/293 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  + +LGQGG+G VYKG L  +G+E+AVK  + +S +G  +F  E+ +I +L+H 
Sbjct: 368  ATDNFAAENRLGQGGFGPVYKGQLH-DGVEVAVKRLASQSGQGFTEFKNEVELIAKLQHT 426

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C +  + +LVYEY+P+ SLD  +F   +T  + W  RC I+ G+   L YLH
Sbjct: 427  NLVRLLGCCIQGEEKILVYEYLPNKSLDFFIFDVDKTSLIDWNKRCGIIEGIAQGLLYLH 486

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                 RV+HRDLKASNI+LD + N ++ DFGLA+   +  T     + V GT GY++PE 
Sbjct: 487  KHSRLRVIHRDLKASNILLDQDMNPKISDFGLAKIFSSNNTE-GNTKRVVGTYGYMSPEY 545

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
               G  + +SD+++FG +LLE++ G+R     + G F +L+ + W +  +GR L+ +   
Sbjct: 546  ASEGIYSIKSDVFSFGVLLLEILSGKRNSGFHQYGDFLNLLGYAWHMWEEGRWLDIIGAS 605

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS---VPVPNVPPF 866
            + +    E  ++ + + L C    A++RP  SDVV ++      +P P  P +
Sbjct: 606  IPQTIPTEGLRKYINIALMCVQENADDRPTMSDVVAMLSSESAVLPEPKHPAY 658



>gb:AF224705_1778584 Arabidopsis thaliana receptor-like protein kinase
            4 (RLK4) mRNA, complete cds.
          Length = 658

 Score =  206 bits (524), Expect = 7e-52
 Identities = 111/291 (38%), Positives = 177/291 (60%), Gaps = 5/291 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F E  K+GQGG+G VYKG L+ +G E+AVK  S+ S +G+ +F  E+ ++ +L+H+
Sbjct: 333  ATDDFVESNKIGQGGFGEVYKGTLS-DGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHR 391

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYEY+P+ SLD  LF   +     W  R KI+ GV   + YLH
Sbjct: 392  NLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQXDWTRRYKIIGGVARGILYLH 451

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKAS I+LD++ N ++ DFG+AR    ++T       + GT GY++PE 
Sbjct: 452  QDSRLTIIHRDLKASTILLDADMNPKIADFGMARIFGLDQTEENTSR-IVGTYGYMSPEY 510

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G+ + +SD+Y+FG ++LE++ G++  +  +  G   LV + W L  +GR LE VD  
Sbjct: 511  AMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPA 570

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILG---SVPVPNVP 860
            + E+    E  R + +GL C      ERP  S +V ++     ++PVP  P
Sbjct: 571  IVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQP 621



>pir|D84860|D84860 probable protein kinase [imported] - Arabidopsis
            thaliana>gb:AC006580_1534489 Arabidopsis thaliana
            chromosome 2 clone F23E6 map m551, complete
            sequence.>gb:AC006931_1534812 Arabidopsis thaliana
            chromosome 2 clone F7D19 map m551, complete sequence.
          Length = 494

 Score =  206 bits (524), Expect = 7e-52
 Identities = 121/279 (43%), Positives = 164/279 (58%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F     LG+GGYGVVY+G L   G E+AVK       + + +F  E+  I  +RHK
Sbjct: 179  ATNRFAPVNVLGEGGYGVVYRGKLVN-GTEVAVKKLLNNLGQAEKEFRVEVEAIGHVRHK 237

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C      +LVYEY+  G+L+Q L     +   L+WE R KI++G   AL YL
Sbjct: 238  NLVRLLGYCIEGVHRMLVYEYVNSGNLEQWLHGAMRQHGNLTWEARMKIITGTAQALAYL 297

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H   E +VVHRD+KASNI++D  FNA+L DFGLA+ LD+  +  T    V GT GY+APE
Sbjct: 298  HEAIEPKVVHRDIKASNILIDDEFNAKLSDFGLAKLLDSGESHIT--TRVMGTFGYVAPE 355

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG   E+SDIY+FG +LLE + G+ P    R     +LV+W+  +    R  E VD 
Sbjct: 356  YANTGLLNEKSDIYSFGVLLLEAITGRDPVDYGRPANEVNLVEWLKMMVGTRRAEEVVDP 415

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            RL+        KR LL+ L C  P A +RPR S V +++
Sbjct: 416  RLEPRPSKSALKRALLVSLRCVDPEAEKRPRMSQVARML 454



>pir|T14519|T14519 probable S-receptor kinase (EC 2.7.1.-) SFR1 - wild
            cabbage>gb:BOY14285_1633936 Brassica oleracea mRNA for
            SFR1 protein.
          Length = 849

 Score =  206 bits (524), Expect = 7e-52
 Identities = 119/298 (39%), Positives = 173/298 (58%), Gaps = 6/298 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G  +F  E+ +I RL+H 
Sbjct: 523  ATHNFSSTNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKMSLQGTDEFKNEVRLIARLQHI 581

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF       L+W+LR  I +G+   L YLH
Sbjct: 582  NLVRLLGCCVDKGEKMLIYEYLENLSLDSHLFDKSRRSNLNWQLRFDIANGIARGLLYLH 641

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T       V GT GY++PE 
Sbjct: 642  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFRRDETE-ANTRKVVGTYGYMSPEY 700

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVD-- 710
             + G  + +SD+++FG +LLE++ G+R        G  SL+  VW   ++ + L+ +D  
Sbjct: 701  AMNGIFSVKSDVFSFGVLLLEIISGKRSTGFYNSSGDLSLLGCVWRNWKERKGLDIIDPI 760

Query: 711  --IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
                L   F   E  R + +GL C    A +RP  S V+ ++LGS       P +PAF
Sbjct: 761  IIDSLSSTFKTHEILRCIHIGLLCVQERAEDRPAMSSVM-VMLGSETTTLPEPKQPAF 817



>pir|T12973|T12973 protein kinase homolog T6H20.210 - Arabidopsis
           thaliana>gb:ATT6H20_1556355 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6H20.
          Length = 337

 Score =  206 bits (524), Expect = 7e-52
 Identities = 124/300 (41%), Positives = 181/300 (60%), Gaps = 4/300 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT+ F E +  G    G VYKG L+    +IAVK  S ++ +     ++++  I +LRHK
Sbjct: 46  ATKGFKESELFGTEANGTVYKGKLSSNA-QIAVKRVSLDAEQDTKHLVSQIVGIGKLRHK 104

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           +LV+LLG+C R G+LLLVY+YMP+G+LD  LF   E   LSW  R  I+ GV  AL YLH
Sbjct: 105 NLVQLLGYCRRKGELLLVYDYMPYGNLDDFLF-NEERPNLSWSQRFHIIKGVASALLYLH 163

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
              EQ V+HRD+KA+N++LD + N RL D+GLAR   N          + G++GY+APE 
Sbjct: 164 ---EQIVLHRDVKAANVLLDEDLNGRL-DYGLARFGTNRNP-------MLGSVGYVAPEL 212

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCG----QRPGTRIGGFQSLVDWVWFLHRDGRILEAVD 710
           ++TG  T ++D+Y+FGA+LLE  CG    + PG +   F +L+ WV    + G ++ A D
Sbjct: 213 IITGMPTTKADVYSFGALLLEFACGRMFIEYPG-KPEEF-NLISWVCQCWKRGNLVGARD 270

Query: 711 IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVWPS 890
            RL+ D+V +E + +L LGL C+     +RP  S VV  + G+  +P +PP  P    P+
Sbjct: 271 ARLEGDYVCKEIEMVLKLGLLCAQYNPEDRPSMSQVVNYLEGNDVLPEMPPDTPGISIPT 330



>gb:OSJN00093_1694779 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 970

 Score =  206 bits (523), Expect = 1e-51
 Identities = 117/266 (43%), Positives = 162/266 (60%), Gaps = 2/266 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    +LG+GGYG VYKG L  +G  +AVK  S+ S +G+  F  E+  I+R++H+
Sbjct: 694  ATENFSSSNRLGEGGYGAVYKGKLM-DGRIVAVKQLSQTSHQGKKQFATEIETISRVQHR 752

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C      LLVYEYM +GSLD+ LF G E   + W  R +I  G+   L YLH
Sbjct: 753  NLVKLYGCCLEGNNPLLVYEYMENGSLDKALF-GTEKLHIGWPARFEICLGIARGLAYLH 811

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             E   RVVHRD+KASN++LD+N N ++ DFGLA+  D++ T  +    VAGT GY+APE 
Sbjct: 812  EESSIRVVHRDIKASNVLLDANLNPKISDFGLAKLYDDKMTHVS--TKVAGTFGYLAPEY 869

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  TE+ D++AFG VLLE + G+     +       + +WVW L+   R L+ VD  
Sbjct: 870  AMRGHMTEKVDVFAFGVVLLETLAGRPNYDDVLEEDKIYIFEWVWRLYESERALDIVDPN 929

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIAN 794
            L E F  EE  R + +GL C+  + +
Sbjct: 930  LTE-FNSEEVLRAIHVGLLCTQGLTS 954



>gb:OSJN00073_1694338 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0027H06, complete sequence.
          Length = 665

 Score =  206 bits (523), Expect = 1e-51
 Identities = 132/319 (41%), Positives = 186/319 (58%), Gaps = 22/319 (6%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEG---------LEIAVKWFSRESIKGQG--DFLA 149
            AT NF + ++LG+G +GVVY G L  +           ++AVK F R+  + +   DFL 
Sbjct: 343  ATGNFTDARRLGRGSFGVVYMGTLTTQRNGRTQEQRQQQVAVKKFDRDENQQRRFTDFLV 402

Query: 150  ELSIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF--IGGETDPLSWELRCK 323
            E+ +I RL+H ++V+L+GWC     LLLVYEY  +GSLD HLF     +   L W  R  
Sbjct: 403  EIQVIIRLKHNNIVQLIGWCLEKRALLLVYEYKHNGSLDNHLFGNHSRQQQVLPWPTRYS 462

Query: 324  IVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGE 503
            IV  V   L Y+H+E E      D+K+SNI+LD  F A LGDFGLAR +   R+S     
Sbjct: 463  IVRDVAAGLHYIHHELE------DIKSSNILLDQEFRACLGDFGLARVISGGRSS--ASM 514

Query: 504  GVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-F 674
             +AGT G+IAPE      AT ++D+YAFGA++LE+V G++    +R      + +WV   
Sbjct: 515  ELAGTRGFIAPEYAQNRVATRRTDVYAFGALVLEIVTGRKALDHSRPSDSVLIANWVRDE 574

Query: 675  LHRDGRILEAVDIRLKED----FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSV 842
             H +G++LEAVD  L  +    +  ++A+RLLLLGL+C+   A++RP    VVQI+   V
Sbjct: 575  FHNNGKLLEAVDGSLTTEEGLQYDADDAERLLLLGLSCTSHSASDRPSMEMVVQIVAKPV 634

Query: 843  PVP--NVPPFRPAFVWPSA 893
            P P   VP   PAFV  S+
Sbjct: 635  PRPVVVVPRVEPAFVGSSS 653



>gb:BOLSRKA_1633859 Turnip mRNA for S-receptor kinase SRK9, partial
            cds.
          Length = 839

 Score =  206 bits (523), Expect = 1e-51
 Identities = 116/299 (38%), Positives = 176/299 (58%), Gaps = 11/299 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            +TENF    KLGQGG+G+VYKG L G+  EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 512  STENFSNCNKLGQGGFGIVYKGTLDGQ--EIAVKRLSKTSVQGADEFMNEVTLIARLQHI 569

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF    +  L+W+ R  I +G+   L YLH
Sbjct: 570  NLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLH 629

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T       V GT GY++PE 
Sbjct: 630  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETE-ANTMRVVGTYGYMSPEY 688

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVD---- 710
             + G  +E+SD+++FG ++LE+V G+R         +L+ + W   ++GR LE VD    
Sbjct: 689  AMEGIFSEKSDVFSFGVIVLEIVTGKR-NREFNNENNLLSYAWSNWKEGRALEIVDPDIV 747

Query: 711  ---IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
                 L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P  P +
Sbjct: 748  DSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVW-MLGSEATEIPQPKPPGY 805



>gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, complete
           sequence.
          Length = 482

 Score =  206 bits (523), Expect = 1e-51
 Identities = 117/297 (39%), Positives = 176/297 (59%), Gaps = 12/297 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLA---------GEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT NF  +  LG+GG+G V+KGW+          G GL +AVK  + + ++G  ++LAE+
Sbjct: 124 ATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEI 183

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + +  L H +LVKL+G+C    + LLVYE+MP GSL+ HLF    + PL W +R KI  G
Sbjct: 184 NYLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLF--RRSLPLPWSIRMKIALG 241

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH E  + V++RD K SNI+LD  +NA+L DFGLA+   +E  ++     V G
Sbjct: 242 AAKGLSFLHEEALKPVIYRDFKTSNILLDGEYNAKLSDFGLAKDAPDEGKTHVSTR-VMG 300

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE ++TG  T +SD+Y+FG VLLE++ G+R     R  G  +LV+W    L   
Sbjct: 301 TYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDK 360

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            R    +D RL+  F V+ A+++  L   C    +  RP+ S+VV+++    P+P++
Sbjct: 361 RRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVL---KPLPHL 414



>gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4P13
            genomic sequence, complete
            sequence.>gb:ATAC010676_1543139 Arabidopsis thaliana
            chromosome III BAC T22N4 genomic sequence, complete
            sequence.
          Length = 490

 Score =  206 bits (523), Expect = 1e-51
 Identities = 117/297 (39%), Positives = 176/297 (59%), Gaps = 12/297 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLA---------GEGLEIAVKWFSRESIKGQGDFLAEL 155
            AT NF  +  LG+GG+G V+KGW+          G GL +AVK  + + ++G  ++LAE+
Sbjct: 132  ATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEI 191

Query: 156  SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
            + +  L H +LVKL+G+C    + LLVYE+MP GSL+ HLF    + PL W +R KI  G
Sbjct: 192  NYLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLF--RRSLPLPWSIRMKIALG 249

Query: 336  VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
                L +LH E  + V++RD K SNI+LD  +NA+L DFGLA+   +E  ++     V G
Sbjct: 250  AAKGLSFLHEEALKPVIYRDFKTSNILLDGEYNAKLSDFGLAKDAPDEGKTHVSTR-VMG 308

Query: 516  TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
            T GY APE ++TG  T +SD+Y+FG VLLE++ G+R     R  G  +LV+W    L   
Sbjct: 309  TYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDK 368

Query: 687  GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
             R    +D RL+  F V+ A+++  L   C    +  RP+ S+VV+++    P+P++
Sbjct: 369  RRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVL---KPLPHL 422



>pir|T14471|T14471 probable S-receptor kinase (EC 2.7.1.-) srk29 -
            wild cabbage>gb:BOSRK29G_1633895 B.oleracea (alboglabra)
            srk29 gene.
          Length = 857

 Score =  206 bits (523), Expect = 1e-51
 Identities = 116/301 (38%), Positives = 180/301 (59%), Gaps = 13/301 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLG+GG+G+VYKG L  +G EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 524  ATENFSNCNKLGEGGFGIVYKGRLL-DGQEIAVKRLSKTSVQGTDEFMNEVTLIARLQHI 582

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++ G C +  + +L+YEY+ + SLD +LF    +  L+W+ R +I +GV   L YLH
Sbjct: 583  NLVQIFGCCIQADEKMLIYEYLENSSLDSYLFGKTRSSKLNWKERFEITNGVARGLLYLH 642

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    E T     + V GT GY++PE 
Sbjct: 643  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFAREETEANTMK-VVGTYGYMSPEY 701

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVD-- 710
             + G  +E+SD+++FG ++LE+V G+R      +    +L+++ W   ++GR LE VD  
Sbjct: 702  AMHGIFSEKSDVFSFGVIVLEIVTGKRNRVFYNLNYEDNLLNYAWNNWKEGRALEIVDPA 761

Query: 711  -----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPP 863
                   L   F  ++  + + +GL C   +A  RP  S VV  +LGS    +P P  P 
Sbjct: 762  ILDSLSSLPSTFQPQDVLKCIQIGLLCVQDLAENRPTMSSVVW-MLGSEATEIPQPKPPG 820

Query: 864  F 866
            +
Sbjct: 821  Y 821



>pir|T14398|T14398 S-receptor kinase (EC 2.7.1.-) -
            turnip>gb:D88193_1675095 Brassica rapa DNA for S-receptor
            kinase, complete cds.
          Length = 841

 Score =  206 bits (523), Expect = 1e-51
 Identities = 116/299 (38%), Positives = 176/299 (58%), Gaps = 11/299 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            +TENF    KLGQGG+G+VYKG L G+  EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 514  STENFSNCNKLGQGGFGIVYKGTLDGQ--EIAVKRLSKTSVQGADEFMNEVTLIARLQHI 571

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF    +  L+W+ R  I +G+   L YLH
Sbjct: 572  NLVQILGCCIDADEKMLIYEYLENLSLDSYLFGKTRSSKLNWKERFDITNGIARGLLYLH 631

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T       V GT GY++PE 
Sbjct: 632  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETE-ANTMRVVGTYGYMSPEY 690

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILEAVD---- 710
             + G  +E+SD+++FG ++LE+V G+R         +L+ + W   ++GR LE VD    
Sbjct: 691  AMEGIFSEKSDVFSFGVIVLEIVTGKR-NREFNNENNLLSYAWSNWKEGRALEIVDPDIV 749

Query: 711  ---IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
                 L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P  P +
Sbjct: 750  DSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVW-MLGSEATEIPQPKPPGY 807



>gb:AP004401_1841245 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0534A03.>gb:AP005126_1848235 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0041B22.
          Length = 865

 Score =  205 bits (522), Expect = 1e-51
 Identities = 120/294 (40%), Positives = 174/294 (59%), Gaps = 6/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF    KLG+GG+G VYKG L G G EIAVK  SR S +G  +F  E+ +I +L+H+
Sbjct: 540  ATDNFSISNKLGEGGFGHVYKGRLPG-GEEIAVKRLSRSSGQGLEEFKNEVILIAKLQHR 598

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C +  + +LVYEYMP+ SLD  LF       L W  R +I+ GV   L YLH
Sbjct: 599  NLVRLLGCCIQGEEKILVYEYMPNKSLDAFLFDPERRGLLDWRTRFQIIEGVARGLLYLH 658

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   RVVHRDLKASNI+LD + N ++ DFG+AR    ++        V GT+GY++PE 
Sbjct: 659  RDSRLRVVHRDLKASNILLDRDMNPKISDFGMARIFGGDQNQVNTNR-VVGTLGYMSPEY 717

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT--RIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+Y+FG ++LE++ GQ+  +   + G  ++V + W L    R  E +D  
Sbjct: 718  AMEGLFSVRSDVYSFGILILEIITGQKNSSFHHMEGSLNIVGYAWQLWNGDRGQELIDPA 777

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
            ++     +EA R + + L C    A++RP    VV + LGS    +P P  P F
Sbjct: 778  IRGTCPAKEALRCVHMALLCVQDHAHDRPDIPYVV-LTLGSDSSVLPTPRPPTF 830



>gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K7M2.
          Length = 458

 Score =  205 bits (522), Expect = 1e-51
 Identities = 114/286 (39%), Positives = 164/286 (57%), Gaps = 6/286 (2%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT  F E   LGQGG+G V+KG L   G E+AVK     S +G+ +F AE+ II+R+ H+
Sbjct: 91  ATNGFSEANLLGQGGFGYVFKGMLRN-GKEVAVKQLKEGSSQGEREFQAEVGIISRVHHR 149

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
           HLV L+G+C    + LLVYE++P+ +L+ HL  G     + W  R KI  G    L YLH
Sbjct: 150 HLVALVGYCIADAQRLLVYEFVPNNTLEFHLH-GKGRPTMEWSSRLKIAVGSAKGLSYLH 208

Query: 363 NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
                +++HRD+KASNI++D  F A++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 209 ENCNPKIIHRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVS--TRVMGTFGYLAPEY 266

Query: 543 LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRD----GRILEA 704
             +GK TE+SD+++FG VLLE++ G+RP     +    SLVDW   L       G     
Sbjct: 267 ASSGKLTEKSDVFSFGVVLLELITGRRPIDVNNVHADNSLVDWARPLLNQVSELGNFEVV 326

Query: 705 VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSV 842
           VD +L  ++  EE  R++    AC    A  RPR   V +++ G++
Sbjct: 327 VDKKLNNEYDKEEMARMVACAAACVRSTAPRRPRMDQVARVLEGNI 372



>gb:AF527808_1808433 Sorghum bicolor clone BAC SBTXS_0040L6 php200725
            orthologous region.
          Length = 839

 Score =  205 bits (522), Expect = 1e-51
 Identities = 113/288 (39%), Positives = 168/288 (58%), Gaps = 2/288 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF E   LGQGG+G VYKG L GE  E+A+K  S+ S +G  +F  E+ +I +L+H+
Sbjct: 520  ATNNFAEDNMLGQGGFGKVYKGIL-GENREVAIKRLSQGSGQGTDEFRNEVVLIAKLQHR 578

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + LL+YEY+P+ SLD  +F     + L W  R +I+ G+   + YLH
Sbjct: 579  NLVRLLGCCIHGDEKLLIYEYLPNKSLDSFIFDAARKNVLDWPTRFRIIKGISRGVLYLH 638

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARAL-DNERTSYTEGEGVAGTIGYIAPE 539
             +    +VHRDLK SNI+LD++ N ++ DFG+AR    N++ + T    V GT GY++PE
Sbjct: 639  QDSRLTIVHRDLKTSNILLDADMNPKISDFGMARIFGGNQQEANT--NRVVGTYGYMSPE 696

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQR-PGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
              + G  +  SD Y+ G +LLE++ G +   T    F SL+ + W L  DG+ ++ VD  
Sbjct: 697  YAMDGAFSVMSDTYSLGVILLEIISGLKITSTHSTSFPSLLAYAWSLWNDGKAMDLVDSF 756

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP 860
            + E     EA R + +GL C     N RP  S VV ++     + +VP
Sbjct: 757  VLESCSANEALRCIHIGLLCVQDNPNSRPLMSTVVFMLENETTLLSVP 804



>gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC092389_1735356 Oryza sativa
            chromosome 10 BAC OSJNBa0053C23 genomic sequence,
            complete sequence.>gb:AE017115_1753422 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 69 of 77
            of the complete sequence.
          Length = 517

 Score =  205 bits (522), Expect = 1e-51
 Identities = 117/279 (41%), Positives = 169/279 (60%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F  +  LG+GGYGVVYKG L  +   +A+K       + + DF  E++ I R+RHK
Sbjct: 215  ATNRFAAENVLGEGGYGVVYKGILR-DNTAVAIKNLHNNRGQAEKDFKVEVATIGRVRHK 273

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGG-ETDPLSWELRCKIVSGVGYALQYL 359
            +LV LLG+C    +LL VYEYM + +LD+ L  G  E  PL+W++R  I+ G    L YL
Sbjct: 274  NLVSLLGYCEGACRLL-VYEYMENSNLDKWLHHGDDEISPLTWDMRMHILLGTARGLAYL 332

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H   E ++VHRD+K+SNI+LD ++NAR+ DFGLA+ L +ER+  T    V GT GY+APE
Sbjct: 333  HEGLEPKIVHRDVKSSNILLDRHWNARVSDFGLAKLLCSERSYVT--TRVMGTFGYVAPE 390

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG   E+SD+Y+FG +++E++ G+ P   TR     +LV+W+  +  + R+ E VD 
Sbjct: 391  YARTGMLNERSDVYSFGVLIMEIISGRTPVDYTRPAPEVNLVEWLKRMVAERRVEEVVDP 450

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            RL E    +  KR +L  L C  P   +RP    VV ++
Sbjct: 451  RLPETPPPKVLKRAVLAALRCVDPDGGQRPTMGHVVHML 489



>gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1729_E01.
          Length = 609

 Score =  205 bits (521), Expect = 2e-51
 Identities = 113/299 (37%), Positives = 182/299 (60%), Gaps = 6/299 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E  K+G+GG+G VYKG L G+  E+AVK  ++ S +G  +   EL ++ +L H+
Sbjct: 298  ATDNFHESNKIGEGGFGAVYKGILHGQ--EVAVKRMAKGSNQGLEELKNELVLVAKLHHR 355

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G+C   G+ LL+YEYM + SLD  LF   +   L W +R KI+ G+   LQYLH
Sbjct: 356  NLVRLVGFCLDEGERLLIYEYMSNKSLDTFLFDAEQKRKLDWAVRFKIIEGIARGLQYLH 415

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + ++++VHRD+KASNI+LD++ N ++GDFGLAR    ++T       +AGT GY+ PE 
Sbjct: 416  QDSQKKIVHRDMKASNILLDADMNPKIGDFGLARLFGQDQTREVTSR-IAGTFGYMPPEY 474

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR----PGTRIGGFQSLVDWVWFLHRDGRILEAVD 710
            +L G+ + +SD+++FG +++E+V G+R    P       + ++  V     +G I E +D
Sbjct: 475  VLRGQYSTKSDVFSFGILVIEIVTGRRRNSGPYLSEQNDEDILSIVRRHWEEGAIAEMID 534

Query: 711  IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPF--RPAFV 881
              L  ++   E  + + +GL C      +RP  +DV+ I+L S     +P    RPA++
Sbjct: 535  HSLGRNYSETEVLKCVNIGLLCVQQNPVDRPTMADVM-ILLNSDTTCTMPALAPRPAYL 592



>pir|T01711|T01711 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) A_IG002N01.22 - Arabidopsis
           thaliana>gb:ATCHRIV3_1544819 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 3.>gb:IG002N01_1683033
           Arabidopsis thaliana BAC IG002N01.
          Length = 450

 Score =  205 bits (521), Expect = 2e-51
 Identities = 110/279 (39%), Positives = 174/279 (62%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
           AT    E+  +G+GGYG+VY G L  +G ++AVK       + + +F  E+  I R+RHK
Sbjct: 156 ATNGLCEENVIGEGGYGIVYSGILT-DGTKVAVKNLLNNRGQAEKEFRVEVEAIGRVRHK 214

Query: 183 HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
           +LV+LLG+C      +LVY+Y+ +G+L+Q +    G+  PL+W++R  I+  +   L YL
Sbjct: 215 NLVRLLGYCVEGAYRMLVYDYVDNGNLEQWIHGDVGDKSPLTWDIRMNIILCMAKGLAYL 274

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H   E +VVHRD+K+SNI+LD  +NA++ DFGLA+ L +E +  T    V GT GY+APE
Sbjct: 275 HEGLEPKVVHRDIKSSNILLDRQWNAKVSDFGLAKLLFSESSYVT--TRVMGTFGYVAPE 332

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
              TG  TE+SDIY+FG +++E++ G+ P   +R  G  +LV+W+  +  + R  E VD 
Sbjct: 333 YACTGMLTEKSDIYSFGILIMEIITGRNPVDYSRPQGEVNLVEWLKTMVGNRRSEEVVDP 392

Query: 714 RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
           ++ E    +  KR+LL+ L C  P AN+RP+   ++ ++
Sbjct: 393 KIPEPPTSKALKRVLLVALRCVDPDANKRPKMGHIIHML 431



>pir|T14450|T14450 serine/threonine kinase (EC 2.7.1.-) BRLK - wild
            cabbage>gb:BOBRLKGEN_1633746 B.oleraceae gene encoding
            serine/threonine kinase, BRLK.
          Length = 850

 Score =  205 bits (521), Expect = 2e-51
 Identities = 112/292 (38%), Positives = 173/292 (59%), Gaps = 4/292 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F  + +LG+GG+G VYKG L  +G EIAVK  S +S +G  +F  E+ +I +L+H+
Sbjct: 525  ATNDFSRENELGRGGFGPVYKGVLE-DGQEIAVKRLSGKSGQGVDEFKNEIILIAKLQHR 583

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C    + +LVYEYMP+ SLD  +F   + + + W+LR  I+ G+   L YLH
Sbjct: 584  NLVRLLGCCFEGEEKMLVYEYMPNKSLDFFIFDEMKQELVDWKLRFAIIEGIARGLLYLH 643

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SN++LD   N ++ DFG+AR     +        V GT GY++PE 
Sbjct: 644  RDSRLRIIHRDLKVSNVLLDGEMNPKISDFGMARIFGGNQNE-ANTVRVVGTYGYMSPEY 702

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR-PGTRIGGFQSLVDWVWFLHRDGRILEAVDIRL 719
             + G  + +SD+Y+FG +LLE++ G+R    R     SL+ + WFL+  GR  E VD ++
Sbjct: 703  AMEGLFSVKSDVYSFGVLLLEIISGKRNTSLRASEHGSLIGYAWFLYTHGRSEELVDPKI 762

Query: 720  KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII---LGSVPVPNVPPF 866
            +      EA R + + + C    A ERP  + V+ ++     ++PVP  P F
Sbjct: 763  RATCNKREALRCIHVAMLCVQDSAAERPNMAAVLLMLESDTATLPVPRQPTF 814



>pir|T51453|T51453 serine/threonine specific protein kinase-like -
            Arabidopsis thaliana>gb:ATF2G14_1550456 Arabidopsis
            thaliana DNA chromosome 5, BAC clone F2G14 (ESSA
            project).>gb:AY062520_1565176 Arabidopsis thaliana
            serine/threonine specific protein kinase-like (At5g15080;
            F2G14_200) mRNA, complete cds.>gb:BT002577_1636180
            Arabidopsis thaliana serine/threonine specific protein
            kinase-like (At5g15080) mRNA, complete cds.
          Length = 493

 Score =  205 bits (521), Expect = 2e-51
 Identities = 116/297 (39%), Positives = 176/297 (59%), Gaps = 12/297 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLA---------GEGLEIAVKWFSRESIKGQGDFLAEL 155
            +T NF  +  LG+GG+G V+KGW+          G GL +AVK  + + ++G  ++LAE+
Sbjct: 138  STRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNPDGLQGHKEWLAEI 197

Query: 156  SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
            + +  L H +LVKL+G+C    + LLVYE+MP GSL+ HLF    + PL W +R KI  G
Sbjct: 198  NFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLF--RRSLPLPWSIRMKIALG 255

Query: 336  VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
                L +LH E  + V++RD K SNI+LD+++NA+L DFGLA+   +E  ++     V G
Sbjct: 256  AAKGLSFLHEEALKPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPDEGKTHVSTR-VMG 314

Query: 516  TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
            T GY APE ++TG  T +SD+Y+FG VLLE++ G+R     R  G  +LV+W    L   
Sbjct: 315  TYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDK 374

Query: 687  GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
             R    +D RL+  F ++ A+++  L   C       RP+ SDVV+ +    P+P++
Sbjct: 375  RRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDVVEAL---KPLPHL 428



>gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0040I22.
          Length = 506

 Score =  204 bits (520), Expect = 2e-51
 Identities = 113/279 (40%), Positives = 168/279 (60%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE F ++  +G+GGYG+VY G L   G ++AVK       + + +F  E+  I R+RHK
Sbjct: 174  ATEMFADENVIGEGGYGIVYHGVLEN-GTQVAVKNLLNNRGQAEKEFKVEVEAIGRVRHK 232

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C    + +LVYEY+ +G+L+Q L    G   PLSW+ R KI+ G    L YL
Sbjct: 233  NLVRLLGYCAEGNQRMLVYEYVDNGNLEQWLHGEVGPVSPLSWDSRVKIILGTAKGLMYL 292

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H   E +VVHRD+K+SNI+LD ++NA+L DFGLA+ L +ER+  T    V GT GY+APE
Sbjct: 293  HEGLEPKVVHRDVKSSNILLDKHWNAKLSDFGLAKLLGSERSYVT--TRVMGTFGYVAPE 350

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG   E SD+Y+FG +++E++ G+ P    R  G  +LVDW+  +         VD 
Sbjct: 351  YAGTGMLNETSDVYSFGILIMEIISGRVPVDYNRPPGEVNLVDWLKTMVSTRNSEGVVDP 410

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            ++ +       K+ LL+ L C  P A +RP+   V+ ++
Sbjct: 411  KMPQKPTSRALKKALLVALRCVDPDARKRPKIGHVIHML 449



>gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRNA,
            complete cds.>gb:BT001060_1635315 Arabidopsis thaliana
            At4g23250/F21P8_140 mRNA, complete cds.
          Length = 579

 Score =  204 bits (520), Expect = 2e-51
 Identities = 113/294 (38%), Positives = 180/294 (61%), Gaps = 6/294 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF E+ KLG+GG+G VYKG L   G EIAVK  S+ S +G+ +F  E+ ++ +L+H 
Sbjct: 255  ATSNFSERNKLGKGGFGEVYKGMLMN-GTEIAVKRLSKTSGQGEVEFKNEVVVVAKLQHI 313

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+  +  + LLVYE++ + SLD  LF   + + L W +R  I+ G+   + YLH
Sbjct: 314  NLVRLLGFSLQGEEKLLVYEFVSNKSLDYFLFDPTKRNQLDWTMRRNIIGGITRGILYLH 373

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRDLKASNI+LD++ N ++ DFG+AR    ++T    G  V GT GY++PE 
Sbjct: 374  QDSRLKIIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTGR-VVGTFGYMSPEY 432

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGT---RIGGFQSLVDWVWFLHRDGRILEAVDI 713
            +  G+ + +SD+Y+FG ++LE++ G++  +     G   +LV +VW L  +  + E +D 
Sbjct: 433  VTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDGLVNNLVTYVWKLWENKSLHELLDP 492

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS---VPVPNVPPF 866
             + +DF  EE  R + +GL C      +RP  S + Q++  S   +PVP  P F
Sbjct: 493  FINQDFTSEEVIRYIHIGLLCVQENPADRPTMSTIHQMLTNSSITLPVPLPPGF 546



>gb:AC073556_1541104 Oryza sativa chromosome 3 BAC OSJNBa0091P11
           genomic sequence, complete sequence.
          Length = 422

 Score =  204 bits (520), Expect = 2e-51
 Identities = 117/286 (40%), Positives = 172/286 (60%), Gaps = 12/286 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT+NF     LG+GG+G VYKGW+          G G+ +AVK    E  +G  ++L E+
Sbjct: 83  ATKNFRPDSLLGEGGFGHVYKGWIDEHTLAPSKPGSGMVVAVKKLKPEGFQGHKEWLTEV 142

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + + +L HK+LVKL+G+C      LLVYE+MP GSL+ HLF  G  DPLSW +R K+  G
Sbjct: 143 NYLGQLHHKNLVKLIGYCSDGDNRLLVYEFMPKGSLENHLFRRG-ADPLSWAIRLKVAIG 201

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH + E +V++RD KASNI+LDS FN++L DFGLA+A      ++   + V G
Sbjct: 202 AARGLSFLH-DAENQVIYRDFKASNILLDSEFNSKLSDFGLAKAGPTGDKTHVSTQ-VMG 259

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG+ + ++D+Y+FG VLLE++ G+R    ++ G  Q+LVDW    L   
Sbjct: 260 THGYAAPEYIATGRLSAKADVYSFGVVLLELLTGRRALDKSKPGIEQNLVDWAKPHLGDK 319

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQ 824
            R+   +D +L   +  + A  +  + L C    A  RPR S+V++
Sbjct: 320 RRLYRVMDTKLGGQYPKKGAHAIANIALQCICNDAKMRPRMSEVLE 365



>gb:AX088876_1461047 Sequence 1 from Patent
            WO0114563.>gb:AX825703_1475974 Sequence 1 from Patent
            WO03072763.>gb:AY028699_1559159 Brassica napus receptor
            protein kinase PERK1 mRNA, complete cds.
          Length = 647

 Score =  204 bits (520), Expect = 2e-51
 Identities = 117/292 (40%), Positives = 169/292 (57%), Gaps = 7/292 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E   LGQGG+G V+KG L   G E+AVK     S +G+ +F AE+ II+R+ H+
Sbjct: 271  ATNGFSEANLLGQGGFGYVHKGVLPS-GKEVAVKQLKVGSGQGEREFQAEVEIISRVHHR 329

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDP-LSWELRCKIVSGVGYALQYL 359
            HLV L+G+C    K LLVYE++P+ +L+ HL   GE  P + W  R KI  G    L YL
Sbjct: 330  HLVSLVGYCIAGAKRLLVYEFVPNNNLELHLH--GEGRPTMEWSTRLKIALGSAKGLSYL 387

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H +   +++HRD+KASNI++D  F A++ DFGLA+   +  T  +    V GT GY+APE
Sbjct: 388  HEDCNPKIIHRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVS--TRVMGTFGYLAPE 445

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFL----HRDGRILE 701
               +GK TE+SD+++FG VLLE++ G+RP     +    SLVDW   L       G    
Sbjct: 446  YAASGKLTEKSDVFSFGVVLLELITGRRPVDANNVYVDDSLVDWARPLLNRASEQGDFEG 505

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
              D ++   +  EE  R++    AC    A  RPR S +V+ + G+V + ++
Sbjct: 506  LADAKMNNGYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDL 557



>gb:AE016959_1023140 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC051632_1540141
           Oryza sativa chromosome 10 BAC OSJNBa0012L23 genomic
           sequence, complete sequence.>gb:AE017106_1752959 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 373

 Score =  204 bits (520), Expect = 2e-51
 Identities = 114/297 (38%), Positives = 183/297 (61%), Gaps = 4/297 (1%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFS-RESIKGQGDFLAELSIINRLRH 179
           AT NF E+ KLG+GG+G V+KG L   G  +AVK  +  E+ + + DF +E+ +I+ + H
Sbjct: 51  ATNNFCEESKLGEGGFGDVFKGLLKN-GKTVAVKRLTVMETSRAKADFESEVKLISNVHH 109

Query: 180 KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
           ++LV+LLG   +  + LLVYEYM +GSLD+ LF G +   L+W+ R  I+ G+   L YL
Sbjct: 110 RNLVRLLGCSSKGSECLLVYEYMANGSLDKFLF-GDKRGTLNWKQRFNIIVGMARGLGYL 168

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H EF   ++HRD+K+SN++LD  F  ++ DFGLAR L ++ +  +     AGT+GY APE
Sbjct: 169 HQEFHVCIIHRDIKSSNVLLDDEFQPKIADFGLARLLPDDHSHLS--TKFAGTLGYTAPE 226

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQR-PGTRIG-GFQSLVDWVWFLHRDGRILEAVDI 713
             + G+ +E+ D Y+FG V+LE++ G++    R+    Q L++W W L+ +  ++E VD 
Sbjct: 227 YAIHGQLSEKVDTYSFGVVVLEIISGRKLNDARLDPDSQYLLEWAWKLYENNNLIELVDK 286

Query: 714 RL-KEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
            L  +++  EE K+++ + L C+      RP  S+VV ++L +       P RP F+
Sbjct: 287 SLDPKEYNPEEVKKIIQIALLCTQSAVASRPTMSEVVVLLL-TKNSSEFQPTRPTFI 342



>pir|T14472|T14472 S-receptor kinase (EC 2.7.1.-) - wild
            cabbage>gb:BOSRK3_1633896 B.oleracea SRK3 gene.
          Length = 850

 Score =  204 bits (520), Expect = 2e-51
 Identities = 117/298 (39%), Positives = 177/298 (59%), Gaps = 10/298 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 521  ATENFSNCNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKTSVQGTDEFMNEVTLIARLQHI 579

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+++G C    + +L+YEY+ + SLD  LF       L+W+ R  I +GV   L YLH
Sbjct: 580  NLVQIIGCCIEADEKMLIYEYLENLSLDSFLFGKTRRSKLNWKERFDITNGVARGLLYLH 639

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    E T  +  + V GT GY++PE 
Sbjct: 640  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARMFAREETEASTMK-VVGTYGYMSPEY 698

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVD-- 710
             + G  +E+SD+++FG ++LE+V G+R      +     L+++ W   ++G+ LE VD  
Sbjct: 699  AMHGIFSEKSDVFSFGVIVLEIVTGKRNSGFNNLNYEDHLLNYAWSHWKEGKALEIVDPV 758

Query: 711  --IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
                L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P  P +
Sbjct: 759  TVDSLPSTFQKQEVLKCIQIGLLCVQELAENRPTMSSVVW-MLGSEATEIPQPKPPGY 815



>gb:AP004687_1843385 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0021C04.
          Length = 710

 Score =  204 bits (519), Expect = 3e-51
 Identities = 129/304 (42%), Positives = 175/304 (57%), Gaps = 26/304 (8%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGE-GLEIAVKWFSRESIKGQGDFLAELSIINRLRH 179
            AT+ F E + LG GG+G VY+G L    G  +A+K  S  + +G  +F+AE++ + R+RH
Sbjct: 360  ATKGFKESELLGAGGFGQVYRGVLRRRSGEAVAIKRISNGTRQGMREFVAEVASLGRMRH 419

Query: 180  KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLF---------IGGETDP----LSWELRC 320
            ++LV+L GWC     LLLVYE+MP GSLD  LF          G +  P    L+W  R 
Sbjct: 420  RNLVELRGWCKHDQDLLLVYEFMPGGSLDARLFGTAASAAAAEGVKAPPPPPLLTWAQRF 479

Query: 321  KIVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFN--ARLGDFGLARALDNERTSYT 494
             I+ GV + L YLH E+E  VVHRD+KA+N++L +     ARLGDFGLAR  ++  T  T
Sbjct: 480  AILKGVAHGLLYLHEEWEHVVVHRDVKANNVLLGAGDTGAARLGDFGLARLYEHGATPAT 539

Query: 495  EGEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRP-----GTRIGGFQSLV 659
                VAGT+GY+APE   T +AT  +D+++FGA+LLEV CG+RP          G   LV
Sbjct: 540  --TRVAGTLGYMAPELTFTSRATTATDVFSFGALLLEVACGRRPIEPAAAGEADGDVLLV 597

Query: 660  DWVWFLHRD-----GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQ 824
             WV     D     G +L AVD RL+  +  EEA+ +L LGL CS      RP    V +
Sbjct: 598  RWVRDRALDGDGGGGDVLRAVDPRLEGCYDEEEARLVLWLGLMCSQARPEARPSMRQVCR 657

Query: 825  IILG 836
             + G
Sbjct: 658  YLDG 661



>gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0042L16, complete sequence.
          Length = 526

 Score =  204 bits (519), Expect = 3e-51
 Identities = 111/279 (39%), Positives = 170/279 (60%), Gaps = 3/279 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F ++K +G+GGYG+VY G L  +G ++AVK       + + +F  E+  I R+RHK
Sbjct: 191  ATAMFADEKVIGEGGYGIVYHGVLE-DGTQVAVKNLLNNRGQAEREFKVEVEAIGRVRHK 249

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIG-GETDPLSWELRCKIVSGVGYALQYL 359
            +LV+LLG+C    + +LVYEY+ +G+L+Q L    G   PL+W++R KI+ G    L YL
Sbjct: 250  NLVRLLGYCAEGNQRMLVYEYVNNGNLEQWLHGDVGPVSPLTWDMRMKIILGTAKGLMYL 309

Query: 360  HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
            H   E +VVHRD+K+SNI+LD  +NA+L DFGLA+ L +ER+  T    V GT GY+APE
Sbjct: 310  HEGLEPKVVHRDVKSSNILLDKTWNAKLSDFGLAKLLGSERSYVT--TRVMGTFGYVAPE 367

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFLHRDGRILEAVDI 713
               TG   E SD+Y+FG +++E++ G+ P    R  G  +LV+W+  +  +      +D 
Sbjct: 368  YAGTGMLNETSDVYSFGILIMEIISGRVPVDYNRPPGEVNLVEWLKTMVSNRNSEGVLDP 427

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            ++ E       K+ LL+ L C  P A +RP+   V+ ++
Sbjct: 428  KMTEKPTSRALKKALLVALRCVDPEARKRPKIGHVIHML 466



>pir|T47526|T47526 protein kinase-like - Arabidopsis
            thaliana>gb:ATF16L2_1548823 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F16L2.
          Length = 676

 Score =  204 bits (519), Expect = 3e-51
 Identities = 111/304 (36%), Positives = 178/304 (58%), Gaps = 7/304 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E  KLGQGG+G VYKG +   G+++AVK  S+ S +G+ +F  E+ ++ +L+H+
Sbjct: 347  ATNKFCETNKLGQGGFGEVYKG-IFPSGVQVAVKRLSKTSGQGEREFANEVIVVAKLQHR 405

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG+C    + +LVYE++P+ SLD  +F       L W  R KI+ G+   + YLH
Sbjct: 406  NLVRLLGFCLERDERILVYEFVPNKSLDYFIFDSTMQSLLDWTRRYKIIGGIARGILYLH 465

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +    ++HRDLKA NI+L  + NA++ DFG+AR    ++T       + GT GY++PE 
Sbjct: 466  QDSRLTIIHRDLKAGNILLGDDMNAKIADFGMARIFGMDQTE-ANTRRIVGTYGYMSPEY 524

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCG-------QRPGTRIGGFQSLVDWVWFLHRDGRILE 701
             + G+ + +SD+Y+FG ++LE++ G       Q  GT  G   +LV + W L  +G  LE
Sbjct: 525  AMYGQFSMKSDVYSFGVLVLEIISGKKNSNVYQMDGTSAG---NLVTYTWRLWSNGSPLE 581

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
             VD   ++++ + E  R + + L C    A +RP  S +VQ++  S  +    P RP F 
Sbjct: 582  LVDPSFRDNYRINEVSRCIHIALLCVQEEAEDRPTMSAIVQMLTTS-SIALAVPQRPGFF 640

Query: 882  WPSA 893
            + S+
Sbjct: 641  FRSS 644



>gb:AP004260_1839291 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0011H09.>gb:AP004306_1839944 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0506F02.
          Length = 647

 Score =  204 bits (518), Expect = 4e-51
 Identities = 111/296 (37%), Positives = 178/296 (60%), Gaps = 2/296 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT NF E  +LG+GG+GVV+KG +  +G E+AVK  S  S +G G    ELS++ +L+HK
Sbjct: 327  ATSNFDESNRLGEGGFGVVFKG-VFPDGQEVAVKRLSNCSNQGLGQLKNELSLVAKLQHK 385

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G C   G+ +LVYEYMP+ SLD  LF   ++  L W  R  I+ G+   LQYLH
Sbjct: 386  NLVRLIGVCLEEGEKVLVYEYMPNKSLDTVLFDPEKSKQLDWGKRYNILYGIARGLQYLH 445

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
               + +++HRDLKASNI+LDS+   ++ DFG+A+   +++T       V GT+GY++PE 
Sbjct: 446  EHSQLKIIHRDLKASNILLDSDMKPKIADFGMAKIFGDDQTRNATSR-VVGTLGYMSPEY 504

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG--FQSLVDWVWFLHRDGRILEAVDIR 716
             + G+ + + D+++FG ++LE+V G+R    +     + L   VW    +G + E VD  
Sbjct: 505  AMRGQYSTKLDVFSFGVLVLEIVTGRRNSYAVVSEHCEDLFSLVWRHWNEGTVTEIVDPS 564

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFVW 884
            L   +   +  + + +GL C      +RP  S ++ ++L S  V    P+RPA+++
Sbjct: 565  LGNHYSRGDILKCINIGLLCVQQNPVDRPPMSAII-LMLSSGTVTLQAPYRPAYIF 619



>gb:AC079288_1732515 Arabidopsis thaliana chromosome 1 BAC T3M22
            genomic sequence, complete sequence.
          Length = 940

 Score =  204 bits (518), Expect = 4e-51
 Identities = 111/288 (38%), Positives = 172/288 (59%), Gaps = 3/288 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT +F    K+G+GG+G VYKG L  +G  IAVK  S +S +G  +F+ E+ +I  L+H 
Sbjct: 607  ATNDFDPLNKIGEGGFGSVYKGRLP-DGTLIAVKKLSSKSHQGNKEFVNEIGMIACLQHP 665

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LVKL G C    +LLLVYEY+ +  L   LF G     L W  R KI  G+   L +LH
Sbjct: 666  NLVKLYGCCVEKNQLLLVYEYLENNCLSDALFAGRSCLKLEWGTRHKICLGIARGLAFLH 725

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRD+K +N++LD + N+++ DFGLAR  ++ ++  T    VAGTIGY+APE 
Sbjct: 726  EDSAVKIIHRDIKGTNVLLDKDLNSKISDFGLARLHEDNQSHIT--TRVAGTIGYMAPEY 783

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQ---SLVDWVWFLHRDGRILEAVDI 713
             + G  TE++D+Y+FG V +E+V G+         +    L+DW + L + G I E +D 
Sbjct: 784  AMRGHLTEKADVYSFGVVAMEIVSGKSNAKYTPDDECCVGLLDWAFVLQKKGDIAEILDP 843

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
            RL+  F V EA+R++ + L C++  +  RP  S VV+++ G   +  +
Sbjct: 844  RLEGMFDVMEAERMIKVSLLCANKSSTLRPNMSQVVKMLEGETEIEQI 891



>gb:AB024416_1515946 Brassica oleracea SRK2-b mRNA, complete cds.
          Length = 854

 Score =  204 bits (518), Expect = 4e-51
 Identities = 115/298 (38%), Positives = 178/298 (59%), Gaps = 10/298 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE+F +  K+G+GG+GVVYKG L  +G EIAVK  S  S +G  +F+ E+ +I +L+H 
Sbjct: 529  ATEHFSDFNKVGKGGFGVVYKGRLV-DGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHN 587

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF    +  L+W++R  I++G+   L YLH
Sbjct: 588  NLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLH 647

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD +   ++ DFG+AR    + T   +   V GT GY++PE 
Sbjct: 648  QDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE-ADTRKVVGTYGYMSPEY 706

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG +LLE++ G+R         S  L+  VW   ++G+ LE VD  
Sbjct: 707  AMNGTFSMKSDVFSFGVLLLEIISGKRNKVFCDSDSSLNLLGCVWRNWKEGQGLEIVDKV 766

Query: 717  LKED----FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
            + +     F   E  R L +GL C      +RP  S +V ++LGS    +P P  P +
Sbjct: 767  IVDSSSPTFRPREISRCLQIGLLCVQERVEDRPMMSSIV-LMLGSEAALIPQPKQPGY 823



>gb:AB013720_1512253 Brassica oleracea mRNA for SRK23Bol, partial cds.
          Length = 846

 Score =  204 bits (518), Expect = 4e-51
 Identities = 118/299 (39%), Positives = 177/299 (59%), Gaps = 13/299 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ SI+G  +F+ E+++I RL+H 
Sbjct: 513  ATENFSNCNKLGQGGFGIVYKGTLI-DGQEIAVKRLSKTSIQGTDEFMNEVTLIARLQHI 571

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++ G C    + +L+YEY+ + SLD ++F    +  L+W+ R  I++GV   L YLH
Sbjct: 572  NLVQIHGCCIEADEKMLIYEYLENLSLDSYIFGNPRSTKLNWKERFDIINGVARGLLYLH 631

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T     + V GT GY++PE 
Sbjct: 632  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMK-VVGTYGYMSPEY 690

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPG--TRIGGFQSLVDWVWFLHRDGRILEAVD-- 710
             + G  +E+SD+++FG ++LE+V G+R      +    SL+ + W   ++GR LE VD  
Sbjct: 691  AMGGIFSEKSDVFSFGVIVLEIVTGKRNRGFYNLSYEYSLLSYAWSNWKEGRALEIVDSV 750

Query: 711  -----IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVP 860
                   L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P  P
Sbjct: 751  LVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVW-MLGSEATEIPHPKPP 808



>gb:AB012106_1511634 Brassica rapa mRNA for SRK45, complete cds.
          Length = 846

 Score =  204 bits (518), Expect = 4e-51
 Identities = 117/295 (39%), Positives = 174/295 (58%), Gaps = 9/295 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF    KLGQGG+G+VYKG L  +G EIAVK  S  S++G  +F+ E+++I RL+H 
Sbjct: 522  ATDNFSNCNKLGQGGFGIVYKGRLL-DGQEIAVKRLSETSVQGTDEFMNEVTLIARLQHI 580

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF   +   L+W+ R  I +GV   L YLH
Sbjct: 581  NLVQILGCCIEADEKMLIYEYLENLSLDSYLFGKTQRSKLNWKERFDITNGVARGLLYLH 640

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T     + V GT GY++PE 
Sbjct: 641  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMK-VVGTYGYMSPEY 699

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSLVDWVWFLHRDGRILE-----AV 707
             + G  +E+SD+++FG ++LE+V G+R         + + + W   ++GR LE      V
Sbjct: 700  AMNGIFSEKSDVFSFGVIVLEIVTGKR-----NRGYNFLSYAWSHWKEGRTLELVDPVIV 754

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVP 860
            D  L   F  EE  + + +GL C   +A  RP  S VV  +LGS    +P P  P
Sbjct: 755  DSSLPSTFQPEEVLKCIQIGLLCVQELAEHRPTMSSVVW-MLGSEATEIPHPKPP 808



>gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1008_E09.>gb:AP005786_1857853 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0458H05.
          Length = 702

 Score =  203 bits (517), Expect = 5e-51
 Identities = 115/297 (38%), Positives = 180/297 (60%), Gaps = 5/297 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT++F + K +GQGG+G+VYKG L  +G EIAVK   + S +G G+  +EL ++ +L HK
Sbjct: 366  ATDDFADTKMIGQGGFGMVYKGVLP-DGQEIAVKRLCQSSRQGIGELKSELILVAKLYHK 424

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G C    + +LVYEYMP+GSLD  LF   +   L W  R KI++G+   LQYLH
Sbjct: 425  NLVRLIGVCLEQQEKILVYEYMPNGSLDIVLFDTDKNRELDWGKRFKIINGIARGLQYLH 484

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + + ++VHRDLKASNI+LD +++ ++ DFGLA+    +++       +AGT GY+APE 
Sbjct: 485  EDSQLKIVHRDLKASNILLDFDYSPKISDFGLAKIFGGDQSEDVTNR-IAGTYGYMAPEY 543

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS-----LVDWVWFLHRDGRILEAV 707
             + G  + +SD+++FG ++LE++ G+R     G + S     L++ VW     G ++E +
Sbjct: 544  AMRGNYSIKSDVFSFGVLVLEIITGRR---NTGSYDSGQDVDLLNLVWEHWTRGNVVELI 600

Query: 708  DIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAF 878
            D  + +   +E+  + + +GL C       RP  S  V I+L S  V      RPAF
Sbjct: 601  DPSMGDHPPIEQMLKCIHIGLLCVQKKPASRPTISS-VNIMLSSNTVRLPSLSRPAF 656



>gb:AP003736_1832661 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1008_E09.
          Length = 663

 Score =  203 bits (516), Expect = 6e-51
 Identities = 108/289 (37%), Positives = 176/289 (60%), Gaps = 3/289 (1%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF E  KLG+GG+G VYKG L  +  ++AVK  ++ S +G  +   EL ++ +L HK
Sbjct: 351  ATDNFNESMKLGEGGFGAVYKGLLFRQ--DVAVKRLAKGSNQGLEEVKNELVLVAKLHHK 408

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G+C   G+ +LVYEYMP+ SLD  LF   +   L W  R +I+ G+   LQYLH
Sbjct: 409  NLVQLVGFCLEEGERMLVYEYMPNKSLDTFLFDEEKRRQLDWTTRFRIIEGIARGLQYLH 468

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             + ++++VHRD+KASNI+LD++ N ++GDFGLAR    ++T       + GT GY++PE 
Sbjct: 469  QDSQKKIVHRDMKASNILLDADMNPKIGDFGLARLFGQDQTREITNR-IVGTFGYMSPEY 527

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGF---QSLVDWVWFLHRDGRILEAVDI 713
            +  G+ + +SD+++FG +++E+V G+R       F   + ++  VW    +G I E +D 
Sbjct: 528  VTHGQYSTKSDVFSFGILVIEIVTGRRRNNGPYFFEPNEDIISIVWRHWAEGNIKEIIDH 587

Query: 714  RLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVP 860
             L  ++   E  + + +GL C      +RP  +DV+ ++L S     +P
Sbjct: 588  SLGRNYPEGEVLKCVNIGLLCVQQNPIDRPTMADVM-VLLNSDATSTLP 635



>gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complete
            cds.>gb:AF370509_1792294 Arabidopsis thaliana protein
            kinase-like protein (MOB24.13) mRNA, complete cds.
          Length = 652

 Score =  203 bits (516), Expect = 6e-51
 Identities = 114/291 (39%), Positives = 169/291 (58%), Gaps = 6/291 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E   LGQGG+G V+KG L   G E+AVK     S +G+ +F AE+ II+R+ H+
Sbjct: 276  ATNGFSEANLLGQGGFGYVHKGILPS-GKEVAVKQLKAGSGQGEREFQAEVEIISRVHHR 334

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            HLV L+G+C    + LLVYE++P+ +L+ HL  G     + W  R KI  G    L YLH
Sbjct: 335  HLVSLIGYCMAGVQRLLVYEFVPNNNLEFHLH-GKGRPTMEWSTRLKIALGSAKGLSYLH 393

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRD+KASNI++D  F A++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 394  EDCNPKIIHRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVS--TRVMGTFGYLAPEY 451

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFL----HRDGRILEA 704
              +GK TE+SD+++FG VLLE++ G+RP     +    SLVDW   L      +G     
Sbjct: 452  AASGKLTEKSDVFSFGVVLLELITGRRPVDANNVYVDDSLVDWARPLLNRASEEGDFEGL 511

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
             D ++  ++  EE  R++    AC    A  RPR S +V+ + G+V + ++
Sbjct: 512  ADSKMGNEYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDL 562



>gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MOB24.>gb:AY056788_1563837 Arabidopsis thaliana
            AT3g24550/MOB24_8 mRNA, complete cds.>gb:AY059901_1564745
            Arabidopsis thaliana protein kinase-like protein
            (MOB24.13) mRNA, complete cds.>gb:AY093065_1575019
            Arabidopsis thaliana unknown protein (At3g24550) mRNA,
            complete cds.>gb:AY128792_1580872 Arabidopsis thaliana
            protein kinase-like protein mRNA, complete
            cds.>gb:BT008400_1639617 Arabidopsis thaliana At3g24550
            gene, complete cds.
          Length = 652

 Score =  203 bits (516), Expect = 6e-51
 Identities = 114/291 (39%), Positives = 169/291 (58%), Gaps = 6/291 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E   LGQGG+G V+KG L   G E+AVK     S +G+ +F AE+ II+R+ H+
Sbjct: 276  ATNGFSEANLLGQGGFGYVHKGILPS-GKEVAVKQLKAGSGQGEREFQAEVEIISRVHHR 334

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            HLV L+G+C    + LLVYE++P+ +L+ HL  G     + W  R KI  G    L YLH
Sbjct: 335  HLVSLIGYCMAGVQRLLVYEFVPNNNLEFHLH-GKGRPTMEWSTRLKIALGSAKGLSYLH 393

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   +++HRD+KASNI++D  F A++ DFGLA+   +  T  +    V GT GY+APE 
Sbjct: 394  EDCNPKIIHRDIKASNILIDFKFEAKVADFGLAKIASDTNTHVS--TRVMGTFGYLAPEY 451

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFL----HRDGRILEA 704
              +GK TE+SD+++FG VLLE++ G+RP     +    SLVDW   L      +G     
Sbjct: 452  AASGKLTEKSDVFSFGVVLLELITGRRPVDANNVYVDDSLVDWARPLLNRASEEGDFEGL 511

Query: 705  VDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV 857
             D ++  ++  EE  R++    AC    A  RPR S +V+ + G+V + ++
Sbjct: 512  ADSKMGNEYDREEMARMVACAAACVRHSARRRPRMSQIVRALEGNVSLSDL 562



>pir|A41369|A41369 S-receptor kinase (EC 2.7.1.-) 6 precursor - wild
            cabbage>gb:BNASKR6A_1633481 Brassica oleracea receptor
            protein kinase (SKR6) mRNA, complete cds.
          Length = 857

 Score =  203 bits (516), Expect = 6e-51
 Identities = 115/300 (38%), Positives = 175/300 (58%), Gaps = 12/300 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 524  ATENFSSCNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKTSVQGTDEFMNEVTLIARLQHI 582

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF       L+W  R  I +GV   L YLH
Sbjct: 583  NLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNWNERFDITNGVARGLLYLH 642

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR  + + T     + V GT GY++PE 
Sbjct: 643  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFERDETEANTMK-VVGTYGYMSPEY 701

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQ--RPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  +E+SD+++FG ++LE+V G+  R    +     L+ +VW   ++GR LE VD  
Sbjct: 702  AMYGIFSEKSDVFSFGVIVLEIVSGKKNRGFYNLDYENDLLSYVWSRWKEGRALEIVDPV 761

Query: 717  LKED-------FVVEEAKRLLLLGLACSHPIANERPRTSDVVQII---LGSVPVPNVPPF 866
            + +        F  +E  + + +GL C   +A  RP  S VV +       +P P  P +
Sbjct: 762  IVDSLSSQPSIFQPQEVLKCIQIGLLCVQELAEHRPAMSSVVWMFGSEATEIPQPKPPGY 821



>sp|Q09092|SRK6_BRAOL Putative serine/threonine-protein kinase
            receptor precursor (EC 2.7.1.37) (S-receptor kinase)
            (SRK).
          Length = 849

 Score =  203 bits (516), Expect = 6e-51
 Identities = 115/300 (38%), Positives = 175/300 (58%), Gaps = 12/300 (4%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    KLGQGG+G+VYKG L  +G EIAVK  S+ S++G  +F+ E+++I RL+H 
Sbjct: 524  ATENFSSCNKLGQGGFGIVYKGRLL-DGKEIAVKRLSKTSVQGTDEFMNEVTLIARLQHI 582

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF       L+W  R  I +GV   L YLH
Sbjct: 583  NLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRRSKLNWNERFDITNGVARGLLYLH 642

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR  + + T     + V GT GY++PE 
Sbjct: 643  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFERDETEANTMK-VVGTYGYMSPEY 701

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQ--RPGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  +E+SD+++FG ++LE+V G+  R    +     L+ +VW   ++GR LE VD  
Sbjct: 702  AMYGIFSEKSDVFSFGVIVLEIVSGKKNRGFYNLDYENDLLSYVWSRWKEGRALEIVDPV 761

Query: 717  LKED-------FVVEEAKRLLLLGLACSHPIANERPRTSDVVQII---LGSVPVPNVPPF 866
            + +        F  +E  + + +GL C   +A  RP  S VV +       +P P  P +
Sbjct: 762  IVDSLSSQPSIFQPQEVLKCIQIGLLCVQELAEHRPAMSSVVWMFGSEATEIPQPKPPGY 821



>gb:AK117389_1815427 Arabidopsis thaliana At2g02800 mRNA for
           putative protein kinase, complete cds, clone:
           RAFL16-97-F04.
          Length = 426

 Score =  202 bits (515), Expect = 8e-51
 Identities = 114/285 (40%), Positives = 171/285 (60%), Gaps = 12/285 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT NF     LG+GG+G V+KGW+          G G+ +AVK    E  +G  ++L E+
Sbjct: 79  ATRNFRPDSLLGEGGFGYVFKGWIDGTTLTASKPGSGIVVAVKKLKTEGYQGHKEWLTEV 138

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + + +L H +LVKL+G+C      LLVYE+MP GSL+ HLF  G   PL+W +R K+  G
Sbjct: 139 NYLGQLSHPNLVKLVGYCVEGENRLLVYEFMPKGSLENHLFRRG-AQPLTWAIRMKVAIG 197

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH + + +V++RD KA+NI+LD+ FN++L DFGLA+A      ++   + V G
Sbjct: 198 AAKGLTFLH-DAKSQVIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQ-VMG 255

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG+ T +SD+Y+FG VLLE++ G+R    +++G  QSLVDW   +L   
Sbjct: 256 THGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDRSKVGMEQSLVDWATPYLGDK 315

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVV 821
            ++   +D RL   +  + A     L L C +P A  RP+ S+V+
Sbjct: 316 RKLFRIMDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVL 360



>gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0008M17, complete sequence.
          Length = 1042

 Score =  202 bits (515), Expect = 8e-51
 Identities = 116/284 (40%), Positives = 169/284 (59%), Gaps = 2/284 (0%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF     LG+GGYG+V+KG L+ +G  + VK  S+ S +G+  F  E+  I+R++H 
Sbjct: 694  ATENFSSSNLLGEGGYGLVHKGRLS-DGRAVPVKQLSQSSNQGKKQFATEIETISRVQHC 752

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L G C      LLVYEY+ +GSLDQ LF  G  + L W  R +I  G+   + YLH
Sbjct: 753  NLVTLYGCCLESNTPLLVYEYLENGSLDQALFGKGSLN-LDWPTRFEICLGLARGIAYLH 811

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R+VHRD+KASN++LD+  N ++ DFGLA+  DN++T  +    VAGT GY+APE 
Sbjct: 812  EDSTVRIVHRDIKASNVLLDAGLNPKISDFGLAKLYDNKKTHVS--TKVAGTFGYLAPEY 869

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVWFLHRDGRILEAVDIR 716
             + G  TE+ D++AFG V LE V G+     T       + + VW L+ +G  L+ VD +
Sbjct: 870  AMRGHMTEKVDVFAFGVVALETVAGESNYQNTLEEDRTYIFERVWELYENGHPLDFVDPK 929

Query: 717  LKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPV 848
            L E F  EE  R++ + L C+    ++RP  S VV ++ G   +
Sbjct: 930  LSE-FNSEEVIRVIRVALLCTQGSPHKRPPMSKVVSMLTGDADI 972



>gb:BOY18259_1633944 Brassica oleracea mRNA for SRK5 protein, partial.
          Length = 848

 Score =  202 bits (515), Expect = 8e-51
 Identities = 116/298 (38%), Positives = 178/298 (59%), Gaps = 10/298 (3%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATE+F +  K+G+GG+GVVYKG L  +G EIAVK  S  S +G  +F+ E+ +I +L+H 
Sbjct: 523  ATEHFSDFNKVGKGGFGVVYKGRLV-DGQEIAVKRLSEMSAQGTDEFMNEVRLIAKLQHY 581

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+LLG C   G+ +L+YEY+ + SLD HLF    +  L+W++R  I++G+   L YLH
Sbjct: 582  NLVRLLGCCVYEGEKILIYEYLENLSLDSHLFDETRSCMLNWQMRFDIINGIARGLLYLH 641

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLKASN++LD +   ++ DFG+AR    + T   +   V GT GY++PE 
Sbjct: 642  QDSRFRIIHRDLKASNVLLDKDMTPKISDFGMARIFGRDETE-ADTRKVVGTYGYMSPEY 700

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQS--LVDWVWFLHRDGRILEAVDIR 716
             + G  + +SD+++FG +LLE++ G+R         S  L+  VW   ++G+ LE VD  
Sbjct: 701  AMNGTFSMKSDVFSFGVLLLEIISGKRNKGLCDSDSSLNLLGCVWRNWKEGQGLEIVDRV 760

Query: 717  LKED----FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVPNVPPF 866
            + +     F   E  R L +GL C      +RP  S VV ++LGS    +P P  P +
Sbjct: 761  IIDSSSPMFRPREISRCLQIGLLCVQERVEDRPMMSSVV-LMLGSEAALIPQPKQPGY 817



>gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MOB24.
          Length = 567

 Score =  202 bits (515), Expect = 8e-51
 Identities = 115/287 (40%), Positives = 167/287 (58%), Gaps = 7/287 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT  F E   LG+GG+G VYKG L   G E+AVK     S +G+ +F AE++II+++ H+
Sbjct: 267  ATNKFSEANLLGEGGFGFVYKGIL-NNGNEVAVKQLKVGSAQGEKEFQAEVNIISQIHHR 325

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV L+G+C    + LLVYE++P+ +L+ HL  G     + W LR KI       L YLH
Sbjct: 326  NLVSLVGYCIAGAQRLLVYEFVPNNTLEFHLH-GKGRPTMEWSLRLKIAVSSSKGLSYLH 384

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLAR-ALDNERTSYTEGEGVAGTIGYIAPE 539
                 +++HRD+KA+NI++D  F A++ DFGLA+ ALD      T    V GT GY+APE
Sbjct: 385  ENCNPKIIHRDIKAANILIDFKFEAKVADFGLAKIALDTNTHVSTR---VMGTFGYLAPE 441

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRP--GTRIGGFQSLVDWVWFL----HRDGRILE 701
               +GK TE+SD+Y+FG VLLE++ G+RP     +    SLVDW   L      +     
Sbjct: 442  YAASGKLTEKSDVYSFGVVLLELITGRRPVDANNVYADDSLVDWARPLLVQALEESNFEG 501

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSV 842
              DI+L  ++  EE  R++    AC    A  RPR   VV+++ G++
Sbjct: 502  LADIKLNNEYDREEMARMVACAAACVRYTARRRPRMDQVVRVLEGNI 548



>pir|T00848|T00848 probable serine/threonine-specific protein kinase
           T20F6.6  (EC 2.7.1.-) - Arabidopsis
           thaliana>gb:AC002521_1530800 Arabidopsis thaliana
           chromosome 2 clone T20F6 map CIC11A04, complete
           sequence.>gb:AY125559_1580364 Arabidopsis thaliana
           At2g02800/T20F6.6 mRNA, complete cds.>gb:D88207_1675097
           Arabidopsis thaliana APK2b mRNA for protein kinase,
           complete cds.>gb:AF428432_1799362 Arabidopsis thaliana
           At2g02800/T20F6.6 mRNA, complete cds.
          Length = 426

 Score =  202 bits (515), Expect = 8e-51
 Identities = 114/285 (40%), Positives = 171/285 (60%), Gaps = 12/285 (4%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWL---------AGEGLEIAVKWFSRESIKGQGDFLAEL 155
           AT NF     LG+GG+G V+KGW+          G G+ +AVK    E  +G  ++L E+
Sbjct: 79  ATRNFRPDSLLGEGGFGYVFKGWIDGTTLTASKPGSGIVVAVKKLKTEGYQGHKEWLTEV 138

Query: 156 SIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSG 335
           + + +L H +LVKL+G+C      LLVYE+MP GSL+ HLF  G   PL+W +R K+  G
Sbjct: 139 NYLGQLSHPNLVKLVGYCVEGENRLLVYEFMPKGSLENHLFRRG-AQPLTWAIRMKVAIG 197

Query: 336 VGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAG 515
               L +LH + + +V++RD KA+NI+LD+ FN++L DFGLA+A      ++   + V G
Sbjct: 198 AAKGLTFLH-DAKSQVIYRDFKAANILLDAEFNSKLSDFGLAKAGPTGDKTHVSTQ-VMG 255

Query: 516 TIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQR--PGTRIGGFQSLVDWVW-FLHRD 686
           T GY APE + TG+ T +SD+Y+FG VLLE++ G+R    +++G  QSLVDW   +L   
Sbjct: 256 THGYAAPEYVATGRLTAKSDVYSFGVVLLELLSGRRAVDKSKVGMEQSLVDWATPYLGDK 315

Query: 687 GRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVV 821
            ++   +D RL   +  + A     L L C +P A  RP+ S+V+
Sbjct: 316 RKLFRIMDTRLGGQYPQKGAYTAASLALQCLNPDAKLRPKMSEVL 360



>gb:OSJN00153_1695778 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011F23, complete sequence.
          Length = 415

 Score =  202 bits (514), Expect = 1e-50
 Identities = 120/300 (40%), Positives = 180/300 (60%), Gaps = 7/300 (2%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFS-RESIKGQGDFLAELSIINRLRH 179
           AT +F +K +LG+GG+G VY G L  +G ++AVK  S  +S +G+ +F  E+++I  ++H
Sbjct: 76  ATRDFHQKNQLGRGGFGPVYLGKL-DDGRKVAVKQLSVGKSGQGESEFFVEVNMITSIQH 134

Query: 180 KHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYL 359
           K+LV+L+G C    + LLVYEYM + SLD+ LF       L+W+ R +I+ G+   LQYL
Sbjct: 135 KNLVRLVGCCSEGQQRLLVYEYMKNKSLDKILFGVDGAPFLNWKTRHQIIIGIARGLQYL 194

Query: 360 HNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPE 539
           H E   R+VHRD+KASNI+LD  F  ++ DFGLAR    ++T  +     AGT+GY APE
Sbjct: 195 HEESNLRIVHRDIKASNILLDDKFQPKISDFGLARFFPEDQTYLS--TAFAGTLGYTAPE 252

Query: 540 CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRI---GGFQSLVDWVWFLHRDGRILEAVD 710
             + G+ T ++D Y+FG ++LE+V   R  T +      Q L +  W L+   +ILE VD
Sbjct: 253 YAIRGELTVKADTYSFGVLVLEIV-SSRKNTDLSLPNEMQYLPEHAWRLYEQSKILELVD 311

Query: 711 IRLKED-FVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNV--PPFRPAFV 881
            +L+ D F  +E  ++  + L C  P  N RP  S+VV ++       +V   P RPAF+
Sbjct: 312 AKLQADGFDEKEVMQVCQIALLCVQPFPNLRPAMSEVVLMLTMKTTEQSVIPAPVRPAFL 371



>gb:AY074844_1567697 Arabidopsis thaliana AT4g21410/T6K22_140 mRNA,
            complete cds.
          Length = 679

 Score =  202 bits (514), Expect = 1e-50
 Identities = 115/305 (37%), Positives = 181/305 (59%), Gaps = 7/305 (2%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            AT+NF  + +LG+GG+G VYKG +  +G EIAVK  S  S +G  +F  E+ ++ +L+H+
Sbjct: 353  ATDNFSSENELGRGGFGSVYKG-VFPQGQEIAVKRLSGNSGQGDNEFKNEILLLAKLQHR 411

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV+L+G+C +  + LLVYE++ + SLDQ +F   +   L W +R K++ G+   L YLH
Sbjct: 412  NLVRLIGFCIQGEERLLVYEFIKNASLDQFIFDTEKRQLLDWVVRYKMIGGIARGLLYLH 471

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERT-SYTEGEGVAGTIGYIAPE 539
             +   R++HRDLKASNI+LD   N ++ DFGLA+  D+ +T ++     +AGT GY+APE
Sbjct: 472  EDSRFRIIHRDLKASNILLDQEMNPKIADFGLAKLFDSGQTMTHRFTSRIAGTYGYMAPE 531

Query: 540  CLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG------FQSLVDWVWFLHRDGRILE 701
              + G+ + ++D+++FG +++E++ G+R     GG       + L+ WVW   R+  IL 
Sbjct: 532  YAMHGQFSVKTDVFSFGVLVIEIITGKRNNN--GGSNGDEDAEDLLSWVWRSWREDTILS 589

Query: 702  AVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGSVPVPNVPPFRPAFV 881
             +D  L       E  R + +GL C    A  RP T   V ++L S       P RPAFV
Sbjct: 590  VIDPSLTAG-SRNEILRCIHIGLLCVQESAATRP-TMATVSLMLNSYSFTLPTPLRPAFV 647

Query: 882  WPSAL 896
              S +
Sbjct: 648  LESVV 652



>gb:AB032473_1518696 Brassica oleracea SRK18 mRNA for S18 S-locus
            receptor kinase, complete cds.
          Length = 856

 Score =  202 bits (514), Expect = 1e-50
 Identities = 119/305 (39%), Positives = 178/305 (58%), Gaps = 17/305 (5%)
 Frame = +3

Query: 3    ATENFGEKKKLGQGGYGVVYKGWLAGEGLEIAVKWFSRESIKGQGDFLAELSIINRLRHK 182
            ATENF    K+G+GG+G+VYKG L  +G EIAVK  S+ S +G  +F+ E+++I RL+H 
Sbjct: 523  ATENFSSCNKIGEGGFGIVYKGRLL-DGQEIAVKRLSKTSFQGTDEFMNEVTLIARLQHI 581

Query: 183  HLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETDPLSWELRCKIVSGVGYALQYLH 362
            +LV++LG C    + +L+YEY+ + SLD +LF    +  LSW+ R  I +GV   L YLH
Sbjct: 582  NLVQVLGCCIEGDEKMLIYEYLENLSLDSYLFGKTRSSKLSWKERFDITNGVARGLLYLH 641

Query: 363  NEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTEGEGVAGTIGYIAPEC 542
             +   R++HRDLK SNI+LD N   ++ DFG+AR    + T     + V GT GY++PE 
Sbjct: 642  QDSRFRIIHRDLKVSNILLDKNMIPKISDFGMARIFARDETEANTMK-VVGTYGYMSPEY 700

Query: 543  LLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGGFQSL------VDWVWFLHRDGRILEA 704
             + G  +E+SD+++FG ++LE+V G+R      GF +L      + + W   ++GR LE 
Sbjct: 701  AMNGIFSEKSDVFSFGVIVLEIVTGKRN----RGFYNLNYKNNFLSYAWSNWKEGRALEI 756

Query: 705  VD-------IRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQIILGS----VPVP 851
            VD         L   F  +E  + + +GL C   +A  RP  S VV  +LGS    +P P
Sbjct: 757  VDPVIVDSLSPLSSTFQPQEVLKCIQIGLLCVQELAEHRPTMSTVVW-MLGSEATEIPQP 815

Query: 852  NVPPF 866
              P +
Sbjct: 816  KPPGY 820



>gb:AX038195_1457677 Sequence 10 from Patent WO0060086.
          Length = 383

 Score =  202 bits (514), Expect = 1e-50
 Identities = 116/293 (39%), Positives = 172/293 (58%), Gaps = 17/293 (5%)
 Frame = +3

Query: 3   ATENFGEKKKLGQGGYGVVYK--------GWLAGEGL-----EIAVKWFSRESIKGQGDF 143
           AT++F    ++G GGYGVV+K        G    EG+     ++AVK  S ES +G  +F
Sbjct: 18  ATDSFHPTNRIGGGGYGVVFKMCNGSDRLGQREAEGVLRDGTQVAVKSLSAESKQGTREF 77

Query: 144 LAELSIINRLRHKHLVKLLGWCHRHGKLLLVYEYMPHGSLDQHLFIGGETD--PLSWELR 317
           L E+++I+ + H +LVKL+G C      +LVYEY+ + SL   L +G  +   PL W  R
Sbjct: 78  LTEINLISNIHHPNLVKLIGCCIEGNNRILVYEYLENNSLASVL-LGSRSRYVPLDWSKR 136

Query: 318 CKIVSGVGYALQYLHNEFEQRVVHRDLKASNIMLDSNFNARLGDFGLARALDNERTSYTE 497
             I  G    L +LH E E  VVHRD+KASNI+LDSNF+ ++GDFGLA+   +  T  + 
Sbjct: 137 AAICVGTASGLAFLHEEVEPHVVHRDIKASNILLDSNFSPKIGDFGLAKLFPDNVTHVS- 195

Query: 498 GEGVAGTIGYIAPECLLTGKATEQSDIYAFGAVLLEVVCGQRPGTRIGG--FQSLVDWVW 671
              VAGT+GY+APE  L G+ T+++D+Y+FG ++LEV+ G        G  +  LV+WVW
Sbjct: 196 -TRVAGTVGYLAPEYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWVW 254

Query: 672 FLHRDGRILEAVDIRLKEDFVVEEAKRLLLLGLACSHPIANERPRTSDVVQII 830
            L  + R+LE VD  L + F  +E  R + + L C+   A +RP    V++++
Sbjct: 255 KLREERRLLECVDPELTK-FPADEVTRFIKVALFCTQAAAQKRPNMKQVMEML 306


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,416,961,812
Number of Sequences: 1806583
Number of extensions: 33725355
Number of successful extensions: 127560
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 100634
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 108212
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 93407712510
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)