BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2221
         (826 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|G84697|G84697 hypothetical protein At2g29560 [imported] - Ar...   356   3e-97   Arabidopsis thaliana [mouse-ear cress]
gb:AC135208_1742054 Oryza sativa (japonica cultivar-group) chrom...   274   2e-72   
gb:AY245549_1592553 Dunaliella salina enolase mRNA, complete cds.     267   2e-70   
gb:BC059434_2552411 Danio rerio zgc:73056, mRNA (cDNA clone MGC:...   221   1e-56   
gb:AJ720730_2502917 Gallus gallus partial mRNA for hypothetical ...   218   1e-55   
pir|JC4186|JC4186 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   218   1e-55   Gallus gallus [bantam]
sp|P51913|ENOA_CHICK|ENOA_CHICK Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   218   1e-55   Gallus gallus [bantam]
gb:AF072587_2471656 Sceloporus undulatus alpha enolase mRNA, com...   216   4e-55   
sp|O57391|ENOG_CHICK|ENOG_CHICK Gamma enolase (EC 4.2.1.11) (2-phospho-D-gl...   216   4e-55   Gallus gallus [bantam]
sp|Q9W7L2|ENOA_SCEUN|ENOA_SCEUN Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   216   4e-55   Sceloporus undulatus
gb:HSM805698_2018000 Homo sapiens mRNA; cDNA DKFZp686B0286 (from...   216   5e-55   
pir|S06756|S06756 phosphopyruvate hydratase (EC 4.2.1.11) beta -...   216   5e-55   Homo sapiens [man]
gb:BC071359_2556101 Danio rerio zgc:73152, mRNA (cDNA clone MGC:...   215   7e-55   
gb:BC059511_2552488 Danio rerio zgc:73152, mRNA (cDNA clone MGC:...   215   9e-55   
gb:BC045082_2549034 Xenopus laevis enolase 3, beta muscle, mRNA ...   215   9e-55   
gb:BT007464_2150396 Synthetic construct Homo sapiens enolase 1, ...   215   9e-55   
gb:HS2PPHAE_1997962 H.sapiens mRNA for 2-phosphopyruvate-hydrata...   215   9e-55   
gb:CR860345_1184424 Pongo pygmaeus mRNA; cDNA DKFZp459M1013 (fro...   215   9e-55   
pir|S11696|A29170 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   215   9e-55   
sp|P06733|ENOA_HUMAN|ENOA_HUMAN Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   215   9e-55   Homo sapiens [man]
gb:AF072589_2471658 Python regius alpha enolase mRNA, complete cds.   214   1e-54   
gb:BT009876_2151264 Synthetic construct Homo sapiens enolase 2, ...   214   1e-54   
gb:HSEN1_2012966 Human mRNA fragment for neurone-specific enolas...   214   1e-54   
gb:CR859195_1183327 Pongo pygmaeus mRNA; cDNA DKFZp459B1817 (fro...   214   1e-54   
pir|A32132|A32132 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   214   1e-54   Anas platyrhynchos [duck]
pir|JU0060|NOHUG phosphopyruvate hydratase (EC 4.2.1.11) gamma -...   214   1e-54   
sp|P09104|ENOG_HUMAN|ENOG_HUMAN Gamma enolase (EC 4.2.1.11) (2-phospho-D-gl...   214   1e-54   Homo sapiens [man]
sp|Q9W7L0|ENOA_PYTRG|ENOA_PYTRG Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   214   1e-54   Python regius [ball python]
sp|P19140|ENOA_ANAPL|ENOA_ANAPL Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   214   1e-54   Anas platyrhynchos [duck]
pir|S10247|S10247 phosphopyruvate hydratase (EC 4.2.1.11) gamma ...   214   2e-54   Mus musculus [mouse]
sp|P17183|ENOG_MOUSE|ENOG_MOUSE Gamma enolase (EC 4.2.1.11) (2-phospho-D-gl...   214   2e-54   Mus musculus [mouse]
gb:BC054169_2550824 Xenopus laevis enolase 1, alpha, mRNA (cDNA ...   214   2e-54   
gb:AF266193_2483246 Gillichthys mirabilis alpha enolase mRNA, pa...   214   2e-54   
gb:AF428105_2494042 Crocodylus palustris tissue-type eye lens ta...   213   3e-54   
gb:HSMSER_2018908 H.sapiens mRNA for muscle specific enolase (MS...   213   3e-54   
gb:HSENO3_2012995 H.sapiens ENO3 gene for muscle specific enolase.    213   3e-54   
gb:BC017249_1975990 Homo sapiens enolase 3 (beta, muscle), trans...   213   3e-54   
sp|P13929|ENOB_HUMAN|ENOB_HUMAN Beta enolase (EC 4.2.1.11) (2-phospho-D-gly...   213   3e-54   Homo sapiens [man]
gb:AF149256_1415145 Bos taurus alpha enolase mRNA, complete cds.      213   4e-54   
sp|Q9XSJ4|ENOA_BOVIN|ENOA_BOVIN Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   213   4e-54   Bos taurus [bovine]
gb:BC090069_2111199 Rattus norvegicus enolase 1, alpha, mRNA (cD...   213   5e-54   
gb:BC081847_2108095 Rattus norvegicus cDNA clone IMAGE:7189453, ...   213   5e-54   
gb:BC078896_2107048 Rattus norvegicus enolase 1, alpha, mRNA (cD...   213   5e-54   
gb:BC063174_2105194 Rattus norvegicus enolase 1, alpha, mRNA (cD...   213   5e-54   
pir|A24742|A24742 phosphopyruvate hydratase (EC 4.2.1.11) gamma ...   213   5e-54   Rattus norvegicus [brown rat]
sp|P07323|ENOG_RAT|ENOG_RAT Gamma enolase (EC 4.2.1.11) (2-phospho-D-glyc...   213   5e-54   Rattus norvegicus [brown rat]
gb:AY725787_1348715 Oncometopia nigricans enolase mRNA, complete...   212   6e-54   
sp|P04764|ENOA_RAT|ENOA_RAT Alpha enolase (EC 4.2.1.11) (2-phospho-D-glyc...   212   6e-54   Rattus norvegicus [brown rat]
gb:AY650330_1958277 Macaca fascicularis enolase 2 mRNA, partial ...   212   8e-54   
pir|JC1039|JC1039 phosphopyruvate hydratase (EC 4.2.1.11) - rat       212   8e-54   Rattus norvegicus [brown rat]
gb:BC041279_2547911 Xenopus laevis similar to enolase 1, alpha n...   211   1e-53   
gb:CET21B10_1367891 Caenorhabditis elegans cosmid T21B10, comple...   211   1e-53   
pir|T25040|T25040 hypothetical protein T21B10.2 - Caenorhabditis...   211   1e-53   Caenorhabditis elegans [roundworm]
sp|Q27527|ENO_CAEEL|ENO_CAEEL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   211   1e-53   Caenorhabditis elegans [roundworm]
gb:AF072586_2471655 Alligator mississippiensis alpha enolase mRN...   211   1e-53   
sp|Q9PVK2|ENOA_ALLMI|ENOA_ALLMI Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   211   1e-53   Alligator mississippiensis
pir|S00463|NOXL phosphopyruvate hydratase (EC 4.2.1.11) ENO1 - A...   211   2e-53   
sp|P08734|ENO_XENLA|ENO_XENLA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   211   2e-53   Xenopus laevis [clawed frog]
gb:BC061287_2553064 Xenopus tropicalis Enolase (2-phosphoglycera...   210   2e-53   
gb:AF072588_2471657 Trachemys scripta elegans alpha enolase mRNA...   210   2e-53   
sp|Q9W7L1|ENOA_TRASC|ENOA_TRASC Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   210   2e-53   Trachemys scripta [dime-store turtle]
gb:UPU85835_1407332 Unidentified pseudophyllidean enolase mRNA, ...   210   3e-53   
pir|S02072|S02072 phosphopyruvate hydratase (EC 4.2.1.11) beta -...   209   4e-53   Rattus norvegicus [brown rat]
sp|P15429|ENOB_RAT|ENOB_RAT Beta enolase (EC 4.2.1.11) (2-phospho-D-glyce...   209   4e-53   Rattus norvegicus [brown rat]
gb:BC083566_2108652 Rattus norvegicus enolase 3, beta, mRNA (cDN...   209   5e-53   
gb:BC083334_2108601 Mus musculus cDNA clone IMAGE:6414729, parti...   209   5e-53   
gb:BC039179_2098372 Mus musculus enolase 1, alpha non-neuron, mR...   209   5e-53   
gb:AL596117_2070857 Mouse DNA sequence from clone RP23-326P7 on ...   209   5e-53   
gb:AK002336_1151129 Mus musculus adult male kidney cDNA, RIKEN f...   209   5e-53   
gb:AK002322_1151121 Mus musculus adult male kidney cDNA, RIKEN f...   209   5e-53   
pir|S10246|S10246 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   209   5e-53   Mus musculus [mouse]
pir|S17109|NOMSB phosphopyruvate hydratase (EC 4.2.1.11) beta - ...   209   5e-53   
sp|P21550|ENOB_MOUSE|ENOB_MOUSE Beta enolase (EC 4.2.1.11) (2-phospho-D-gly...   209   5e-53   Mus musculus [mouse]
sp|P17182|ENOA_MOUSE|ENOA_MOUSE Alpha enolase (EC 4.2.1.11) (2-phospho-D-gl...   209   5e-53   Mus musculus [mouse]
gb:AY398342_2531872 Danio rerio clone RK122A2D02 enolase 1, (alp...   209   7e-53   
gb:AF260259_1416988 Oryctolagus cuniculus beta beta enolase mRNA...   209   7e-53   
pir|A23126|A23126 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   209   7e-53   Rattus norvegicus [brown rat]
pir|A37210|A37210 phosphopyruvate hydratase (EC 4.2.1.11) beta -...   209   7e-53   Oryctolagus cuniculus [domestic rabbit]
sp|P25704|ENOB_RABIT|ENOB_RABIT Beta enolase (EC 4.2.1.11) (2-phospho-D-gly...   209   7e-53   Oryctolagus cuniculus [domestic rabbit]
gb:CSU85836_1375802 Calliobothrium sp. enolase mRNA, partial cds.     208   9e-53   
pir|JC4187|JC4187 phosphopyruvate hydratase (EC 4.2.1.11) beta c...   207   1e-52   Gallus gallus [bantam]
sp|P07322|ENOB_CHICK|ENOB_CHICK Beta enolase (EC 4.2.1.11) (2-phospho-D-gly...   207   1e-52   Gallus gallus [bantam]
gb:BC072713_2556643 Danio rerio enolase 2, mRNA (cDNA clone MGC:...   206   3e-52   
gb:SSU85829_1398134 Spongilla sp. enolase mRNA, partial cds.          206   4e-52   
gb:TSU85834_1401118 Tubularia sp. enolase mRNA, partial cds.          204   1e-51   
gb:AF363629_1265653 Trichinella spiralis enolase (Eno) mRNA, com...   204   2e-51   
pir|A23850|A23850 phosphopyruvate hydratase (EC 4.2.1.11), skele...   202   5e-51   Gallus gallus [bantam]
gb:HCU85827_1385822 Hydra cf. oligactis enolase mRNA, partial cds.    201   1e-50   
gb:HDU85833_1385869 Hymenolepis diminuta enolase mRNA, partial cds.   201   1e-50   
sp|O02654|ENO_LOLPE|ENO_LOLPE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   201   1e-50   Doryteuthis pealeii [longfin inshore squid]
sp|Q9U615|ENO_MASBA|ENO_MASBA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   199   4e-50   Mastigamoeba balamuthi
sp|P56252|ENO_HOMGA|ENO_HOMGA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   199   5e-50   Homarus gammarus
gb:AF100985_1241267 Penaeus monodon phosphopyruvate hydratase mR...   198   9e-50   
pir|B96768|B96768 protein enolase F2P9.10 [imported] - Arabidops...   198   1e-49   Arabidopsis thaliana [mouse-ear cress]
sp|P26300|ENO_LYCES|ENO_LYCES Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   197   2e-49   Solanum lycopersicum
gb:AY005161_2507833 Salmo trutta alpha-1 enolase-1 mRNA, partial...   197   3e-49   
gb:AB026051_1194327 Plasmodium falciparum mRNA for enolase, comp...   196   3e-49   
gb:AE014185_937732 Plasmodium falciparum 3D7 chromosome 10 compl...   196   3e-49   
sp|Q27727|ENO_PLAFA|ENO_PLAFA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   196   3e-49   Plasmodium falciparum
gb:AY118449_1300171 Drosophila melanogaster SD23356 full insert ...   196   4e-49   
gb:AE014134_1127043 Drosophila melanogaster chromosome 2L, compl...   196   4e-49   
gb:AF348936_1790164 Chlamydomonas reinhardtii enolase (eno) gene...   196   6e-49   
gb:AF532606_1279814 Onchocerca volvulus enolase mRNA, complete cds.   195   8e-49   
gb:AE014134_1127047 Drosophila melanogaster chromosome 2L, compl...   195   8e-49   
sp|P15007|ENO_DROME|ENO_DROME Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   195   8e-49   Drosophila melanogaster
sp|P42895|ENO2_MAIZE|ENO2_MAIZE Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   195   8e-49   Zea mays [maize]
gb:BC046928_1983760 Homo sapiens enolase 1, (alpha) pseudogene, ...   194   2e-48   
gb:AY430417_1605980 Heterosigma akashiwo enolase gene, partial cds.   194   2e-48   
gb:ASI496792_1285626 Anisakis simplex mRNA for enolase (eno gene).    194   2e-48   
gb:EGR272112_1676457 Euglena gracilis partial mRNA for chloropla...   194   2e-48   
sp|Q27877|ENO_SCHMA|ENO_SCHMA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   194   2e-48   Schistosoma mansoni
sp|P51555|ENO1_ENTHI|ENO1_ENTHI Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   194   2e-48   Entamoeba histolytica
gb:AF115859_2474784 Pelusios subniger alpha enolase mRNA, partia...   193   3e-48   
gb:AY297757_1596488 Gossypium barbadense enolase mRNA, complete ...   193   3e-48   
sp|P33676|ENO_SCHJA|ENO_SCHJA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   193   3e-48   Schistosoma japonicum
gb:LLU271785_1685106 Lupinus luteus mRNA for enolase.                 193   4e-48   
gb:AF115856_2474781 Sphenodon punctatus alpha enolase mRNA, part...   192   5e-48   
gb:AY054253_1563073 Arabidopsis thaliana At2g36530/F1O11.16 mRNA...   192   5e-48   
gb:LTU85828_1389275 Lacistorhynchus tenuis enolase mRNA, partial...   192   5e-48   
pir|A53665|A53665 phosphopyruvate hydratase (EC 4.2.1.11) - live...   192   5e-48   Fasciola hepatica
sp|Q27655|ENO_FASHE|ENO_FASHE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   192   5e-48   Fasciola hepatica
sp|O74286|ENO_CUNEL|ENO_CUNEL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   192   5e-48   Cunninghamella elegans
gb:AF428279_1799209 Arabidopsis thaliana At2g36530/F1O11.16 mRNA...   192   6e-48   
gb:SOL271719_1715700 Spinacia oleracea mRNA for enolase (eno gene).   192   6e-48   
gb:AY559080_1614837 Capsella bursa-pastoris LOS2 (los2) mRNA, co...   192   6e-48   
gb:AY335488_1600218 Oryza sativa (japonica cultivar-group) enola...   192   6e-48   
gb:AY072095_1566989 Arabidopsis thaliana putative enolase (2-pho...   192   6e-48   
sp|Q42971|ENO_ORYSA|ENO_ORYSA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   192   6e-48   Oryza sativa [red rice]
sp|P25696|ENO_ARATH|ENO_ARATH Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   192   6e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AF115857_2474782 Eumeces inexpectatus alpha enolase mRNA, par...   191   1e-47   
pir|T12341|T12341 phosphopyruvate hydratase (EC 4.2.1.11) - comm...   191   1e-47   Mesembryanthemum crystallinum
sp|Q43130|ENO_MESCR|ENO_MESCR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   191   1e-47   Mesembryanthemum crystallinum
gb:AE017343_1755255 Cryptococcus neoformans var. neoformans JEC2...   191   2e-47   
gb:SSU85830_1398135 Stephanostomum sp. enolase mRNA, partial cds.     191   2e-47   
gb:AY522939_1332960 Centruroides sp. SBH266264 2-phospho-D-glyce...   191   2e-47   
gb:AF152348_1245588 Trypanosoma brucei brucei enolase gene, comp...   191   2e-47   
gb:AF115858_2474783 Trachemys scripta alpha enolase mRNA, partia...   190   2e-47   
gb:AF115855_2474780 Caiman crocodilus alpha enolase mRNA, partia...   190   2e-47   
gb:AY307448_1597835 Brassica rapa enolase mRNA, complete cds.         190   3e-47   
gb:HSU85826_1386472 Haematolechus sp. enolase mRNA, partial cds.      190   3e-47   
gb:AF424654_1798989 Phytophthora infestans clone MY-07-F-01 enol...   189   4e-47   
gb:AY092986_1574940 Arabidopsis thaliana enolase (2-phospho-D-gl...   189   4e-47   
sp|P42896|ENO_RICCO|ENO_RICCO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   188   9e-47   Ricinus communis
gb:AE016959_1021115 Oryza sativa (japonica cultivar-group) chrom...   187   2e-46   
gb:SZU85832_1398320 Stylochus zebra enolase mRNA, partial cds.        187   2e-46   
gb:CCU85831_1359529 Cerebratulus cf. lacteus enolase mRNA, parti...   187   2e-46   
gb:AY522934_1332955 Artemia sp. SBH266677 2-phospho-D-glycerate ...   187   2e-46   
gb:AF353515_1264906 Eimeria tenella enolase mRNA, complete cds.       187   2e-46   
gb:AF258670_1256778 Tomocerus sp. 'Tom' enolase mRNA, partial cds.    187   2e-46   
gb:AY307449_1597836 Brassica napus enolase mRNA, complete cds.        187   3e-46   
gb:AY496909_1609129 Glycine max enolase mRNA, complete cds.           186   4e-46   
gb:AY522932_1332953 Phormictopus sp. SBH266263 2-phospho-D-glyce...   186   6e-46   
gb:AF123457_1242904 Toxoplasma gondii enolase (ENO2) mRNA, compl...   186   6e-46   
gb:AP003526_1830451 Oryza sativa (japonica cultivar-group) genom...   185   8e-46   
pir|I50026|I50026 phosphopyruvate hydratase (EC 4.2.1.11) alpha ...   185   8e-46   Alligator mississippiensis
sp|P42897|ENO_ALLMI|ENO_ALLMI Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   185   8e-46   Alligator mississippiensis
sp|P26301|ENO1_MAIZE|ENO1_MAIZE Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   185   8e-46   Zea mays [maize]
gb:LMFP1408_1388739 Leishmania major Friedlin chromosome 14 PAC ...   185   1e-45   
sp|P42894|ENO_NEOFR|ENO_NEOFR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   184   1e-45   Neocallimastix frontalis
gb:AY005162_2507834 Salmo trutta alpha-2 enolase-1 mRNA, partial...   184   2e-45   
gb:EGR272111_1676456 Euglena gracilis mRNA for enolase (eno02 ge...   184   2e-45   
gb:AE017330_444845 Listeria monocytogenes str. 4b F2365, section...   184   2e-45   
sp|Q928I3|ENO_LISMO|ENO_LISMO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   184   2e-45   
sp|Q9LEJ0|ENO1_HEVBR|ENO1_HEVBR Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   183   3e-45   Hevea brasiliensis [jebe]
gb:CR382139_1672627 Debaryomyces hansenii chromosome G of strain...   183   4e-45   
gb:AY522931_1332952 Diplopoda sp. SBH266145 2-phospho-D-glycerat...   183   4e-45   
gb:AF051910_1236724 Toxoplasma gondii enolase mRNA, complete cds...   183   4e-45   
gb:AY005158_2507830 Neoceratodus forsteri beta enolase-1 mRNA, p...   182   5e-45   
gb:AY522938_1332959 Ostracoda sp. SBH266127 2-phospho-D-glycerat...   182   5e-45   
gb:AY522933_1332954 Limulus polyphemus 2-phospho-D-glycerate hyd...   182   5e-45   
sp|Q9LEI9|ENO2_HEVBR|ENO2_HEVBR Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   182   5e-45   Hevea brasiliensis [jebe]
gb:AY615333_1618127 Heterocapsa triquetra enolase 2 mRNA, partia...   182   7e-45   
gb:AY005154_2507826 Latimeria chalumnae alpha enolase-1 mRNA, pa...   181   1e-44   
gb:AF480465_1275304 Clonorchis sinensis enolase mRNA, complete cds.   181   1e-44   
sp|Q43321|ENO_ALNGL|ENO_ALNGL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   181   1e-44   
gb:AF348937_1790165 Scenedesmus rubescens enolase (eno) gene, pa...   181   1e-44   
gb:AY430422_1605985 Prymnesium parvum enolase gene, partial cds.      181   1e-44   
sp|Q870B9|ENO_RHORB|ENO_RHORB Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   181   1e-44   Rhodotorula mucilaginosa
gb:AY430424_1605987 Heterocapsa triquetra enolase gene, partial ...   181   2e-44   
sp|Q8ENP5|ENO_OCEIH|ENO_OCEIH Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   181   2e-44   Oceanobacillus iheyensis
gb:AY005157_2507829 Lepidosiren paradoxa beta enolase-1 mRNA, pa...   180   3e-44   
gb:CR382121_1654663 Kluyveromyces lactis strain NRRL Y-1140 chro...   180   3e-44   
gb:AF258665_1256773 Limulus polyphemus isolate Lpo23_344 enolase...   180   3e-44   
gb:BACTPIPMEN_746590 Bacillus subtilis phosphoglycerate kinase (...   180   3e-44   
sp|Q8PT81|ENO_METMA|ENO_METMA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   180   3e-44   Methanosarcina mazei
sp|Q8KG25|ENO2_CHLTE|ENO2_CHLTE Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   180   3e-44   Chlorobaculum tepidum
gb:DCU85837_1376805 Dugesia cf. dorotocephala enolase mRNA, part...   180   3e-44   
gb:AP006840_567438 Symbiobacterium thermophilum DNA, complete ge...   180   3e-44   
gb:AY005152_2507824 Amia calva alpha enolase-1 mRNA, partial cds.     179   4e-44   
sp|P37869|ENO_BACSU|ENO_BACSU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   179   4e-44   Bacillus subtilis
gb:ECU85825_1384245 Echinostoma caproni enolase mRNA, partial cds.    179   6e-44   
gb:AY430416_1605979 Apodachlya brachynema enolase 2 gene, partia...   179   7e-44   
gb:AY522930_1332951 Lithobius sp. SBH266126 2-phospho-D-glycerat...   179   7e-44   
gb:CR543861_103920 Acinetobacter sp. ADP1 complete genome.            179   7e-44   
gb:AE017333_449444 Bacillus licheniformis DSM 13, complete genom...   178   1e-43   
gb:AE017202_404085 Lactobacillus johnsonii NCC 533, section 3 of...   178   1e-43   
gb:AY430423_1605986 Thraustotheca clavata enolase gene, partial ...   178   1e-43   
sp|Q8TQ79|ENO_METAC|ENO_METAC Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   178   1e-43   Methanosarcina acetivorans
sp|Q9K596|ENO_ENTFA|ENO_ENTFA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   177   2e-43   Enterococcus faecalis
gb:AE016818_1748439 Ashbya gossypii (= Eremothecium gossypii) AT...   177   2e-43   
sp|Q88MF9|ENO_PSEPK|ENO_PSEPK Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   177   2e-43   Pseudomonas putida
gb:AY005153_2507825 Amia calva beta enolase-1 mRNA, partial cds.      177   3e-43   
gb:CR380955_1651623 Candida glabrata strain CBS138 chromosome I ...   177   3e-43   
gb:AY005160_2507832 Chiloscyllium punctatum beta enolase-1 mRNA,...   176   4e-43   
gb:HUMENOGA_2030892 Human gamma enolase mRNA, 3' end.                 176   4e-43   
gb:AY005159_2507831 Chiloscyllium punctatum alpha enolase-1 mRNA...   176   5e-43   
gb:AY314788_1598395 Tuber borchii enolase (eno-1) gene, promoter...   176   5e-43   
sp|Q886M3|ENO1_PSESM|ENO1_PSESM Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   176   5e-43   Pseudomonas syringae pv. tomato
gb:YSCENOA_1728862 S.cerevisiae enolase gene (clone peno46) and ...   176   6e-43   
gb:AF258671_1256779 Speleonectes tulumensis isolate Stu23_241 en...   176   6e-43   
pir|S64586|NOBY phosphopyruvate hydratase (EC 4.2.1.11) 1 [valid...   176   6e-43   
sp|P00924|ENO1_YEAST|ENO1_YEAST Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   176   6e-43   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380952_1650578 Candida glabrata strain CBS138 chromosome F ...   175   8e-43   
gb:CR378673_96372 Photobacterium profundum SS9; segment 11/12.        175   8e-43   
gb:AY499570_1609606 Cryphonectria parasitica enolase (Eno1) gene...   175   1e-42   
sp|Q9HXZ5|ENO_PSEAE|ENO_PSEAE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   175   1e-42   Pseudomonas aeruginosa
gb:AY522937_1332958 Nereis macrydi 2-phospho-D-glycerate hydrola...   174   1e-42   
sp|P40370|EN11_SCHPO|EN11_SCHPO Enolase 1-1 (EC 4.2.1.11) (2-phosphoglycera...   174   1e-42   Schizosaccharomyces pombe
sp|Q8EBR0|ENO_SHEON|ENO_SHEON Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   174   2e-42   Shewanella oneidensis
gb:AY522935_1332956 Daphnia magna 2-phospho-D-glycerate hydrolas...   174   2e-42   
gb:AF375335_1266656 Araucarius minor isolate Cou02 enolase (Eno1...   174   2e-42   
gb:AF284645_1783088 Aspergillus fumigatus enolase mRNA, complete...   173   3e-42   
gb:AF258668_1256776 Polyxenus fasciculatus enolase mRNA, partial...   173   3e-42   
sp|P30575|ENO1_CANAL|ENO1_CANAL Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   173   4e-42   Candida albicans
gb:CR382132_1665642 Yarrowia lipolytica chromosome F of strain C...   172   5e-42   
gb:AB091508_1525051 Penicillium chrysogenum mRNA for enolase, co...   172   5e-42   
gb:CP000020_872251 Vibrio fischeri ES114 chromosome I, complete ...   172   5e-42   
gb:AE004969_60374 Neisseria gonorrhoeae FA 1090, complete genome.     172   5e-42   
pir|A01148|NOBY2 phosphopyruvate hydratase (EC 4.2.1.11) 2 - yea...   172   5e-42   
sp|Q9JZ53|ENO_NEIMB|ENO_NEIMB Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   172   5e-42   Neisseria meningitidis serogroup B
sp|Q9JU46|ENO_NEIMA|ENO_NEIMA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   172   5e-42   
sp|P00925|ENO2_YEAST|ENO2_YEAST Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   172   5e-42   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382136_1668681 Debaryomyces hansenii chromosome D of strain...   172   7e-42   
gb:CHU82438_1647470 Cladosporium herbarum enolase gene, complete...   172   7e-42   
gb:BA000043_739631 Geobacillus kaustophilus HTA426 DNA, complete...   172   7e-42   
sp|Q8Y0B5|ENO_RALSO|ENO_RALSO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   172   7e-42   Ralstonia solanacearum
sp|P42040|ENO_CLAHE|ENO_CLAHE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   172   7e-42   Cladosporium herbarum
sp|Q05524|ENOL_HUMAN|ENOL_HUMAN Alpha enolase, lung specific (EC 4.2.1.11) ...   172   7e-42   Homo sapiens [man]
gb:AF375333_1266654 Coleobothrus germeauxi enolase (Eno1ni) gene...   172   9e-42   
gb:AF025805_1234142 Drosophila pseudoobscura enolase (Eno) mRNA,...   172   9e-42   
gb:ECENO_125496 E.coli eno gene.                                      172   9e-42   
sp|Q88YH3|ENOA_LACPL|ENOA_LACPL Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   172   9e-42   Lactobacillus plantarum
gb:AF375290_1266624 Xylosandrus sp. SCY05 enolase (Eno2i) gene, ...   171   1e-41   
gb:AF258669_1256777 Scolopendra polymorpha enolase mRNA, partial...   171   1e-41   
gb:AF025806_1234143 Drosophila subobscura enolase (Eno) mRNA, pa...   171   1e-41   
gb:CP000001_855415 Bacillus cereus ZK, complete genome.               171   1e-41   
gb:AE017040_385266 Bacillus anthracis str. Ames section 17 of 18...   171   1e-41   
sp|Q8GR70|ENO_ENTHR|ENO_ENTHR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   171   1e-41   Enterococcus hirae
gb:CET21B10_1367893 Caenorhabditis elegans cosmid T21B10, comple...   171   2e-41   
gb:AF375283_1266617 Coccotrypes dactyliperda enolase (Eno2i) gen...   171   2e-41   
sp|Q8R967|ENO_THETN|ENO_THETN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   171   2e-41   
gb:AF348923_1790157 Prionitis lanceolata enolase 1 (eno) gene, p...   171   2e-41   
gb:AF254643_1781145 Penicillium citrinum enolase mRNA, complete ...   171   2e-41   
gb:AY430420_1605983 Phaeodactylum tricornutum enolase gene, part...   171   2e-41   
gb:AE017280_426438 Bacillus cereus ATCC 10987, section 17 of 18 ...   170   3e-41   
pir|E64103|E64103 phosphopyruvate hydratase (EC 4.2.1.11) - Haem...   170   3e-41   Haemophilus influenzae
sp|Q8U477|ENO_PYRFU|ENO_PYRFU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Pyrococcus furiosus
sp|P43806|ENO_HAEIN|ENO_HAEIN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Haemophilus influenzae
sp|Q9HDT3|ENO_ALTAL|ENO_ALTAL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Alternaria alternata
gb:AY522936_1332957 Callinectes sapidus 2-phospho-D-glycerate hy...   170   3e-41   
gb:BX936398_835400 Yersinia pseudotuberculosis IP32953 genome, c...   170   3e-41   
pir|H85928|H85928 enolase [imported] - Escherichia coli (strain ...   170   3e-41   Escherichia coli [E. coli]
pir|G65059|NOEC phosphopyruvate hydratase (EC 4.2.1.11) - Escher...   170   3e-41   
sp|Q8ZBN2|ENO_YERPE|ENO_YERPE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Yersinia pestis
sp|O59605|ENO_PYRHO|ENO_PYRHO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Pyrococcus horikoshii
sp|Q8F4T8|ENO_LEPIN|ENO_LEPIN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   
sp|P08324|ENO_ECOLI|ENO_ECOLI Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   170   3e-41   Escherichia coli [E. coli]
gb:AY142826_592009 Heliobacillus mobilis Enolase gene, partial cds.   169   4e-41   
gb:AE017152_392037 Haemophilus ducreyi strain 35000HP section 2 ...   169   4e-41   
sp|Q12560|ENO_ASPOR|ENO_ASPOR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   169   4e-41   Aspergillus oryzae
gb:AF348920_1790154 Mastocarpus papillatus enolase 1 (eno) mRNA,...   169   6e-41   
gb:BX950851_842301 Erwinia carotovora subsp. atroseptica SCRI104...   169   6e-41   
sp|Q9KPC5|ENO_VIBCH|ENO_VIBCH Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   169   6e-41   
gb:AY430415_1605978 Apodachlya brachynema enolase 1 gene, partia...   169   8e-41   
gb:AF375334_1266655 Stenancylus sp. COR01 enolase (Eno1ni) gene,...   169   8e-41   
gb:AF375291_1266625 Dryocoetoides cristatus enolase (Eno2i) gene...   169   8e-41   
gb:AE017014_379960 Bacillus cereus ATCC 14579 section 17 of 18 o...   169   8e-41   
pir|S43113|S43113 phosphopyruvate hydratase (EC 4.2.1.11) - fung...   169   8e-41   Cladosporium herbarum
sp|Q9CHS7|ENOA_LACLA|ENOA_LACLA Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   168   1e-40   Lactococcus lactis subsp. lactis
gb:AF063247_1765406 Pneumocystis carinii f. sp. ratti enolase mR...   168   1e-40   
gb:AY430421_1605984 Phytophthora palmivora enolase gene, partial...   168   1e-40   
gb:AF375341_1266662 Dendroctonus pseudotsugae enolase (Eno1ni) g...   168   1e-40   
gb:AF375284_1266618 Araptus sp. SCH05 enolase (Eno2i) gene, part...   168   1e-40   
gb:BX572602_802487 Rhodopseudomonas palustris CGA009 complete ge...   168   1e-40   
gb:AE016827_341885 Mannheimia succiniciproducens MBEL55E, comple...   168   1e-40   
sp|Q87LQ0|ENO_VIBPA|ENO_VIBPA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   168   1e-40   
sp|Q8GE63|ENO_AERHY|ENO_AERHY Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   168   1e-40   
gb:AF348921_1790155 Mastocarpus papillatus enolase 2 (eno) mRNA,...   167   2e-40   
gb:CR555306_108926 Azoarcus sp. EbN1 complete genome.                 167   2e-40   
gb:CP000031_86489 Silicibacter pomeroyi DSS-3, complete genome.       167   2e-40   
gb:AY130386_1302447 Branchiostoma lanceolatum enolase 3 mRNA, pa...   167   2e-40   
gb:BA000037_723644 Vibrio vulnificus YJ016 DNA, chromosome I, co...   167   2e-40   
gb:AE017340_456535 Idiomarina loihiensis L2TR, complete genome.       167   2e-40   
gb:AE001753_38786 Thermotoga maritima MSB8 section 65 of 136 of ...   167   2e-40   
pir|AC0859|AC0859 enolase [imported] - Salmonella enterica subsp...   167   2e-40   
sp|P42848|ENO_THEMA|ENO_THEMA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   167   2e-40   
sp|Q8XGP6|ENO_SALTY|ENO_SALTY Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   167   2e-40   
gb:BX571862_785772 Photorhabdus luminescens subsp. laumondii TTO...   167   3e-40   
pir|H75022|H75022 phosphopyruvate hydratase (EC 4.2.1.11) PAB112...   167   3e-40   
sp|Q8DC62|ENO_VIBVU|ENO_VIBVU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   167   3e-40   
sp|Q9UXZ0|ENO_PYRAB|ENO_PYRAB Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   167   3e-40   
sp|P57975|ENO_PASMU|ENO_PASMU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   167   3e-40   
gb:AF348935_1790163 Pedinomonas minor enolase (eno) gene, partia...   166   4e-40   
gb:AY714869_1190488 Uncultured archaeon GZfos3D4 clone GZfos3D4,...   166   4e-40   
gb:BX640418_806785 Bordetella pertussis strain Tohama I, complet...   166   4e-40   
pir|JC4036|JC4036 phosphopyruvate hydratase (EC 4.2.1.11) - fiss...   166   4e-40   
sp|P42222|ERR1_YEAST|ERR1_YEAST Enolase related protein 1 (EC 4.2.1.11).>pi...   166   4e-40   
sp|Q8XKU4|ENO_CLOPE|ENO_CLOPE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   166   4e-40   
sp|Q9K717|ENO_BACHD|ENO_BACHD Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   166   4e-40   
gb:BX294155_771816 Pirellula sp. strain 1 complete genome; segme...   166   5e-40   
gb:BA000040_733054 Bradyrhizobium japonicum USDA 110 DNA, comple...   166   5e-40   
gb:AE006524_219805 Streptococcus pyogenes M1 GAS, section 53 of ...   166   6e-40   
sp|P82479|ENO_STRPY|ENO_STRPY Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   166   6e-40   
sp|P57492|ENO_BUCAI|ENO_BUCAI Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   166   6e-40   
gb:AF159529_1246066 Trypanosoma brucei enolase gene, partial cds.     165   8e-40   
gb:LSA567484_142134 Lactobacillus sakei gap operon (cggR, gap, p...   165   1e-39   
pir|S67305|S67305 phosphopyruvate hydratase (EC 4.2.1.11) ERR1 -...   165   1e-39   
sp|Q8D2K1|ENO_WIGBR|ENO_WIGBR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   165   1e-39   
gb:BX842642_822278 Mycoplasma mycoides subsp. mycoides SC genomi...   164   1e-39   
gb:AE017180_400581 Geobacter sulfurreducens PCA, complete genome.     164   1e-39   
gb:AE017283_430330 Propionibacterium acnes KPA171202, complete g...   164   2e-39   
sp|O66778|ENO_AQUAE|ENO_AQUAE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   164   2e-39   
gb:SSO536594_190700 Streptococcus sobrinus eno1 gene for enolase.     164   2e-39   
gb:AF348924_1790158 Prionitis lanceolata enolase 2 (eno) gene, p...   163   3e-39   
gb:AF465774_1273458 Giardia intestinalis enolase (enol) gene, co...   163   3e-39   
gb:AE017263_421022 Mesoplasma florum L1 complete genome.              163   3e-39   
sp|Q8DPS0|ENO_STRR6|ENO_STRR6 Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   163   3e-39   
sp|Q97QS2|ENO_STRPN|ENO_STRPN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   163   3e-39   
sp|Q8E6G0|ENO_STRA3|ENO_STRA3 Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   163   3e-39   
gb:AB025329_2461094 Lampetra reissneri mRNA for enolase-1, parti...   163   4e-39   
gb:AP006878_577258 Thermococcus kodakaraensis strain KOD1 DNA, c...   163   4e-39   
gb:SPN303085_188868 Streptococcus pneumoniae eno gene for alpha-...   163   4e-39   
gb:AF348918_1790153 Pycnococcus provasolii enolase 2 (eno) gene,...   162   5e-39   
sp|Q8DTS9|ENO_STRMU|ENO_STRMU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   5e-39   
gb:AF442556_511544 Streptococcus thermophilus 2-phosphoglycerate...   162   7e-39   
gb:AF439649_511050 Streptococcus agalactiae enolase gene, comple...   162   7e-39   
sp|P77972|ENO_SYNY3|ENO_SYNY3 Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   7e-39   
sp|Q8RI55|ENO_FUSNN|ENO_FUSNN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   7e-39   
sp|Q9RR60|ENO_DEIRA|ENO_DEIRA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   7e-39   
sp|Q9XDS7|ENO_STRIT|ENO_STRIT Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   9e-39   
sp|O85348|ENO_NITEU|ENO_NITEU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   162   9e-39   
gb:AF375286_1266620 Pityokeines minutus enolase (Eno2i) gene, pa...   161   1e-38   
gb:BX571965_792061 Burkholderia pseudomallei strain K96243, chro...   161   1e-38   
gb:AE013598_296664 Xanthomonas oryzae pv. oryzae KACC10331, comp...   161   1e-38   
sp|Q8P9Z3|ENO_XANCP|ENO_XANCP Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   161   1e-38   
gb:AF258663_1256771 Eumesocampa frigilis isolate Efr23_344 enola...   161   2e-38   
gb:AY458642_619686 Uncultured bacterium 560 clone EBAC750-16D01 ...   161   2e-38   
sp|Q8PLS0|ENO_XANAC|ENO_XANAC Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   161   2e-38   
sp|O32513|ENO_DESVM|ENO_DESVM Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   161   2e-38   
gb:CP000023_874589 Streptococcus thermophilus LMG 18311, complet...   160   2e-38   
gb:AE015937_319581 Clostridium tetani E88, section 2 of 10 of th...   160   2e-38   
gb:SPBPB21E7_1720691 S.pombe chromosome II BAC pB21E7.                160   3e-38   
gb:AF348927_1264480 Paramecium tetraurelia enolase (eno) gene, p...   160   3e-38   
gb:AY458650_620269 Uncultured bacterium 583 clone EBAC750-10A10 ...   160   3e-38   
gb:AE017310_438578 Desulfovibrio vulgaris subsp. vulgaris str. H...   160   3e-38   
sp|Q8NKC2|EN12_SCHPO|EN12_SCHPO Enolase 1-2 (EC 4.2.1.11) (2-phosphoglycera...   160   3e-38   
gb:AE017178_397961 Porphyromonas gingivalis W83 section 7 of 8 o...   159   5e-38   
sp|Q87DY6|ENO_XYLFT|ENO_XYLFT Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   159   5e-38   
gb:AP006627_565335 Bacillus clausii KSM-K16 DNA, complete genome.     159   6e-38   
gb:AB025330_2461095 Lampetra reissneri mRNA for enolase-2, parti...   159   8e-38   
gb:AY871864_2150028 Synthetic construct hypothetical protein (FT...   159   8e-38   
gb:AJ749949_531166 Francisella tularensis subsp. tularensis comp...   159   8e-38   
gb:AY181039_595349 Methylobacterium extorquens enolase (eno) gen...   158   1e-37   
sp|Q97L52|ENO_CLOAB|ENO_CLOAB Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   158   1e-37   
sp|P59566|ENO_BUCBP|ENO_BUCBP Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   158   1e-37   
gb:AF348925_1790159 Prionitis lanceolata enolase 3 (eno) gene, p...   158   1e-37   
gb:AY034826_1559671 Curvularia lunata enolase mRNA, complete cds.     158   1e-37   
sp|Q8TUV6|ENO_METKA|ENO_METKA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   158   1e-37   
sp|Q8UFH1|ENO_AGRT5|ENO_AGRT5 Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   158   1e-37   
gb:AB025326_2461091 Eptatretus burgeri mRNA for enolase, partial...   157   2e-37   
gb:BX842648_823775 Bdellovibrio bacteriovorus complete genome, s...   157   2e-37   
gb:AE017306_437244 Thermus thermophilus HB27 section 6 of 7 of t...   157   2e-37   
gb:CP000027_79596 Dehalococcoides ethenogenes 195, complete genome.   157   2e-37   
gb:AE016852_349307 Tropheryma whipplei str. Twist, section 3 of ...   157   2e-37   
gb:BX248584_763780 Blochmannia floridanus complete genome; segme...   157   3e-37   
gb:AE016945_363938 Bacteroides thetaiotaomicron VPI-5482, sectio...   157   3e-37   
pir|F82700|F82700 enolase XF1291 [imported] - Xylella fastidiosa...   157   3e-37   
sp|Q9PDT8|ENO_XYLFA|ENO_XYLFA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   157   3e-37   
sp|Q8CPY3|ENO_STAEP|ENO_STAEP Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   157   3e-37   
sp|Q8KNX9|ENO_BACFR|ENO_BACFR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   157   3e-37   
sp|Q9F2Q3|ENO1_STRCO|ENO1_STRCO Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   157   3e-37   
gb:AE017345_1756605 Cryptococcus neoformans var. neoformans JEC2...   156   5e-37   
sp|Q9A7J9|ENO_CAUCR|ENO_CAUCR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   156   5e-37   
gb:AE015780_317776 Shewanella oneidensis MR-1 section 329 of 457...   155   7e-37   
gb:CR767821_116844 Ehrlichia ruminantium strain Welgevonden, com...   155   7e-37   
gb:AE017321_441754 Wolbachia endosymbiont strain TRS of Brugia m...   155   9e-37   
gb:AE008692_241346 Zymomonas mobilis subsp. mobilis ZM4, complet...   155   9e-37   
pir|T33721|T33721 phosphopyruvate hydratase (EC 4.2.1.11) eno - ...   155   9e-37   
sp|P33675|ENO_ZYMMO|ENO_ZYMMO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   9e-37   
sp|O69174|ENO_STAAU|ENO_STAAU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   9e-37   
sp|Q99VK5|ENO_STAAM|ENO_STAAM Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   9e-37   
pir|A64329|A64329 phosphopyruvate hydratase (EC 4.2.1.11) - Meth...   155   1e-36   
sp|Q60173|ENO_METJA|ENO_METJA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   1e-36   
sp|Q8G0G3|ENO_BRUSU|ENO_BRUSU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   1e-36   
sp|Q8YHF0|ENO_BRUME|ENO_BRUME Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   155   1e-36   
gb:AF348938_1790166 Nephroselmis olivacea enolase (eno) gene, pa...   154   1e-36   
gb:BA000030_701420 Streptomyces avermitilis MA-4680 genomic DNA,...   154   1e-36   
gb:CR925677_117756 Ehrlichia ruminantium str. Gardel, complete g...   154   3e-36   
sp|Q8K9E0|ENO_BUCAP|ENO_BUCAP Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   154   3e-36   
gb:BX251412_764979 Tropheryma whipplei TW08/27, complete genome;...   153   3e-36   
sp|Q92Q98|ENO_RHIME|ENO_RHIME Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   153   3e-36   
gb:AE017257_418264 Wolbachia endosymbiont of Drosophila melanoga...   153   4e-36   
gb:BX842681_1644251 Neurospora crassa DNA linkage group I BAC cl...   152   6e-36   
gb:BX957220_843649 Methanococcus maripaludis S2 complete genome;...   152   6e-36   
sp|P74934|ENO_TREPA|ENO_TREPA Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   152   6e-36   
sp|P31683|ENO_CHLRE|ENO_CHLRE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   152   6e-36   
sp|Q8YRB0|ENO_ANASP|ENO_ANASP Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   152   6e-36   
gb:AF375332_1266653 Aphanarthrum sp. SCR03 enolase (Eno1ni) gene...   152   1e-35   
gb:CP000009_864256 Gluconobacter oxydans 621H, complete genome.       152   1e-35   
gb:BX908798_829699 Parachlamydia-related symbiont UWE25, complet...   152   1e-35   
gb:AY540635_1334275 Plasmodium yoelii nigeriensis enolase mRNA, ...   151   1e-35   
gb:AE016822_340707 Leifsonia xyli subsp. xyli str. CTCB07, compl...   151   1e-35   
gb:AF375282_1266616 Hypocryphalus mangiferae enolase (Eno2i) gen...   151   2e-35   
gb:CR628337_115219 Legionella pneumophila str. Lens complete gen...   150   2e-35   
gb:AY430418_1605981 Isochrysis galbana enolase gene, partial cds.     150   4e-35   
gb:AF348930_1264483 Tetrahymena bergeri enolase (eno) gene, part...   150   4e-35   
gb:AF348933_1790162 Guillardia theta enolase (eno) gene, partial...   149   5e-35   
gb:AE016969_369774 Mycoplasma gallisepticum strain R section 3 o...   149   5e-35   
gb:AE017282_429223 Methylococcus capsulatus str. Bath, complete ...   149   6e-35   
gb:CR522870_100644 Desulfotalea psychrophila LSv54 chromosome.        149   6e-35   
pir|G86940|G86940 probable enolase [imported] - Mycobacterium le...   149   6e-35   
sp|Q8EW32|ENO_MYCPE|ENO_MYCPE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   149   6e-35   
gb:AY130387_2514058 Danio rerio enolase 3 mRNA, partial cds.          149   8e-35   
gb:AE017249_415997 Treponema denticola ATCC 35405, section 4 of ...   149   8e-35   
gb:BA000045_742196 Gloeobacter violaceus PCC 7421 DNA, complete ...   148   1e-34   
gb:AJ849471_533787 Lactobacillus crispatus eno1 gene for alpha-e...   148   1e-34   
gb:AE016965_368860 Coxiella burnetii strain RSA 493, section 6 o...   148   1e-34   
gb:AF516689_1807552 Musa acuminata clone F175 enolase mRNA, part...   148   1e-34   
gb:AF348929_1264482 Tetrahymena thermophila enolase (eno) gene, ...   148   1e-34   
gb:AY174100_594840 Moraxella catarrhalis strain O35E KDO biosynt...   148   1e-34   
gb:AP006628_566719 Onion yellows phytoplasma OY-M DNA, complete ...   148   1e-34   
gb:AB005550_809 Desulfovibrio vulgaris gene for ferredoxin II, p...   148   1e-34   
gb:CR628336_112136 Legionella pneumophila str. Paris complete ge...   147   2e-34   
sp|Q98MZ3|ENO_RHILO|ENO_RHILO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   147   2e-34   
gb:AE017354_460392 Legionella pneumophila subsp. pneumophila str...   147   2e-34   
sp|Q98Q50|ENO_MYCPU|ENO_MYCPU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   147   2e-34   
gb:AY895164_1354969 Trichomonas vaginalis enolase (Eno) mRNA, co...   146   4e-34   
sp|P75189|ENO_MYCPN|ENO_MYCPN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   146   4e-34   
sp|Q9CD42|ENO_MYCLE|ENO_MYCLE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   146   4e-34   
gb:BX572101_799424 Prochlorococcus marinus MIT9313 complete geno...   146   5e-34   
gb:CP000030_83537 Anaplasma marginale str. St. Maries, complete ...   146   5e-34   
sp|Q88VW2|ENOB_LACPL|ENOB_LACPL Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   146   5e-34   
gb:BX248356_762201 Corynebacterium diphtheriae gravis NCTC13129,...   145   7e-34   
gb:CP000033_89163 Lactobacillus acidophilus NCFM, complete genome.    145   9e-34   
sp|Q9F3P9|ENO2_STRCO|ENO2_STRCO Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   145   9e-34   
gb:BX897700_828727 Bartonella quintana str. Toulouse, complete g...   145   1e-33   
gb:BX569695_777250 Synechococcus sp. WH8102 complete genome; seg...   144   2e-33   
gb:AF000366_466987 Borrelia burgdorferi oligopeptide permease ho...   144   2e-33   
gb:AE017332_445390 Mycoplasma hyopneumoniae 232, complete genome.     144   2e-33   
sp|O51312|ENO_BORBU|ENO_BORBU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   144   2e-33   
gb:AF348928_1264481 Colpidium aqueous enolase (eno) gene, partia...   144   2e-33   
gb:BX572090_795834 Prochlorococcus marinus MED4 complete genome;...   144   2e-33   
sp|Q8DL40|ENO_SYNEL|ENO_SYNEL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   144   2e-33   
sp|Q9CIT0|ENOB_LACLA|ENOB_LACLA Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   144   2e-33   
sp|Q8KB35|ENO1_CHLTE|ENO1_CHLTE Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate...   144   3e-33   
gb:AF348915_1790150 Nitella opaca enolase (eno) gene, partial cds.    143   3e-33   
gb:CP000013_869571 Borrelia garinii PBi, complete genome.             143   3e-33   
gb:AP008231_580581 Synechococcus elongatus PCC 6301 DNA, complet...   143   3e-33   
sp|O52191|ENO_STRTR|ENO_STRTR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   143   3e-33   
sp|Q9PJF3|ENO_CHLMU|ENO_CHLMU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   143   3e-33   
sp|Q8FQS7|ENO_COREF|ENO_COREF Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   143   4e-33   
gb:AX064945_1459386 Sequence 71 from Patent WO0100844.>gb:AX7631...   142   6e-33   
gb:AE017230_411695 Mycobacterium avium subsp. paratuberculosis s...   142   6e-33   
sp|Q8NRS1|ENO_CORGL|ENO_CORGL Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   142   6e-33   
sp|P47647|ENO_MYCGE|ENO_MYCGE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   142   8e-33   
gb:AF348931_1790160 Rhodomonas salina enolase 1 (eno) gene, part...   142   1e-32   
sp|Q87WD5|ENO2_PSESM|ENO2_PSESM Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate...   142   1e-32   
sp|P96377|ENO_MYCTU|ENO_MYCTU Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   141   1e-32   
gb:AE017161_394693 Prochlorococcus marinus subsp. marinus str. C...   141   2e-32   
sp|Q8G5I9|ENO_BIFLO|ENO_BIFLO Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   140   2e-32   
gb:AE017282_428663 Methylococcus capsulatus str. Bath, complete ...   140   3e-32   
gb:BX248337_758406 Mycobacterium bovis subsp. bovis AF2122/97 co...   140   4e-32   
sp|Q8L202|ENO_BARHE|ENO_BARHE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   140   4e-32   
gb:AE017308_437802 Mycoplasma mobile 163K complete genome.            139   6e-32   
gb:AE017204_404571 Lactobacillus johnsonii NCC 533, section 5 of...   139   6e-32   
gb:AB107787_1199881 Trichonympha agilis eno mRNA for enolase, co...   139   8e-32   
gb:BX571661_778801 Wolinella succinogenes, complete genome; segm...   139   8e-32   
gb:AE017203_404456 Lactobacillus johnsonii NCC 533, section 4 of...   139   8e-32   
sp|O84591|ENO_CHLTR|ENO_CHLTR Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   139   8e-32   
gb:S79816_1704583 enolase [Echinochloa phyllopogon, shoots, mRNA...   138   1e-31   
gb:AP006618_561260 Nocardia farcinica IFM 10152 DNA, complete ge...   138   1e-31   
gb:CP000025_879567 Campylobacter jejuni RM1221, complete genome.      137   2e-31   
sp|P42448|ENO_CAMJE|ENO_CAMJE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   137   2e-31   
gb:AF348914_1790149 Chara corallina enolase (eno) gene, partial ...   137   2e-31   
gb:AF348916_1790151 Nitellopsis obtusa enolase (eno) gene, parti...   136   4e-31   
gb:HSM805054_1187296 Homo sapiens mRNA; cDNA DKFZp666C036 (from ...   136   5e-31   
gb:DUKAETC12_2571425 Peking duck alpha-enolase/tau-crystallin ge...   135   9e-31   
gb:AF348919_1264478 Chlorarachnion CCMP621 enolase (eno) mRNA, p...   135   9e-31   
gb:AF159531_1246068 Trypanosoma cruzi enolase 2 gene, partial cds.    135   9e-31   
gb:AF159530_1246067 Trypanosoma cruzi enolase 1 gene, partial cd...   135   9e-31   
gb:AE017145_390384 Helicobacter hepaticus ATCC 51449 section 2 o...   134   2e-30   
gb:HPU13756_137594 Helicobacter pylori RecA (recA) gene, complet...   134   2e-30   
sp|Q9ZMS6|ENO_HELPJ|ENO_HELPJ Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   134   2e-30   
sp|Q821H7|ENO_CHLCV|ENO_CHLCV Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   134   2e-30   
gb:AF348917_1790152 Pycnococcus provasolii enolase 1 (eno) gene,...   134   3e-30   
gb:MUSENOB_2125739 Mouse muscle-specific enolase beta mRNA, 3' end.   133   4e-30   
sp|O30885|ENO_CAMFE|ENO_CAMFE Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   133   4e-30   
sp|P48285|ENO_HELPY|ENO_HELPY Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   132   8e-30   
sp|Q9Z7A6|ENO_CHLPN|ENO_CHLPN Enolase (EC 4.2.1.11) (2-phosphoglycerate de...   132   1e-29   
gb:AF348926_1264479 Paramecium multimicronucleatum enolase (eno)...   131   1e-29   


>pir|G84697|G84697 hypothetical protein At2g29560 [imported] -
           Arabidopsis thaliana>gb:AC004561_1531869 Arabidopsis
           thaliana chromosome 2 clone F16P2 map ve014, complete
           sequence.>gb:AY035128_1559898 Arabidopsis thaliana
           putative enolase 2-phospho-D-glycerate hydroylase
           (At2g29560) mRNA, complete cds.>gb:AY113918_1578329
           Arabidopsis thaliana putative enolase
           2-phospho-D-glycerate hydroylase (At2g29560) mRNA,
           complete cds.
          Length = 475

 Score =  356 bits (914), Expect = 3e-97
 Identities = 179/214 (83%), Positives = 198/214 (92%)
 Frame = +2

Query: 185 MSVQEYLDKHMLSRKLEDAVNAAVRAKTSDPVLFISNHMRKSVPSVITKLKARQILDSRG 364
           MSVQEYLDKHMLSRK+EDAVNAAVRAKTSDPVLFI+NH++K+V SVITK+KARQILDSRG
Sbjct: 1   MSVQEYLDKHMLSRKIEDAVNAAVRAKTSDPVLFIANHLKKAVSSVITKVKARQILDSRG 60

Query: 365 IPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEA 544
           IPTVEVDL+TNKG+FRAS PSG S G YEAIELRD DKG YLGN V++AVKNINEKISEA
Sbjct: 61  IPTVEVDLHTNKGVFRASVPSGDSSGTYEAIELRDGDKGMYLGNSVAKAVKNINEKISEA 120

Query: 545 LIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLS 724
           LIGMDP LQ QIDQAMIDLDKTEKK ELGANAILAVS+AACKAGAAEKEVPL KH++DLS
Sbjct: 121 LIGMDPKLQGQIDQAMIDLDKTEKKSELGANAILAVSIAACKAGAAEKEVPLCKHLSDLS 180

Query: 725 GKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           G+ N++LPVPAFT++SGGKHA N  A+QEIMILP
Sbjct: 181 GRANMVLPVPAFTVLSGGKHASNTFAIQEIMILP 214



>gb:AC135208_1742054 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1364E02, complete sequence.
          Length = 485

 Score =  274 bits (700), Expect = 2e-72
 Identities = 139/214 (64%), Positives = 172/214 (80%)
 Frame = +2

Query: 185 MSVQEYLDKHMLSRKLEDAVNAAVRAKTSDPVLFISNHMRKSVPSVITKLKARQILDSRG 364
           MSVQEYL+KH+LSRK+E+AVNAAVRAK  DPVLFISNHMR++ P+VIT ++ARQILD RG
Sbjct: 1   MSVQEYLEKHLLSRKIEEAVNAAVRAKAPDPVLFISNHMRRAAPAVITSVRARQILDGRG 60

Query: 365 IPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEA 544
            P VEV L+TNK + RASA +  +     A  +RDA+K   L   V+ AV+ IN+K+SEA
Sbjct: 61  EPAVEVSLHTNKAVHRASAAAADAPEGAAADAVRDAEKRKLLARAVADAVRVINDKVSEA 120

Query: 545 LIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLS 724
           L+GMDP  QSQIDQA++DLDK   K E+G N++LAVS+AACKAGAAEKEVPLYKHIA+L 
Sbjct: 121 LVGMDPQQQSQIDQAIMDLDKAHHKAEIGVNSMLAVSIAACKAGAAEKEVPLYKHIAELV 180

Query: 725 GKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           GK+   LP+PA T+I+GG HAGN+L +QEIMILP
Sbjct: 181 GKSATTLPIPAITVINGGTHAGNSLPIQEIMILP 214



>gb:AY245549_1592553 Dunaliella salina enolase mRNA, complete cds.
          Length = 479

 Score =  267 bits (683), Expect = 2e-70
 Identities = 132/213 (61%), Positives = 166/213 (77%)
 Frame = +2

Query: 188 SVQEYLDKHMLSRKLEDAVNAAVRAKTSDPVLFISNHMRKSVPSVITKLKARQILDSRGI 367
           +VQEY+DKH L +K ED +N AV++K  +P+ F++  + +  PS I K+  RQI+DSRG 
Sbjct: 3   TVQEYIDKHQLQKKTEDVLNIAVKSKPDEPLSFLAKELLRMAPSEILKVVGRQIIDSRGN 62

Query: 368 PTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEAL 547
           PTVE D++T+KGMFRA+ PSGAS G++EA+ELRD DK  +LG GV +AV++IN  IS AL
Sbjct: 63  PTVEADVHTHKGMFRAAVPSGASTGIHEAVELRDGDKTKFLGKGVQKAVESINTIISPAL 122

Query: 548 IGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            GMDP  QS++DQ MIDLD T  K +LGANAILAVS+A  KAGAAEKEVPLY+HIADL+G
Sbjct: 123 KGMDPKNQSEVDQKMIDLDGTPNKAKLGANAILAVSLATAKAGAAEKEVPLYRHIADLAG 182

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              L LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 183 NPKLYLPVPAFNIINGGSHAGNALAMQEFMILP 215



>gb:BC059434_2552411 Danio rerio zgc:73056, mRNA (cDNA clone
           MGC:73056 IMAGE:4144135), complete cds.
          Length = 433

 Score =  221 bits (564), Expect = 1e-56
 Identities = 111/170 (65%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT +G+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTERGLFRAAVPSGASTGIYEALELRDNDKSRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+N+N+ I+ ALIG    +  Q +IDQ M++LD TE K   GANAIL VS+AACKAG
Sbjct: 63  SKAVENVNQHIAPALIGQGIPVVEQEKIDQFMLELDGTENKSRFGANAILGVSLAACKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AJ720730_2502917 Gallus gallus partial mRNA for hypothetical
           protein, clone 24e12.
          Length = 221

 Score =  218 bits (554), Expect = 1e-55
 Identities = 108/170 (63%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ ALI  +  +  Q +ID+ M+++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHVNKTIAPALISKNVNVVEQEKIDKLMLEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|JC4186|JC4186 phosphopyruvate hydratase (EC 4.2.1.11) alpha
           chain - chicken>gb:D37900_2570520 Chicken mRNA for
           enolase alpha, complete cds.
          Length = 434

 Score =  218 bits (554), Expect = 1e-55
 Identities = 108/170 (63%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ ALI  +  +  Q +ID+ M+++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHVNKTIAPALISKNVNVVEQEKIDKLMLEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P51913|ENOA_CHICK Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  218 bits (554), Expect = 1e-55
 Identities = 108/170 (63%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   ILKIHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ ALI  +  +  Q +ID+ M+++D TE K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHVNKTIAPALISKNVNVVEQEKIDKLMLEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AF072587_2471656 Sceloporus undulatus alpha enolase mRNA,
           complete cds.
          Length = 434

 Score =  216 bits (550), Expect = 4e-55
 Identities = 107/170 (62%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I KL AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 3   ILKLHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ AL+     +  Q +ID+ M+++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHVNKTIAPALVNKKVNVVEQEKIDKLMLEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNEDVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|O57391|ENOG_CHICK Gamma enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Neural enolase)
           (NSE).>gb:AB004291_2460343 Gallus gallus mRNA for
           gamma-subunit of enolase, complete cds.
          Length = 434

 Score =  216 bits (550), Expect = 4e-55
 Identities = 105/170 (61%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           + ++ AR+ILDSRG PTVEVDLYT+KGMFRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 3   VERIHAREILDSRGNPTVEVDLYTHKGMFRAAVPSGASTGIYEALELRDNDKSRFLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  ++ A++G   ++  Q +ID  M+++D TE K + GANAIL VS+A CKAG
Sbjct: 63  LQAVDHINSTVAPAIVGSGLSVVDQEKIDNLMLEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK+VPLY+HIADL+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKDVPLYRHIADLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q9W7L2|ENOA_SCEUN Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  216 bits (550), Expect = 4e-55
 Identities = 107/170 (62%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I KL AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 2   ILKLHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ AL+     +  Q +ID+ M+++D TE K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHVNKTIAPALVNKKVNVVEQEKIDKLMLEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKGVPLYRHIADLAGNEDVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:HSM805698_2018000 Homo sapiens mRNA; cDNA DKFZp686B0286 (from
           clone DKFZp686B0286); complete cds.
          Length = 434

 Score =  216 bits (549), Expect = 5e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKARYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|S06756|S06756 phosphopyruvate hydratase (EC 4.2.1.11) beta -
           human>gb:HSENO3BE_2012997 Human ENO3 mRNA for
           beta-enolase (EC 4.2.1.11).
          Length = 434

 Score =  216 bits (549), Expect = 5e-55
 Identities = 109/168 (64%), Positives = 134/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DKG YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV+NIN  +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGNNLA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNNLAMQEFMILP 172



>gb:BC071359_2556101 Danio rerio zgc:73152, mRNA (cDNA clone
           MGC:86675 IMAGE:6894943), complete cds.
          Length = 432

 Score =  215 bits (548), Expect = 7e-55
 Identities = 106/170 (62%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+  L+  + ++  Q +ID+ M+D+D T+ K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPGLVSQNVSVLEQEKIDKLMLDMDGTDNKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPDVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC059511_2552488 Danio rerio zgc:73152, mRNA (cDNA clone
           MGC:73152 IMAGE:4144055), complete cds.
          Length = 432

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+  L+  + ++  Q +ID+ M+D+D T+ K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPGLVSQNVSVLEQEKIDKLMLDMDGTDNKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC045082_2549034 Xenopus laevis enolase 3, beta muscle, mRNA
           (cDNA clone MGC:53843 IMAGE:5542701), complete cds.
          Length = 434

 Score =  215 bits (547), Expect = 9e-55
 Identities = 109/170 (64%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   ILKIHAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKSRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV++IN+ I  AL+    ++  Q +ID+ M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVEHINKTIVPALLEKKLSVVEQEKIDKVMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G + L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNSELVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BT007464_2150396 Synthetic construct Homo sapiens enolase 1,
           (alpha) mRNA, partial cds.
          Length = 435

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:HS2PPHAE_1997962 H.sapiens mRNA for
           2-phosphopyruvate-hydratase-alpha-enolase.
          Length = 434

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:CR860345_1184424 Pongo pygmaeus mRNA; cDNA DKFZp459M1013 (from
           clone DKFZp459M1013).
          Length = 434

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|S11696|A29170 phosphopyruvate hydratase (EC 4.2.1.11) alpha -
           human>gb:AL139415_1920748 Human DNA sequence from clone
           RP3-477M7 on chromosome 1 Contains the ENO1 gene for
           enolase 1 (alpha), two novel genes, a novel pseudogene,
           a pseudogene similar to part of a Zinc finger protein, a
           pseudogene similar to part of cytochrome oxidase subunit
           II, the CA6 gene for carbonic anhydrase VI and a CpG
           island, complete sequence.>gb:BC001810_1967875 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:2414
           IMAGE:2906988), complete cds.>gb:BC004458_1969294 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:4315
           IMAGE:2820106), complete cds.>gb:BC009912_1972341 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:2689
           IMAGE:2820106), complete cds.>gb:BC011130_1972917 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:17252
           IMAGE:3447583), complete cds.>gb:BC015641_1975224 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:23319
           IMAGE:4643088), complete cds.>gb:BC022545_1977948 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:26814
           IMAGE:4799584), complete cds.>gb:BC027725_1978954 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:23185
           IMAGE:4843306), complete cds.>gb:BC050642_1984452 Homo
           sapiens enolase 1, (alpha), mRNA (cDNA clone MGC:60133
           IMAGE:6063437), complete cds.>gb:BT007163_1990601 Homo
           sapiens enolase 1, (alpha) mRNA, complete
           cds.>gb:HSENOAL2_2012998 H.sapiens alpha-enolase gene
           for non-neuronal enolase (EC 4.2.1.11) exon
           2.>gb:HUMENOA_2030890 Human alpha enolase mRNA, complete
           cds.
          Length = 434

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P06733|ENOA_HUMAN Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Non- neural
           enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase).
          Length = 433

 Score =  215 bits (547), Expect = 9e-55
 Identities = 106/170 (62%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 2   ILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 61

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++ T Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AVEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AF072589_2471658 Python regius alpha enolase mRNA, complete cds.
          Length = 434

 Score =  214 bits (546), Expect = 1e-54
 Identities = 103/170 (60%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K++AR+I DSRG PT+EVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 3   ILKIQAREIFDSRGNPTIEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ AL+  + ++  Q +ID+ MI++D +E K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHVNKTIAPALVNKNVSVVEQEKIDKLMIEMDGSENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK++PLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKDIPLYRHIADLAGNKEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BT009876_2151264 Synthetic construct Homo sapiens enolase 2,
           (gamma, neuronal) mRNA, partial cds.
          Length = 435

 Score =  214 bits (546), Expect = 1e-54
 Identities = 108/170 (63%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+E+PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:HSEN1_2012966 Human mRNA fragment for neurone-specific
           enolase.>gb:HSNSEMRNA_2019225 Human mRNA for neurone
           specific gamma enolase (NSE), EC number=4.2.1.11.
          Length = 433

 Score =  214 bits (546), Expect = 1e-54
 Identities = 108/170 (63%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   IQKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 62  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+E+PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:CR859195_1183327 Pongo pygmaeus mRNA; cDNA DKFZp459B1817 (from
           clone DKFZp459B1817).
          Length = 338

 Score =  214 bits (546), Expect = 1e-54
 Identities = 108/170 (63%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+E+PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|A32132|A32132 phosphopyruvate hydratase (EC 4.2.1.11) alpha -
           duck>gb:APTCAE_2507323 Peking Duck mRNA for
           tau-crystallin/alpha enolase.>gb:DUKCRYT_2571429 Peking
           duck tau-crystallin/alpha-enolase mRNA, complete cds.
          Length = 434

 Score =  214 bits (546), Expect = 1e-54
 Identities = 107/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ ALI  +  +  Q +ID+ M+D+D +E K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALISKNVNVVEQDKIDKLMLDMDGSENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MI P
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMIPP 172



>pir|JU0060|NOHUG phosphopyruvate hydratase (EC 4.2.1.11) gamma -
           human>gb:BC002745_1968374 Homo sapiens enolase 2 (gamma,
           neuronal), mRNA (cDNA clone MGC:3520 IMAGE:3629603),
           complete cds.>gb:BT007383_1990821 Homo sapiens enolase
           2, (gamma, neuronal) mRNA, complete
           cds.>gb:CR536582_1993875 Homo sapiens full open reading
           frame cDNA clone RZPDo834F1122D for gene ENO2, enolase
           2, (gamma, neuronal); complete cds, incl.
           stopcodon.>gb:HSENO2_2012994 Human ENO2 gene for neuron
           specific (gamma) enolase.>gb:HSU47924_2024511 Human
           chromosome 12p13 sequence, complete
           sequence.>gb:HUMENOG_2030891 Human neuron-specific
           gamma-2 enolase, complete cds.
          Length = 434

 Score =  214 bits (546), Expect = 1e-54
 Identities = 108/170 (63%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+E+PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P09104|ENOG_HUMAN Gamma enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Neural enolase)
           (NSE) (Enolase 2).
          Length = 433

 Score =  214 bits (546), Expect = 1e-54
 Identities = 108/170 (63%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 62  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+E+PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>sp|Q9W7L0|ENOA_PYTRG Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  214 bits (546), Expect = 1e-54
 Identities = 103/170 (60%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K++AR+I DSRG PT+EVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 2   ILKIQAREIFDSRGNPTIEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ AL+  + ++  Q +ID+ MI++D +E K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHVNKTIAPALVNKNVSVVEQEKIDKLMIEMDGSENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK++PLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKDIPLYRHIADLAGNKEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>sp|P19140|ENOA_ANAPL Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Tau- crystallin).
          Length = 433

 Score =  214 bits (546), Expect = 1e-54
 Identities = 107/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 2   ILKIHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ ALI  +  +  Q +ID+ M+D+D +E K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHINKTIAPALISKNVNVVEQDKIDKLMLDMDGSENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MI P
Sbjct: 122 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMIPP 171



>pir|S10247|S10247 phosphopyruvate hydratase (EC 4.2.1.11) gamma -
           mouse>gb:AK003051_1151614 Mus musculus adult male brain
           cDNA, RIKEN full-length enriched library,
           clone:0710008M22 product:enolase 2, gamma neuronal, full
           insert sequence.>gb:AC002397_2049808 Mouse chromosome 6
           BAC-284H12 (Research Genetics mouse BAC library)
           complete sequence.>gb:BC031739_2097201 Mus musculus
           enolase 2, gamma neuronal, mRNA (cDNA clone MGC:25270
           IMAGE:4527274), complete cds.>gb:MSGAEN_2124733 Mouse
           mRNA for gamma-enolase (2-phospho-D-glycerate hydrolase)
           (EC 4.2.1.11).
          Length = 434

 Score =  214 bits (545), Expect = 2e-54
 Identities = 107/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN +I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSRIAPALISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+++PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAERDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P17183|ENOG_MOUSE Gamma enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Neural enolase)
           (NSE) (Enolase 2).
          Length = 433

 Score =  214 bits (545), Expect = 2e-54
 Identities = 107/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   IEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN +I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 62  LKAVDHINSRIAPALISSGISVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE+++PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAERDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:BC054169_2550824 Xenopus laevis enolase 1, alpha, mRNA (cDNA
           clone MGC:64288 IMAGE:6874241), complete cds.
          Length = 434

 Score =  214 bits (544), Expect = 2e-54
 Identities = 106/170 (62%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  ++AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IKNIRAREIFDSRGNPTVEVDLYTCKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+G +  +  Q + D+ MI++D TE K + GANA+L VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVGKNLNVVEQEKFDKLMIEMDGTENKSKFGANALLGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AF266193_2483246 Gillichthys mirabilis alpha enolase mRNA,
           partial cds.
          Length = 194

 Score =  214 bits (544), Expect = 2e-54
 Identities = 105/170 (61%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+  + ++  Q ++D+ M+D+D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVNKNVSVLEQEKVDKLMLDMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+G  HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGSSHAGNKLAMQEFMILP 172



>gb:AF428105_2494042 Crocodylus palustris tissue-type eye lens
           tau-crystallin protein mRNA, complete
           cds.>gb:AF428106_2494043 Crocodylus palustris
           tissue-type brain alpha-enolase mRNA, complete
           cds.>gb:AF428107_2494044 Crocodylus palustris
           tissue-type heart alpha-enolase mRNA, complete
           cds.>gb:AF428108_2494045 Crocodylus palustris
           tissue-type GAM alpha-enolase mRNA, complete cds.
          Length = 434

 Score =  213 bits (543), Expect = 3e-54
 Identities = 104/170 (61%), Positives = 137/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           + K+ AR+I DSRG PTVEVDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   VLKVHAREIFDSRGNPTVEVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV+++N+ I+ ALI  +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHVNKTIAPALISKNINVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G + ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNSEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:HSMSER_2018908 H.sapiens mRNA for muscle specific enolase (MSE)
           (EC 4.2.1.11).
          Length = 434

 Score =  213 bits (543), Expect = 3e-54
 Identities = 108/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DKG YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV+NIN  +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVENINNTLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:HSENO3_2012995 H.sapiens ENO3 gene for muscle specific enolase.
          Length = 434

 Score =  213 bits (543), Expect = 3e-54
 Identities = 108/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DKG YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV+NIN  +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC017249_1975990 Homo sapiens enolase 3 (beta, muscle),
           transcript variant 2, mRNA (cDNA clone MGC:29581
           IMAGE:4902149), complete cds.
          Length = 434

 Score =  213 bits (543), Expect = 3e-54
 Identities = 108/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DKG YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV+NIN  +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVENINSTLGPALLQKKLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P13929|ENOB_HUMAN Beta enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle
           enolase) (MSE) (Enolase 3).
          Length = 433

 Score =  213 bits (543), Expect = 3e-54
 Identities = 108/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DKG YLG GV +
Sbjct: 4   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLK 63

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV+NIN  +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 64  AVENINNTLGPALLQKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 123

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 EKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AF149256_1415145 Bos taurus alpha enolase mRNA, complete cds.
          Length = 434

 Score =  213 bits (542), Expect = 4e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   ILKVHAREIFDSRGNPTVEVDLFTAKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TEKK + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKSNVVEQEKIDKLMIEMDGTEKKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNAEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q9XSJ4|ENOA_BOVIN Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Non- neural
           enolase) (NNE) (Enolase 1) (Phosphopyruvate hydratase).
          Length = 433

 Score =  213 bits (542), Expect = 4e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDL+T KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 2   ILKVHAREIFDSRGNPTVEVDLFTAKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TEKK + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHINKTIAPALVSKKSNVVEQEKIDKLMIEMDGTEKKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AVEKGVPLYRHIADLAGNAEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:BC090069_2111199 Rattus norvegicus enolase 1, alpha, mRNA (cDNA
           clone MGC:93770 IMAGE:7108936), complete cds.
          Length = 434

 Score =  213 bits (541), Expect = 5e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC081847_2108095 Rattus norvegicus cDNA clone IMAGE:7189453,
           partial cds.
          Length = 465

 Score =  213 bits (541), Expect = 5e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 34  ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 93

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 94  SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 153

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 154 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 203



>gb:BC078896_2107048 Rattus norvegicus enolase 1, alpha, mRNA (cDNA
           clone MGC:93625 IMAGE:7112523), complete cds.
          Length = 434

 Score =  213 bits (541), Expect = 5e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC063174_2105194 Rattus norvegicus enolase 1, alpha, mRNA (cDNA
           clone IMAGE:6922384), partial cds.
          Length = 472

 Score =  213 bits (541), Expect = 5e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 41  ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 100

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 101 SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 160

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 161 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 210



>pir|A24742|A24742 phosphopyruvate hydratase (EC 4.2.1.11) gamma -
           rat>gb:AF019973_2051026 Rattus norvegicus
           neuron-specific enolase (NSE) mRNA, complete
           cds.>gb:BC060310_2103988 Rattus norvegicus enolase 2,
           gamma, mRNA (cDNA clone MGC:72663 IMAGE:6888358),
           complete cds.>gb:RATENONS_2132140 Rat brain
           neuron-specific enolase mRNA, complete
           cds.>gb:RNEN2_2134801 R.norvegicus gene encoding
           neuron-specific enolase, exon 2 and joined CDS.
          Length = 434

 Score =  213 bits (541), Expect = 5e-54
 Identities = 107/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IQKIWAREILDSRGNPTVEVDLHTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK++PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P07323|ENOG_RAT Gamma enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Neural enolase)
           (NSE) (Enolase 2).
          Length = 433

 Score =  213 bits (541), Expect = 5e-54
 Identities = 107/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   IQKIWAREILDSRGNPTVEVDLHTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 62  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK++PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKDLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AY725787_1348715 Oncometopia nigricans enolase mRNA, complete
           cds.
          Length = 433

 Score =  212 bits (540), Expect = 6e-54
 Identities = 107/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVDL T  G+FRA+ PSGAS G+YEA+ELRD DKG+YLG GV
Sbjct: 3   IQKIHARQIFDSRGNPTVEVDLVTELGLFRAAVPSGASTGIYEALELRDGDKGSYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NIN  I+ AL+  G++ T Q +IDQ M+ LD TE K + GANAIL VS+A  KAG
Sbjct: 63  LKAVGNINNDIAPALLKAGLEVTQQKEIDQFMLKLDGTENKSKFGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K +PL+K+IA+L+G +N++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAKKGIPLFKYIAELAGNSNIVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P04764|ENOA_RAT Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Non- neural
           enolase) (NNE) (Enolase 1).
          Length = 433

 Score =  212 bits (540), Expect = 6e-54
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 2   ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 61

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 62  SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AVEKGVPLYRHIADLAGNPEVILPVPAFDVINGGSHAGNKLAMQEFMILP 171



>gb:AY650330_1958277 Macaca fascicularis enolase 2 mRNA, partial
           cds.
          Length = 420

 Score =  212 bits (539), Expect = 8e-54
 Identities = 106/165 (64%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +2

Query: 338 ARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVK 517
           AR+ILDSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV +AV 
Sbjct: 1   AREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVD 60

Query: 518 NINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKE 691
           +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAGAAE+E
Sbjct: 61  HINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE 120

Query: 692 VPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 165



>pir|JC1039|JC1039 phosphopyruvate hydratase (EC 4.2.1.11) - rat
          Length = 434

 Score =  212 bits (539), Expect = 8e-54
 Identities = 107/170 (62%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IQKIWAREILDSRGNPTVEVDLHTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN  I+ ALI  G+    Q ++D  M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK +PLY+HIA L+G ++L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKNLPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC041279_2547911 Xenopus laevis similar to enolase 1, alpha
           non-neuron, mRNA (cDNA clone MGC:53543 IMAGE:4681315),
           complete cds.
          Length = 434

 Score =  211 bits (538), Expect = 1e-53
 Identities = 107/170 (62%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IKNIHAREIFDSRGNPTVEVDLYTCKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            RAVK +NE +  AL    +D   Q +ID+ MI++D TE K + GANA+L VS+A CKAG
Sbjct: 63  GRAVKYVNEFLGPALCTQNLDVVEQEKIDKLMIEMDGTENKSKFGANALLGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:CET21B10_1367891 Caenorhabditis elegans cosmid T21B10, complete
           sequence.
          Length = 465

 Score =  211 bits (538), Expect = 1e-53
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ ARQI DSRG PTVEVDL+T KG+FRA+ PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 34  ITKIHARQIYDSRGNPTVEVDLFTEKGVFRAAVPSGASTGVHEALELRDGDKAVHLGKGV 93

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NINEKI+ ALI  G D T Q  ID  M+ LD +E KG LGANAIL VS+A  KAG
Sbjct: 94  LKAVSNINEKIAPALIAKGFDVTAQKDIDDFMMALDGSENKGNLGANAILGVSLAVAKAG 153

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K +PLYK+IA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 154 AVHKGLPLYKYIAELAGTGKVVLPVPAFNVINGGSHAGNKLAMQEFMILP 203



>pir|T25040|T25040 hypothetical protein T21B10.2 - Caenorhabditis
           elegans>gb:CET21B10_1367892 Caenorhabditis elegans
           cosmid T21B10, complete sequence.
          Length = 434

 Score =  211 bits (538), Expect = 1e-53
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ ARQI DSRG PTVEVDL+T KG+FRA+ PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   ITKIHARQIYDSRGNPTVEVDLFTEKGVFRAAVPSGASTGVHEALELRDGDKAVHLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NINEKI+ ALI  G D T Q  ID  M+ LD +E KG LGANAIL VS+A  KAG
Sbjct: 63  LKAVSNINEKIAPALIAKGFDVTAQKDIDDFMMALDGSENKGNLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K +PLYK+IA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVHKGLPLYKYIAELAGTGKVVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q27527|ENO_CAEEL Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 433

 Score =  211 bits (538), Expect = 1e-53
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ ARQI DSRG PTVEVDL+T KG+FRA+ PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 2   ITKIHARQIYDSRGNPTVEVDLFTEKGVFRAAVPSGASTGVHEALELRDGDKAVHLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NINEKI+ ALI  G D T Q  ID  M+ LD +E KG LGANAIL VS+A  KAG
Sbjct: 62  LKAVSNINEKIAPALIAKGFDVTAQKDIDDFMMALDGSENKGNLGANAILGVSLAVAKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K +PLYK+IA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AVHKGLPLYKYIAELAGTGKVVLPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AF072586_2471655 Alligator mississippiensis alpha enolase mRNA,
           complete cds.
          Length = 434

 Score =  211 bits (537), Expect = 1e-53
 Identities = 104/170 (61%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV ++N+ I+ ALI  + ++  Q +ID+ M+++D +E K + GANAIL VS+A CKAG
Sbjct: 63  SKAVAHVNKTIAPALISKNISVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q9PVK2|ENOA_ALLMI Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  211 bits (537), Expect = 1e-53
 Identities = 104/170 (61%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 2   ILKIHAREIFDSRGNPTVEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV ++N+ I+ ALI  + ++  Q +ID+ M+++D +E K + GANAIL VS+A CKAG
Sbjct: 62  SKAVAHVNKTIAPALISKNISVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>pir|S00463|NOXL phosphopyruvate hydratase (EC 4.2.1.11) ENO1 -
           African clawed frog>gb:XLENO1_2582776 Xenopus laevis
           mRNA for enolase.
          Length = 434

 Score =  211 bits (536), Expect = 2e-53
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  ++AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 3   IKNIRAREIFDSRGNPTVEVDLYTCKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            RAVK +NE +  AL    ++   Q +ID+ MI++D TE K + GANA+L VS+A CKAG
Sbjct: 63  GRAVKYVNEFLGPALCTQNLNVVEQEKIDKLMIEMDGTENKSKFGANALLGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P08734|ENO_XENLA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 433

 Score =  211 bits (536), Expect = 2e-53
 Identities = 106/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  ++AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV
Sbjct: 2   IKNIRAREIFDSRGNPTVEVDLYTCKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            RAVK +NE +  AL    ++   Q +ID+ MI++D TE K + GANA+L VS+A CKAG
Sbjct: 62  GRAVKYVNEFLGPALCTQNLNVVEQEKIDKLMIEMDGTENKSKFGANALLGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:BC061287_2553064 Xenopus tropicalis Enolase (2-phosphoglycerate
           dehydratase), mRNA (cDNA clone MGC:75746 IMAGE:5381403),
           complete cds.
          Length = 434

 Score =  210 bits (535), Expect = 2e-53
 Identities = 107/170 (62%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV
Sbjct: 3   IKKILAREIFDSRGNPTVEVDLYTCKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            RAVK INE +  AL   + ++  Q +ID  MI++D TE K + GANA+L VS+A CKAG
Sbjct: 63  GRAVKYINEFLGPALCTQNLSVVEQEKIDNLMIEMDGTENKSKFGANALLGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AF072588_2471657 Trachemys scripta elegans alpha enolase mRNA,
           complete cds.
          Length = 434

 Score =  210 bits (535), Expect = 2e-53
 Identities = 105/170 (61%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 3   ILKIFAREIFDSRGNPTVEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV ++N+ I+ ALI  +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAG
Sbjct: 63  SKAVGHVNKTIAPALISKNINVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q9W7L1|ENOA_TRASC Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  210 bits (535), Expect = 2e-53
 Identities = 105/170 (61%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GV
Sbjct: 2   ILKIFAREIFDSRGNPTVEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV ++N+ I+ ALI  +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAG
Sbjct: 62  SKAVGHVNKTIAPALISKNINVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:UPU85835_1407332 Unidentified pseudophyllidean enolase mRNA,
           partial cds.
          Length = 170

 Score =  210 bits (534), Expect = 3e-53
 Identities = 109/168 (64%), Positives = 133/168 (79%), Gaps = 3/168 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVDLYT KGMFRA+ PSGAS G++EA+ELRD DK  Y+G GV
Sbjct: 3   IQKIHARQIFDSRGNPTVEVDLYTAKGMFRAAVPSGASTGIHEAVELRDDDKKNYMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+ A+I  G+  T Q +ID+ MI LD T  KG+LGANAIL VS+AACKAG
Sbjct: 63  LHAVKNVNDIIAPAVIKSGLSVTKQKEIDELMIKLDGTPNKGKLGANAILGVSLAACKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNN-LAVQEIM 817
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN+ LA+ E M
Sbjct: 123 AAEKGVPLYRHIADLAGNKDVVLPVPAFNVINGGSHAGNHKLAMHEFM 170



>pir|S02072|S02072 phosphopyruvate hydratase (EC 4.2.1.11) beta -
           rat>gb:RSBBE_2138329 Rattus norvegicus mRNA for beta
           beta enolase (EC 4.2.1.11).
          Length = 434

 Score =  209 bits (533), Expect = 4e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVPK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P15429|ENOB_RAT Beta enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle
           enolase) (Enolase 3).
          Length = 433

 Score =  209 bits (533), Expect = 4e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 4   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVPK 63

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 64  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 123

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:BC083566_2108652 Rattus norvegicus enolase 3, beta, mRNA (cDNA
           clone MGC:93623 IMAGE:7193009), complete cds.
          Length = 434

 Score =  209 bits (532), Expect = 5e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:BC083334_2108601 Mus musculus cDNA clone IMAGE:6414729, partial
           cds.
          Length = 462

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 31  ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 90

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 91  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 150

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 151 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 200



>gb:BC039179_2098372 Mus musculus enolase 1, alpha non-neuron, mRNA
           (cDNA clone IMAGE:4501041), partial cds.
          Length = 458

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 27  ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 86

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 87  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 146

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 147 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 196



>gb:AL596117_2070857 Mouse DNA sequence from clone RP23-326P7 on
           chromosome 11 Contains the Gp1ba gene for glycoprotein
           1b alpha polypeptide, the Slc25a11 gene for solute
           carrier family 25 (mitochondrial carrier; oxoglutarate
           carrier) member 11, the gene for a novel PA domain and
           C3HC4 type zinc finger (RING finger) containing protein,
           the Pfn1 gene for profilin 1, five novel genes, the Eno3
           gene for muscle enolase 3 beta, the Spag7 gene for sperm
           associated antigen 7, the Kif1c gene for kinesin family
           member 1C, a ribosomal protein 37A (Rpl37a) pseudogene,
           the gene for a novel zinc finger protein and six CpG
           islands, complete sequence.
          Length = 196

 Score =  209 bits (532), Expect = 5e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKARYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AK002336_1151129 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610008I15
           product:enolase 1, alpha non-neuron, full insert
           sequence.>gb:AK088788_1175623 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430026A19 product:enolase 1,
           alpha non-neuron, full insert
           sequence.>gb:BC003891_2089434 Mus musculus enolase 1,
           alpha non-neuron, mRNA (cDNA clone MGC:6751
           IMAGE:3592683), complete cds.>gb:BC010685_2091056 Mus
           musculus enolase 1, alpha non-neuron, mRNA (cDNA clone
           MGC:11651 IMAGE:3599051), complete
           cds.>gb:BC024644_2094647 Mus musculus enolase 1, alpha
           non-neuron, mRNA (cDNA clone MGC:30328 IMAGE:3583123),
           complete cds.>gb:BC085098_2109052 Mus musculus enolase
           1, alpha non-neuron, mRNA (cDNA clone MGC:103111
           IMAGE:5376359), complete cds.>gb:BC089539_2110887 Mus
           musculus enolase 1, alpha non-neuron, mRNA (cDNA clone
           MGC:107267 IMAGE:6707317), complete
           cds.>gb:BC087210_2565067 Xenopus laevis hypothetical
           LOC495886, mRNA (cDNA clone MGC:98164 IMAGE:7201003),
           complete cds.
          Length = 434

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AK002322_1151121 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610008C10
           product:enolase 1, alpha non-neuron, full insert
           sequence.
          Length = 321

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|S10246|S10246 phosphopyruvate hydratase (EC 4.2.1.11) alpha -
           mouse>gb:MSALEN_2124731 Mouse mRNA for alpha-enolase
           (2-phospho-D-glycerate hydrolase) (EC 4.2.1.11).
          Length = 434

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|S17109|NOMSB phosphopyruvate hydratase (EC 4.2.1.11) beta -
           mouse>gb:AK002485_1151240 Mus musculus adult male kidney
           cDNA, RIKEN full-length enriched library,
           clone:0610010I24 product:enolase 3, beta muscle, full
           insert sequence.>gb:AL596117_2070856 Mouse DNA sequence
           from clone RP23-326P7 on chromosome 11 Contains the
           Gp1ba gene for glycoprotein 1b alpha polypeptide, the
           Slc25a11 gene for solute carrier family 25
           (mitochondrial carrier; oxoglutarate carrier) member 11,
           the gene for a novel PA domain and C3HC4 type zinc
           finger (RING finger) containing protein, the Pfn1 gene
           for profilin 1, five novel genes, the Eno3 gene for
           muscle enolase 3 beta, the Spag7 gene for sperm
           associated antigen 7, the Kif1c gene for kinesin family
           member 1C, a ribosomal protein 37A (Rpl37a) pseudogene,
           the gene for a novel zinc finger protein and six CpG
           islands, complete sequence.>gb:BC013460_2091748 Mus
           musculus enolase 3, beta muscle, mRNA (cDNA clone
           MGC:18648 IMAGE:4217678), complete
           cds.>gb:MMBERNA_2114289 M.musculus mRNA for
           beta-enolase.>gb:MMENO3A_2114822 M.musculus ENO3 mRNA
           for enolase beta subunit.>gb:MMENO3G_2114823 M.musculus
           gene for beta-enolase.
          Length = 434

 Score =  209 bits (532), Expect = 5e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKARYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P21550|ENOB_MOUSE Beta enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle
           enolase) (Enolase 3).
          Length = 433

 Score =  209 bits (532), Expect = 5e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 4   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKARYLGKGVLK 63

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 64  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 123

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 EKGVPLYRHIADLAGNPDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 171



>sp|P17182|ENOA_MOUSE Alpha enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Non- neural
           enolase) (NNE) (Enolase 1).
          Length = 433

 Score =  209 bits (532), Expect = 5e-53
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 2   ILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+     +  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 62  SQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AVEKGVPLYRHIADLAGNPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AY398342_2531872 Danio rerio clone RK122A2D02 enolase 1, (alpha)
           (ENO1) mRNA, complete cds.
          Length = 433

 Score =  209 bits (531), Expect = 7e-53
 Identities = 105/170 (61%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR+ILDSRG PTVEVDLYT KG FRA+ PSGAS G++EA+ELRD DK  YLG G 
Sbjct: 3   ISKIHAREILDSRGNPTVEVDLYTTKGRFRAAVPSGASTGVHEALELRDGDKTRYLGKGT 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV ++N+ I+  LI    ++  Q +ID+ M++LD TE K + GANAIL VS+A CKAG
Sbjct: 63  QKAVDHVNKDIAPKLIEKKFSVVEQEKIDKFMLELDGTENKSQFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEKGVPLYRHIADLAGNKDVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:AF260259_1416988 Oryctolagus cuniculus beta beta enolase mRNA,
           complete cds.
          Length = 434

 Score =  209 bits (531), Expect = 7e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 5   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLK 64

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 65  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 124

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 125 EKGVPLYRHIADLAGNHDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|A23126|A23126 phosphopyruvate hydratase (EC 4.2.1.11) alpha -
           rat>gb:RNENOAA_2134806 Rat mRNA for non-neuronal enolase
           (NNE) (alpha-alpha enolase, 2-phospho-D-glycerate
           hydrolase EC 4.2.1.11).
          Length = 434

 Score =  209 bits (531), Expect = 7e-53
 Identities = 105/170 (61%), Positives = 132/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+I DSRG PTVEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GV
Sbjct: 3   ILKIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AV++IN+ I+ AL+   ++   Q +IDQ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  SKAVEHINKTIAPALVSKKLNVVEQEKIDQLMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K VPLY+HIADL+G   + LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVGKGVPLYRHIADLAGNPEVTLPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|A37210|A37210 phosphopyruvate hydratase (EC 4.2.1.11) beta -
           rabbit
          Length = 433

 Score =  209 bits (531), Expect = 7e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 4   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLK 63

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 64  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 123

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 EKGVPLYRHIADLAGNHDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 171



>sp|P25704|ENOB_RABIT Beta enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Skeletal muscle
           enolase) (Enolase 3).
          Length = 433

 Score =  209 bits (531), Expect = 7e-53
 Identities = 106/168 (63%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query: 329 KLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +
Sbjct: 4   KIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLK 63

Query: 509 AVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           AV++IN+ +  AL+    ++  Q ++D+ MI+LD TE K + GANAIL VS+A CKAGAA
Sbjct: 64  AVEHINKTLGPALLEKKLSVVDQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAA 123

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK VPLY+HIADL+G  +L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 EKGVPLYRHIADLAGNHDLVLPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:CSU85836_1375802 Calliobothrium sp. enolase mRNA, partial cds.
          Length = 171

 Score =  208 bits (530), Expect = 9e-53
 Identities = 108/168 (64%), Positives = 131/168 (77%), Gaps = 2/168 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVDL T KGMFRA+ PSGAS G++EA+ELRD DK +Y+G GV
Sbjct: 3   IVSIHARQIFDSRGNPTVEVDLTTAKGMFRAAVPSGASTGVHEAVELRDGDKSSYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N  I+ ALI   +  T Q++ID+ MI LD T  KG+LGANAIL VS+AACKAG
Sbjct: 63  LNAVKNVNTIIAPALIKEKLPVTEQAKIDEFMIKLDGTANKGKLGANAILGVSLAACKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMI 820
           AAEK VPLY+HIADL+G  +++LPVPAF +I+GG HAGN LA+ E MI
Sbjct: 123 AAEKGVPLYRHIADLAGNKDVVLPVPAFNVINGGSHAGNKLAMHEFMI 170



>pir|JC4187|JC4187 phosphopyruvate hydratase (EC 4.2.1.11) beta
           chain - chicken>gb:D37901_2570521 Chicken mRNA for
           enolase beta, complete cds.
          Length = 434

 Score =  207 bits (528), Expect = 1e-52
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G++EA+E RD DK  +LG GV
Sbjct: 3   IQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPRDGDKKRFLGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV++IN+ I  ALI    ++  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G T L+LPVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 123 AAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLP 172



>sp|P07322|ENOB_CHICK Beta enolase (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Phosphopyruvate
           hydratase).
          Length = 433

 Score =  207 bits (528), Expect = 1e-52
 Identities = 106/170 (62%), Positives = 133/170 (78%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G++EA+E RD DK  +LG GV
Sbjct: 2   IQKIHAREILDSRGEPTVEVDLHTAKGHFRAAVPSGASTGIHEALEPRDGDKKRFLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV++IN+ I  ALI    ++  Q +ID+ MI++D TE K + GANAIL VS+A CKAG
Sbjct: 62  LKAVEHINKTIGPALIEKKISVVEQEKIDKVMIEMDGTENKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G T L+LPVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 122 AAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLP 171



>gb:BC072713_2556643 Danio rerio enolase 2, mRNA (cDNA clone
           MGC:92418 IMAGE:7038923), complete cds.
          Length = 434

 Score =  206 bits (525), Expect = 3e-52
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           +  + AR+ILDSRG PTVEVDL T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y G GV
Sbjct: 3   VVSIIAREILDSRGNPTVEVDLRTDKGLFRAAVPSGASTGIYEALELRDGDKSRYNGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV +IN+ +  A+I  + ++  Q ++D  MI++D TE K + GANAIL VS+A CKAG
Sbjct: 63  LKAVGHINDTLGPAIIASEISVVDQEKLDNMMIEMDGTENKSQFGANAILGVSLAICKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK  PLY+HIADL+G T L+LPVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 123 AAEKGAPLYRHIADLAGNTELVLPVPAFNVINGGSHAGNKLAMQEFMVLP 172



>gb:SSU85829_1398134 Spongilla sp. enolase mRNA, partial cds.
          Length = 170

 Score =  206 bits (524), Expect = 4e-52
 Identities = 103/169 (60%), Positives = 131/169 (77%), Gaps = 2/169 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           + +TK+ AR+ILDSRG PTVEV++ T KG+FRA+ PSGAS G+YEA+ELRD D   YLG 
Sbjct: 2   ATVTKVHAREILDSRGNPTVEVEVTTAKGVFRAAVPSGASTGIYEALELRDKDPQRYLGK 61

Query: 497 GVSRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACK 670
           GV +AV+N+ + I  +L+  G+D T Q+ IDQ M+DLD TE K +LGANAIL VS+A CK
Sbjct: 62  GVLKAVENVTKVIGPSLLTSGLDVTNQAAIDQLMLDLDDTENKSKLGANAILGVSLAVCK 121

Query: 671 AGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AGAA K VPLY+HIAD++GKT  +LP PAF +I+GG HAGN LA+ E M
Sbjct: 122 AGAAHKGVPLYQHIADIAGKTTFVLPCPAFNVINGGSHAGNKLAMHEFM 170



>gb:TSU85834_1401118 Tubularia sp. enolase mRNA, partial cds.
          Length = 166

 Score =  204 bits (520), Expect = 1e-51
 Identities = 103/165 (62%), Positives = 130/165 (78%), Gaps = 2/165 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           S +TK+ AR+ILDSRG PTVEVDL T++G+FRA+ PSGAS G+YEA+ELRD D   YLG 
Sbjct: 2   SGVTKIHAREILDSRGNPTVEVDLATSRGVFRAAVPSGASTGIYEALELRDKDPKRYLGK 61

Query: 497 GVSRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACK 670
           G  +AV NIN+ I  ALI   +D T Q ++D+ M++LD TE K +LGANAILAVS+A CK
Sbjct: 62  GALKAVSNINDIIGPALISKNIDCTQQGEVDKIMLELDGTENKSKLGANAILAVSLAVCK 121

Query: 671 AGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAV 805
           AGAA K VPLYKHIADL+G + +++PVPAF +I+GG HAGN LA+
Sbjct: 122 AGAAHKGVPLYKHIADLAGNSKVIMPVPAFNVINGGSHAGNKLAM 166



>gb:AF363629_1265653 Trichinella spiralis enolase (Eno) mRNA,
           complete cds.
          Length = 437

 Score =  204 bits (519), Expect = 2e-51
 Identities = 105/170 (61%), Positives = 129/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVDL TN+G+FRA+ PSGAS G++EA+ELRD DK  Y+G GV
Sbjct: 3   ILDIHARQIFDSRGNPTVEVDLRTNRGIFRAAVPSGASTGIHEALELRDGDKSQYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+AVKNINE I+ +LI    + T QS ID  M+ LD TE K  LGANAIL VS+A CKAG
Sbjct: 63  SKAVKNINEVIAPSLIAKNFEVTEQSLIDNFMLSLDGTENKSVLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K V LY++IADL+G   +++PVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 123 AVHKGVSLYRYIADLAGVDKVIMPVPAFNVINGGSHAGNKLAMQEFMLLP 172



>pir|A23850|A23850 phosphopyruvate hydratase (EC 4.2.1.11), skeletal
           muscle - chicken
          Length = 433

 Score =  202 bits (515), Expect = 5e-51
 Identities = 104/170 (61%), Positives = 132/170 (77%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVDL+T KG FRA+ PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 2   IQKIHAREILDSRGDPTVEVDLHTAKGHFRAAVPSGASTGIHEALELRDGDKKRFLGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV++IN+ I  ALI    ++  Q +ID+ +I++D TE K + GANAIL VS+A   AG
Sbjct: 62  LKAVEHINKTIGPALIEKKISVVEQEKIDKVVIEMDGTENKSKFGANAILGVSLAVSHAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+HIADL+G T L+LPVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 122 AAEKGVPLYRHIADLAGNTELILPVPAFNVINGGSHAGNKLAMQEFMVLP 171



>gb:HCU85827_1385822 Hydra cf. oligactis enolase mRNA, partial cds.
          Length = 173

 Score =  201 bits (512), Expect = 1e-50
 Identities = 105/170 (61%), Positives = 129/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ AR+ILDS G PTVEVDL T  G FRA+ PSGAS G++EA+ELRD D   YLG GV
Sbjct: 4   ITKIHAREILDSTGNPTVEVDLTTPLGTFRAAVPSGASTGIHEALELRDKDPKRYLGKGV 63

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV+N+NE I+  LI   +D T Q ++DQ MI+LD T  K +LGANA L VS+A  KAG
Sbjct: 64  TKAVENVNEIIAPYLISKNIDCTKQKEVDQLMIELDGTPNKSKLGANATLGVSLAVSKAG 123

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K VPLYKH+ADL+G  NL+LPVPAF +I+GG HAGN LA+ E MI P
Sbjct: 124 AAQKGVPLYKHLADLAGNENLILPVPAFNVINGGSHAGNKLAMHEFMIGP 173



>gb:HDU85833_1385869 Hymenolepis diminuta enolase mRNA, partial cds.
          Length = 168

 Score =  201 bits (511), Expect = 1e-50
 Identities = 102/166 (61%), Positives = 127/166 (76%), Gaps = 2/166 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVDL+T+ GMFRA+ PSGAS G++EA+ELRD DK  Y+G GV
Sbjct: 3   IVKIHARQIFDSRGNPTVEVDLFTDNGMFRAAVPSGASTGVHEAVELRDNDKANYMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+  LI  G   T Q  ID+ MI LD T+ KG+LGANAIL VS+A CKAG
Sbjct: 63  LNAVKNVNDIIAPELIKKGFKVTEQEAIDEFMIKLDGTKNKGKLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEI 814
           AA K VPLY+HIA+L+G  +++LPVPAF +++GG HAGN LA+  I
Sbjct: 123 AALKGVPLYRHIAELAGNKDVILPVPAFNVLNGGSHAGNKLAMHRI 168



>sp|O02654|ENO_LOLPE Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:S80961_1396983 enolase [Loligo
           pealii=squids, nervous system, mRNA, 1515 nt].
          Length = 434

 Score =  201 bits (511), Expect = 1e-50
 Identities = 103/171 (60%), Positives = 129/171 (75%), Gaps = 2/171 (1%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           VI K+ +RQI DSRG PTVEVDL+T+KGMFRA+ PSGAS G+YEA+E+RD D   Y G  
Sbjct: 2   VIKKVHSRQIFDSRGNPTVEVDLWTDKGMFRAAVPSGASTGIYEALEMRDKDAKNYHGKT 61

Query: 500 VSRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
           +  AV N+N+ I+ AL+   MD   Q+ +D  ++ LD TE K +LGANAIL VS+A CKA
Sbjct: 62  LFNAVGNVNKIIAPALVDKKMDEKDQTAVDNFLLALDGTENKNKLGANAILGVSLAVCKA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           GAA K VPLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 GAAAKGVPLYRHIADLAGNKEVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|Q9U615|ENO_MASBA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AF205070_1250835 Mastigamoeba balamuthi
           enolase mRNA, complete cds.>gb:AF348478_1264394
           Mastigamoeba balamuthi enolase (enol) gene, complete
           cds.
          Length = 439

 Score =  199 bits (507), Expect = 4e-50
 Identities = 98/170 (57%), Positives = 129/170 (75%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           S I  + AR+ILDSRG PTVEVDL T KG+FR++ PSGAS G+YEA ELRD DK  YLG 
Sbjct: 2   STIKSVFAREILDSRGNPTVEVDLTTEKGLFRSAVPSGASTGIYEACELRDGDKSRYLGK 61

Query: 497 GVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           GV +AV+N+N+ ++  LIG+D T Q +ID+ M+ +D TE K  LGANAIL  SM+ C+A 
Sbjct: 62  GVLKAVENVNKILAPKLIGLDVTKQGEIDRLMLQIDGTENKTHLGANAILGCSMSVCRAA 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA + +PLY++IA+LSG  + +LP+P F +I+GG+HAGN LA+QE MI P
Sbjct: 122 AAFRGLPLYRYIAELSGNKSPMLPLPCFNVINGGEHAGNKLAMQEFMICP 171



>sp|P56252|ENO_HOMGA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 433

 Score =  199 bits (506), Expect = 5e-50
 Identities = 102/170 (60%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ AR I DSRG PTVEVDLYT+KG+FRA+ PSGAS G++EA+E+RD DK  Y G  V
Sbjct: 2   ITKVFARTIFDSRGNPTVEVDLYTSKGLFRAAVPSGASTGVHEALEMRDGDKSKYHGKSV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I   +I  G+  T Q + D+ M  LD TE K  LGANAIL VS+A CKAG
Sbjct: 62  FNAVKNVNDVIVPEIIKSGLKVTQQKECDEFMCKLDGTENKSSLGANAILGVSLAICKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE  +PLY+HIA+L+    ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 AAELGIPLYRHIANLANYDEVILPVPAFNVINGGSHAGNKLAMQEFMILP 171



>gb:AF100985_1241267 Penaeus monodon phosphopyruvate hydratase mRNA,
           complete cds.
          Length = 434

 Score =  198 bits (504), Expect = 9e-50
 Identities = 101/170 (59%), Positives = 127/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ AR I DSRG PTVEVDLYT+KG+FRA+ PSGAS G++EA+E+RD DK  Y G  V
Sbjct: 3   ITKVFARTIFDSRGNPTVEVDLYTHKGLFRAAVPSGASTGVHEALEMRDGDKSKYHGKSV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N  I+  +I  G+  T Q + D  M  LD TE K  LGANAIL VS+A CKAG
Sbjct: 63  FKAVNNVNSIIAPEIIKSGLKVTQQKECDDFMCKLDGTENKSRLGANAILGVSLAICKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE  +PLY+HIA+L+  ++++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAELGIPLYRHIANLANYSDVILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>pir|B96768|B96768 protein enolase F2P9.10 [imported] - Arabidopsis
           thaliana>gb:AE005173_894948 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538223 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.>gb:AY034978_1559758 Arabidopsis thaliana
           putative enolase (At1g74030) mRNA, complete
           cds.>gb:AY062968_1565557 Arabidopsis thaliana putative
           enolase (At1g74030) mRNA, complete cds.
          Length = 477

 Score =  198 bits (503), Expect = 1e-49
 Identities = 98/165 (59%), Positives = 127/165 (76%)
 Frame = +2

Query: 332 LKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRA 511
           +KARQI+DSRG PTVEVDL T+  ++R++ PSGAS G+YEA+ELRD DK  Y G GV +A
Sbjct: 54  VKARQIIDSRGNPTVEVDLITDD-LYRSAVPSGASTGIYEALELRDGDKSVYGGKGVLQA 112

Query: 512 VKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKE 691
           +KNINE ++  LIG+D   Q+ +D  M++LD T  K +LGANAIL VS++ C+AGA  K 
Sbjct: 113 IKNINELVAPKLIGVDVRNQADVDALMLELDGTPNKSKLGANAILGVSLSVCRAGAGAKG 172

Query: 692 VPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           VPLYKHI + SG   L++PVPAF +I+GG HAGN+LA+QE MILP
Sbjct: 173 VPLYKHIQETSGTKELVMPVPAFNVINGGSHAGNSLAMQEFMILP 217



>sp|P26300|ENO_LYCES Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|JQ1185|JQ1185 phosphopyruvate
           hydratase (EC 4.2.1.11) - tomato>gb:LEMRNAEN_1684375
           L.esculentum mRNA for enolase.
          Length = 444

 Score =  197 bits (501), Expect = 2e-49
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD++ + G+F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATIKSIKARQIFDSRGNPTVEVDVHISNGVFARAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  AL+G DPT Q+ +D  M+  LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVNNVNSIIGPALVGKDPTDQTGLDNFMVHQLDGTQNEWGWCKEKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGAA + VPLYKHIADL+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAAVRNVPLYKHIADLAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AY005161_2507833 Salmo trutta alpha-1 enolase-1 mRNA, partial
           cds.
          Length = 369

 Score =  197 bits (500), Expect = 3e-49
 Identities = 97/153 (63%), Positives = 122/153 (79%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           VEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GVS+AV +IN+ I+ AL+ 
Sbjct: 1   VEVDLYTKKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGVSKAVDHINKTIAPALVR 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            +  +  Q ++D+ M+D+D TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  QNVNVLEQEKVDKLMLDMDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
             N++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 NPNVILPVPAFNVINGGSHAGNKLAMQEFMILP 153



>gb:AB026051_1194327 Plasmodium falciparum mRNA for enolase,
           complete cds.
          Length = 446

 Score =  196 bits (499), Expect = 3e-49
 Identities = 104/177 (58%), Positives = 134/177 (75%), Gaps = 8/177 (4%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           VIT++ AR+ILDSRG PTVEVDL TN G+FRA+ PSGAS G+YEA+ELRD DK  YLG G
Sbjct: 4   VITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTE-----KKGELGANAILAVSMA 661
           V +A+KNINE I+  LIGM+ T Q +ID  M+ +LD ++      K +LGANAILA+SMA
Sbjct: 64  VQKAIKNINEIIAPKLIGMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTN--LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            C+AGAA  +V LYK++A L+GK +  ++LPVP   +I+GG HAGN L+ QE MI+P
Sbjct: 124 VCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKLSFQEFMIVP 180



>gb:AE014185_937732 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014831_1228466 Plasmodium falciparum 3D7
           chromosome 10 section 3 of 7 of the complete sequence.
          Length = 446

 Score =  196 bits (499), Expect = 3e-49
 Identities = 104/177 (58%), Positives = 134/177 (75%), Gaps = 8/177 (4%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           VIT++ AR+ILDSRG PTVEVDL TN G+FRA+ PSGAS G+YEA+ELRD DK  YLG G
Sbjct: 4   VITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTE-----KKGELGANAILAVSMA 661
           V +A+KNINE I+  LIGM+ T Q +ID  M+ +LD ++      K +LGANAILA+SMA
Sbjct: 64  VQKAIKNINEIIAPKLIGMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTN--LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            C+AGAA  +V LYK++A L+GK +  ++LPVP   +I+GG HAGN L+ QE MI+P
Sbjct: 124 VCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKLSFQEFMIVP 180



>sp|Q27727|ENO_PLAFA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|S42206|S42206 phosphopyruvate
           hydratase (EC 4.2.1.11) - malaria parasite  (Plasmodium
           falciparum)>gb:PFAENOL1_1393758 Plasmodium falciparum
           enolase gene complete cds.
          Length = 446

 Score =  196 bits (499), Expect = 3e-49
 Identities = 104/177 (58%), Positives = 134/177 (75%), Gaps = 8/177 (4%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           VIT++ AR+ILDSRG PTVEVDL TN G+FRA+ PSGAS G+YEA+ELRD DK  YLG G
Sbjct: 4   VITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTE-----KKGELGANAILAVSMA 661
           V +A+KNINE I+  LIGM+ T Q +ID  M+ +LD ++      K +LGANAILA+SMA
Sbjct: 64  VQKAIKNINEIIAPKLIGMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTN--LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            C+AGAA  +V LYK++A L+GK +  ++LPVP   +I+GG HAGN L+ QE MI+P
Sbjct: 124 VCRAGAAPNKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKLSFQEFMIVP 180



>gb:AY118449_1300171 Drosophila melanogaster SD23356 full insert
           cDNA.>gb:BT014924_1358244 Drosophila melanogaster
           AT25373 full insert cDNA.
          Length = 500

 Score =  196 bits (498), Expect = 4e-49
 Identities = 110/207 (53%), Positives = 138/207 (66%), Gaps = 11/207 (5%)
 Frame = +2

Query: 239 AVNAAVRAKTSDPVLFISN-----HMRKSV----PSVITKLKARQILDSRGIPTVEVDLY 391
           + N A R ++   V  +S+      +RKS        I  +KARQI DSRG PTVEVDL 
Sbjct: 33  SANVAPRFRSKSAVSQLSSGFKFVQIRKSTCDSNEMTIKAIKARQIYDSRGNPTVEVDLT 92

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMDPT 565
           T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V +AV ++N+ +   LI   +D  
Sbjct: 93  TELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKAVGHVNDTLGPELIKANLDVV 152

Query: 566 LQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q+ ID  MI LD TE K + GANAIL VS+A  KAGAA+K VPLYKHIADL+G   ++L
Sbjct: 153 DQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLYKHIADLAGNKEIIL 212

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 213 PVPAFNVINGGSHAGNKLAMQEFMILP 239



>gb:AE014134_1127043 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127044 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127045
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127046 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003585_1216572
           Drosophila melanogaster chromosome 2L, section 6 of 83
           of the complete sequence.>gb:AE003585_1216573 Drosophila
           melanogaster chromosome 2L, section 6 of 83 of the
           complete sequence.>gb:AE003585_1216574 Drosophila
           melanogaster chromosome 2L, section 6 of 83 of the
           complete sequence.>gb:AE003585_1216575 Drosophila
           melanogaster chromosome 2L, section 6 of 83 of the
           complete sequence.
          Length = 500

 Score =  196 bits (498), Expect = 4e-49
 Identities = 110/207 (53%), Positives = 138/207 (66%), Gaps = 11/207 (5%)
 Frame = +2

Query: 239 AVNAAVRAKTSDPVLFISN-----HMRKSV----PSVITKLKARQILDSRGIPTVEVDLY 391
           + N A R ++   V  +S+      +RKS        I  +KARQI DSRG PTVEVDL 
Sbjct: 33  SANVAPRFRSKSAVSQLSSGFKFVQIRKSTCDSNEMTIKAIKARQIYDSRGNPTVEVDLT 92

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMDPT 565
           T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V +AV ++N+ +   LI   +D  
Sbjct: 93  TELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKAVGHVNDTLGPELIKANLDVV 152

Query: 566 LQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q+ ID  MI LD TE K + GANAIL VS+A  KAGAA+K VPLYKHIADL+G   ++L
Sbjct: 153 DQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAGAAKKGVPLYKHIADLAGNKEIIL 212

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 213 PVPAFNVINGGSHAGNKLAMQEFMILP 239



>gb:AF348936_1790164 Chlamydomonas reinhardtii enolase (eno) gene,
           partial cds.
          Length = 139

 Score =  196 bits (497), Expect = 6e-49
 Identities = 96/139 (69%), Positives = 115/139 (82%)
 Frame = +2

Query: 389 YTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL 568
           YT KGMFRA+ PSGAS G++EA+ELRD DK  YLG GV++AV+NIN  I+ AL GMDP  
Sbjct: 1   YTRKGMFRAAVPSGASTGVHEAVELRDGDKSKYLGKGVTKAVENINAIIAPALKGMDPVK 60

Query: 569 QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLLP 748
           Q++IDQ M DLD T+ KG+LGANAILAVSMA CKAGAAEK VPLYKHIADL+G + L+LP
Sbjct: 61  QAEIDQKMKDLDGTDNKGKLGANAILAVSMAVCKAGAAEKGVPLYKHIADLAGNSKLILP 120

Query: 749 VPAFTLISGGKHAGNNLAV 805
           VP+F +I+GG HAGN LA+
Sbjct: 121 VPSFNIINGGSHAGNALAM 139



>gb:AF532606_1279814 Onchocerca volvulus enolase mRNA, complete cds.
          Length = 435

 Score =  195 bits (496), Expect = 8e-49
 Identities = 100/170 (58%), Positives = 127/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           IT++ AR I DSRG PTVEVDL T KG+FRA+ PSGAS G++EA+ELRD D+    G GV
Sbjct: 3   ITRVHARPIYDSRGNPTVEVDLTTEKGIFRAAVPSGASTGIHEALELRDNDEAVNHGKGV 62

Query: 503 SRAVKNINEKISEALIGMD--PTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+NE+I  AL+  +  PT Q +ID  M+ LD TE K +LGANAIL VS+A CKAG
Sbjct: 63  LQAVGNVNEQIGPALVAKNFCPTQQREIDLFMLQLDGTENKAKLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K +PLYK+IA+L+G   ++LPVPA  +I+GG HAGN LA+QE MI+P
Sbjct: 123 AVHKGMPLYKYIAELAGTRQIVLPVPAMNVINGGSHAGNKLAMQEFMIMP 172



>gb:AE014134_1127047 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003585_1216576 Drosophila melanogaster
           chromosome 2L, section 6 of 83 of the complete sequence.
          Length = 433

 Score =  195 bits (496), Expect = 8e-49
 Identities = 102/170 (60%), Positives = 124/170 (72%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  +KARQI DSRG PTVEVDL T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V
Sbjct: 3   IKAIKARQIYDSRGNPTVEVDLTTELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV ++N+ +   LI   +D   Q+ ID  MI LD TE K + GANAIL VS+A  KAG
Sbjct: 63  LKAVGHVNDTLGPELIKANLDVVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K VPLYKHIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAKKGVPLYKHIADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P15007|ENO_DROME Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|S07586|S07586 phosphopyruvate
           hydratase (EC 4.2.1.11) - fruit fly  (Drosophila
           melanogaster)>gb:DMENOLAS_1379507 Drosophila gene for
           enolase (2-phospho-D-glycerate hydrolase) (EC 4.2.1.11).
          Length = 433

 Score =  195 bits (496), Expect = 8e-49
 Identities = 102/170 (60%), Positives = 124/170 (72%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  +KARQI DSRG PTVEVDL T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V
Sbjct: 3   IKAIKARQIYDSRGNPTVEVDLTTELGLFRAAVPSGASTGVHEALELRDNDKANYHGKSV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV ++N+ +   LI   +D   Q+ ID  MI LD TE K + GANAIL VS+A  KAG
Sbjct: 63  LKAVGHVNDTLGPELIKANLDVVDQASIDNFMIKLDGTENKSKFGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K VPLYKHIADL+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAKKGVPLYKHIADLAGNKEIILPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P42895|ENO2_MAIZE Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 2) (2-phospho- D-glycerate hydro-lyase
           2).>pir|T02221|T02221 phosphopyruvate hydratase (EC
           4.2.1.11) - maize>gb:AY344113_1600928 Cynodon dactylon
           pollen 2-phosphoglycerate dehydrogenase 2 precursor,
           mRNA, complete cds.>gb:ZMU17973_1732097 Zea mays enolase
           (eno2) mRNA, complete cds.
          Length = 446

 Score =  195 bits (496), Expect = 8e-49
 Identities = 106/177 (59%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD++ + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 3   ATIQSVKARQIFDSRGNPTVEVDVFCSDGTFARAAVPSGASTGVYEALELRDGGS-YYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q++ID  M+  LD T+      K +LGANAILAVS
Sbjct: 62  KGVSKAVNNVNSVIGPALIGKDPTAQTEIDNFMVQQLDGTKNEWGWCKQKLGANAILAVS 121

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA+ K +PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 LAVCKAGASIKRIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:BC046928_1983760 Homo sapiens enolase 1, (alpha) pseudogene,
           mRNA (cDNA clone MGC:52271 IMAGE:3689936), complete cds.
          Length = 388

 Score =  194 bits (493), Expect = 2e-48
 Identities = 96/170 (56%), Positives = 128/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR++ DSRG PTVEVDL+T++G+FRA+ PSGAS G+YE +EL+D DK  Y+G GV
Sbjct: 3   ILKIHARELFDSRGNPTVEVDLFTSEGLFRAAVPSGASTGIYEVLELQDNDKTRYMGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           S+ V+ IN+ I+  L+   ++ T Q +ID+ MI++D TE K + GANAIL VS+AACKA 
Sbjct: 63  SKPVEPINKTIAPVLVSKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAACKAS 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY HIADLSG + ++LPVP F +I+G  HA   LA+QE M+LP
Sbjct: 123 AVEKGVPLYHHIADLSGNSKVILPVPVFNVINGSSHAVTKLAMQEFMVLP 172



>gb:AY430417_1605980 Heterosigma akashiwo enolase gene, partial cds.
          Length = 389

 Score =  194 bits (493), Expect = 2e-48
 Identities = 98/155 (63%), Positives = 119/155 (76%)
 Frame = +2

Query: 362 GIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISE 541
           G PTVEVD++T+ GMFRAS PSGAS G+YEA ELRD     Y+G GV +AV N++  I +
Sbjct: 2   GNPTVEVDIFTDNGMFRASVPSGASTGIYEACELRDGGD-RYMGKGVLQAVNNVDTLIKD 60

Query: 542 ALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADL 721
           ALIG DPT Q +IDQ M+DLD T+ K +LGANAIL VS+A  KAGAA K VPLY+H ADL
Sbjct: 61  ALIGKDPTQQREIDQIMLDLDGTKNKTKLGANAILGVSLAVSKAGAAAKGVPLYQHYADL 120

Query: 722 SGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +G T L+LPVP+F +I+GG HAGN LA QE M+LP
Sbjct: 121 AGNTQLVLPVPSFNVINGGSHAGNKLAFQEFMVLP 155



>gb:ASI496792_1285626 Anisakis simplex mRNA for enolase (eno gene).
          Length = 436

 Score =  194 bits (493), Expect = 2e-48
 Identities = 98/170 (57%), Positives = 127/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           IT++ ARQI DSRG PTVEVDL T KG+FRA+ PSGAS G++EA+ELRD DK    G  V
Sbjct: 3   ITRIHARQIYDSRGNPTVEVDLTTEKGVFRAAVPSGASTGVHEALELRDGDKAVNHGKSV 62

Query: 503 SRAVKNINEKISEALIGMD--PTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NIN+KI+ A++  +   T Q +IDQ M+D+D T  K  LGANAIL VS+A  KAG
Sbjct: 63  LKAVANINDKIAPAIVAKNFCSTQQKEIDQFMLDMDGTANKANLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K +PLYK+IA+L+G   +++PVP+F +I+GG HAGN LA+QE MI+P
Sbjct: 123 AVHKGMPLYKYIAELAGVKQVVMPVPSFNVINGGSHAGNKLAMQEFMIMP 172



>gb:EGR272112_1676457 Euglena gracilis partial mRNA for chloroplast
           enolase (eno29 gene).
          Length = 485

 Score =  194 bits (492), Expect = 2e-48
 Identities = 103/212 (48%), Positives = 139/212 (65%), Gaps = 2/212 (0%)
 Frame = +2

Query: 197 EYLDKHMLSRKLEDAVNAAVRAKTSDPVLFISNHMRKSVPSVITKLKARQILDSRGIPTV 376
           +YL +H +   + D +   V  K + PV F+ + + K   +VI  +KARQILDSRG PTV
Sbjct: 16  QYLRQHNIPELVNDLIQQLVTTKPAQPVAFLRDVLSKR-KAVIKVVKARQILDSRGNPTV 74

Query: 377 EVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           EVD+  + G+  R + PSGAS G YEA+ELRD DK  YLG GV ++V  +N  ++  LIG
Sbjct: 75  EVDVILDNGVVGRGAVPSGASTGEYEAVELRDGDKKVYLGKGVLKSVNAVNTLVAPKLIG 134

Query: 554 MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG-K 730
           +DP  Q +ID+ M  +D T  KG++GAN IL VSMA C+A A  + +PL+KHIA+L G K
Sbjct: 135 LDPANQREIDELMKQIDGTPNKGKIGANGILGVSMACCRAAALTQGIPLWKHIANLHGNK 194

Query: 731 TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            N  LPVP   +I+GGKHA N +  QE MI+P
Sbjct: 195 DNFQLPVPMCNIINGGKHADNKIDFQEFMIMP 226



>sp|Q27877|ENO_SCHMA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:SMENOLAS2_1397806 Schistosoma mansoni
           enolase gene, exons 7 and 8, and complete
           cds.>gb:SMU30175_1397835 Schisosoma mansoni enolase
           trans-spliced mRNA, complete cds.
          Length = 434

 Score =  194 bits (492), Expect = 2e-48
 Identities = 101/170 (59%), Positives = 129/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVDL T+KG+FRA+ PSGAS G++EA+ELRD +   Y+  GV
Sbjct: 3   ILTIHARQIFDSRGNPTVEVDLKTSKGLFRAAVPSGASTGVHEALELRDTNSKAYMKKGV 62

Query: 503 SRAVKNINEKISEALIGMD--PTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N+ I+ ALI  +   T Q+ ID+ MIDLD TE K +LGANAIL VS+A CKAG
Sbjct: 63  LTAVSNVNKIIAPALINKNIPVTNQAAIDKYMIDLDGTENKEKLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE  +PLY++IA L+G  ++++PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAEAGLPLYRYIARLAGHEDVIMPVPAFNVINGGSHAGNKLAMQEFMILP 172



>sp|P51555|ENO1_ENTHI Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:EHU09736_1384529 Entamoeba histolytica
           HM1:IMSS enolase (enl-1) mRNA, complete cds.
          Length = 436

 Score =  194 bits (492), Expect = 2e-48
 Identities = 95/168 (56%), Positives = 126/168 (75%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PT+EV++ T KGMFR+  PSGAS G++EA+ELRD DK  Y G GV
Sbjct: 3   IQKVHAREILDSRGNPTIEVEITTGKGMFRSCVPSGASTGVHEAVELRDGDKKRYGGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
            +AV+N+N  I  AL+G +   Q+++D+ MI LD T  KG+LGANAIL  SM+ C+A AA
Sbjct: 63  LKAVENVNTIIGPALLGKNVLNQAELDEMMIKLDGTNNKGKLGANAILGCSMSICRAAAA 122

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           EK +PLYK++A+L+G   + +PVP F +I+GG HAGN LA+QE MI P
Sbjct: 123 EKGLPLYKYLAELTGHKEMTMPVPCFNVINGGAHAGNALAMQEFMICP 170



>gb:AF115859_2474784 Pelusios subniger alpha enolase mRNA, partial
           cds.
          Length = 373

 Score =  193 bits (491), Expect = 3e-48
 Identities = 96/153 (62%), Positives = 122/153 (79%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           VEVDLYTNKGMFRA+ PSGAS G+YEA+ELRD DK  +LG GVS+AV ++N+ I+ ALI 
Sbjct: 1   VEVDLYTNKGMFRAAVPSGASTGIYEALELRDNDKTRFLGKGVSKAVGHVNKTIAPALIS 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  KNINVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 NPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 153



>gb:AY297757_1596488 Gossypium barbadense enolase mRNA, complete
           cds.
          Length = 445

 Score =  193 bits (491), Expect = 3e-48
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD+ T+ G+  RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 3   ATIVSVKARQIFDSRGNPTVEVDVETSNGIKARAAVPSGASTGIYEALELRDGGSD-YLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+  LD T+      K +LGANAILAVS
Sbjct: 62  KGVSKAVANVNTIIGPALIGKDPTEQTAIDNFMVQQLDGTQNEWGWCKQKLGANAILAVS 121

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA  K++PLYKHIA+L+G + L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 LAVCKAGAEVKKLPLYKHIANLAGNSKLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>sp|P33676|ENO_SCHJA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:SCMENOL_1397199 Schistosoma japonicum
           enolase mRNA, complete cds.
          Length = 434

 Score =  193 bits (491), Expect = 3e-48
 Identities = 100/170 (58%), Positives = 127/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVDL T KG+FRA+ PSGAS G++EA+ELRD +   Y+  GV
Sbjct: 3   IIAIHARQIFDSRGNPTVEVDLKTAKGLFRAAVPSGASTGVHEALELRDTNSKAYMCKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N  I+ AL+   +  T QS++DQ MI+LD  E KG LGANAIL VS+A CKAG
Sbjct: 63  LTAVSNVNNIIAPALLKKQIPVTNQSEVDQFMIELDGKENKGNLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAE  +PLY++IA L+G  ++++PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AAELNLPLYRYIAKLAGHKDVIMPVPAFNVINGGSHAGNKLAMQEFMILP 172



>gb:LLU271785_1685106 Lupinus luteus mRNA for enolase.
          Length = 444

 Score =  193 bits (490), Expect = 4e-48
 Identities = 107/177 (60%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVDL  + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATIATIKARQIFDSRGNPTVEVDLTLSDGTFARAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I+ ALIG DPT Q+ ID  ++ +LD T       K +LGANAILAVS
Sbjct: 61  KGVSKAVDNVNTIIAPALIGKDPTEQTAIDNFIVQELDGTVNEWGWGKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA+  ++PLYKHIA+L+G  NL+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGASALKIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AF115856_2474781 Sphenodon punctatus alpha enolase mRNA, partial
           cds.
          Length = 373

 Score =  192 bits (489), Expect = 5e-48
 Identities = 94/153 (61%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           VEVDLYT KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GVS+AV++IN+ I+ AL+ 
Sbjct: 1   VEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGVSKAVEHINKTIAPALVN 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            + ++  Q +ID+ M+++D TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  KNISVVEQEKIDKLMVEMDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++LPVPAF +I+GG HAGN LA+Q++MILP
Sbjct: 121 NAEVILPVPAFNVINGGSHAGNKLAMQDLMILP 153



>gb:AY054253_1563073 Arabidopsis thaliana At2g36530/F1O11.16 mRNA,
           complete cds.
          Length = 444

 Score =  192 bits (489), Expect = 5e-48
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNVIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:LTU85828_1389275 Lacistorhynchus tenuis enolase mRNA, partial
           cds.
          Length = 169

 Score =  192 bits (489), Expect = 5e-48
 Identities = 98/167 (58%), Positives = 125/167 (74%), Gaps = 2/167 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVDL T KGMFRA+ PSGAS G++EA+ELRD  K  Y+G GV
Sbjct: 3   IKTIHARQIFDSRGNPTVEVDLTTAKGMFRAAVPSGASTGVHEAVELRDGVKNQYMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N+ +   LI  G+  T Q ++D+ M  LD T+ KG+LGANAIL VS+A CKAG
Sbjct: 63  LKAVDNVNKILGPELIKSGIAVTEQVKVDEFMKKLDGTDNKGKLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AAEK +PLY+HIA+L+G   ++LPVPAF +++GG HAGN LA+ E M
Sbjct: 123 AAEKGIPLYRHIANLAGNKEIVLPVPAFNVLNGGSHAGNKLAMHEFM 169



>pir|A53665|A53665 phosphopyruvate hydratase (EC 4.2.1.11) - liver
           fluke
          Length = 431

 Score =  192 bits (489), Expect = 5e-48
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVD+ T KG+FRA+ PSGAS G++EA+ELRD   G Y+G GV
Sbjct: 3   IKAIHARQIFDSRGNPTVEVDVTTAKGLFRAAVPSGASTGVHEALELRDGPPG-YMGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N +I+  LI  G++ T Q+ +D+ M+DLD T  K +LGANAIL VS+A CKAG
Sbjct: 62  LKAVANVNSQIAPNLIKSGINVTDQAAVDKFMLDLDGTPNKEKLGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK +PLYK+IA L+G   +++PVP+F +I+GG HAGN LA+QE MI+P
Sbjct: 122 AAEKGLPLYKYIATLAGNKEVIMPVPSFNVINGGSHAGNKLAMQEFMIMP 171



>sp|Q27655|ENO_FASHE Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:FHU10297_1385112 Fasciola hepatica
           enolase trans-spliced mRNA, complete cds.
          Length = 431

 Score =  192 bits (489), Expect = 5e-48
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVD+ T KG+FRA+ PSGAS G++EA+ELRD   G Y+G GV
Sbjct: 3   IKAIHARQIFDSRGNPTVEVDVTTAKGLFRAAVPSGASTGVHEALELRDGPPG-YMGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N +I+  LI  G++ T Q+ +D+ M+DLD T  K +LGANAIL VS+A CKAG
Sbjct: 62  LKAVANVNSQIAPNLIKSGINVTDQAAVDKFMLDLDGTPNKEKLGANAILGVSLAXCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK +PLYK+IA L+G   +++PVP+F +I+GG HAGN LA+QE MI+P
Sbjct: 122 AAEKGLPLYKYIATLAGNKEVIMPVPSFNVINGGSHAGNKLAMQEFMIMP 171



>sp|O74286|ENO_CUNEL Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase)
           (Fragment).>gb:CEY17298_1646166 Cunninghamella elegans
           mRNA for enolase.
          Length = 436

 Score =  192 bits (489), Expect = 5e-48
 Identities = 103/173 (59%), Positives = 128/173 (73%), Gaps = 3/173 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           S ITK+ ARQI DSRG PTVEV++ T+KG+FRA  PSGAS G++EA+ELRD  K  YLG 
Sbjct: 1   STITKVHARQIFDSRGNPTVEVEVTTDKGVFRAGVPSGASTGVHEALELRDGVKSDYLGK 60

Query: 497 GVSRAVKNINEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACK 670
           GV +AV N+N  I+E L+  + ++  Q  +D  +I LD TE K +LGANAIL VS+A  K
Sbjct: 61  GVLKAVGNVNTIINEELVKANLSVVDQKAVDDFLIQLDGTENKEKLGANAILGVSLAVAK 120

Query: 671 AGAAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AGAAEK VP Y HIADL+G K   +LPVPAF +I+GG HAGN LA+QE MI+P
Sbjct: 121 AGAAEKGVPFYVHIADLAGSKKPFVLPVPAFNVINGGSHAGNKLAMQEFMIMP 173



>gb:AF428279_1799209 Arabidopsis thaliana At2g36530/F1O11.16 mRNA,
           complete cds.
          Length = 325

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:SOL271719_1715700 Spinacia oleracea mRNA for enolase (eno gene).
          Length = 444

 Score =  192 bits (488), Expect = 6e-48
 Identities = 103/175 (58%), Positives = 130/175 (74%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +KARQI DSRG PTVE D++ + G F RA+ PSGAS G+YEA+ELRD  K  Y+G G
Sbjct: 4   IKSVKARQIFDSRGNPTVEADIHLDDGTFARAAVPSGASTGIYEALELRDGGKD-YMGKG 62

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVSMA 661
           V +AV+N+NE I  AL+G DPT Q+ ID  M+ +LD T       K +LGANAILAVS+A
Sbjct: 63  VFKAVQNVNEIIGPALVGKDPTEQTAIDNFMVQELDGTTNEWGWCKQKLGANAILAVSLA 122

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K++PLY+HIA++SG   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 VCKAGAQVKKIPLYQHIAEISGNKKMVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AY559080_1614837 Capsella bursa-pastoris LOS2 (los2) mRNA,
           complete cds.
          Length = 444

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGVKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AY335488_1600218 Oryza sativa (japonica cultivar-group) enolase
           (Eno1) mRNA, complete cds.
          Length = 446

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD+  + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 3   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSD-YLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I+ ALIG DPT Q+++D  M+  LD T+      K +LGANAILAVS
Sbjct: 62  KGVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVS 121

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA  K++PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 LAICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:AY072095_1566989 Arabidopsis thaliana putative enolase
           (2-phospho-D-glycerate hydroylase) (At2g36530) mRNA,
           complete cds.
          Length = 444

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>sp|Q42971|ENO_ORYSA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase)
           (OSE1).>pir|T03267|T03267 probable phosphopyruvate
           hydratase (EC 4.2.1.11) - rice>gb:OSU09450_1698405 Oryza
           sativa enolase mRNA, complete cds.
          Length = 446

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD+  + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 3   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSD-YLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I+ ALIG DPT Q+++D  M+  LD T+      K +LGANAILAVS
Sbjct: 62  KGVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVS 121

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA  K++PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 122 LAICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>sp|P25696|ENO_ARATH Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|JQ1187|JQ1187 phosphopyruvate
           hydratase (EC 4.2.1.11) - Arabidopsis
           thaliana>gb:AC006919_1534721 Arabidopsis thaliana
           chromosome 2 clone F1O11 map g6825, complete
           sequence.>gb:ATENGE_1548117 A.thaliana enolase
           gene.>gb:AY150418_1584983 Arabidopsis thaliana enolase
           (2-phospho-D-glycerate hydroylase) (At2g36530) mRNA,
           complete cds.>gb:AF424603_1798942 Arabidopsis thaliana
           At2g36530/F1O11.16 mRNA, complete cds.
          Length = 444

 Score =  192 bits (488), Expect = 6e-48
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AF115857_2474782 Eumeces inexpectatus alpha enolase mRNA,
           partial cds.
          Length = 373

 Score =  191 bits (486), Expect = 1e-47
 Identities = 93/153 (60%), Positives = 124/153 (81%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           VEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GVS+AV+++N+ I+ AL+ 
Sbjct: 1   VEVDLYTDKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGVSKAVEHVNKTIAPALVN 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
              ++  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  KKVSVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
             +++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 NQDVILPVPAFNVINGGSHAGNKLAMQEFMILP 153



>pir|T12341|T12341 phosphopyruvate hydratase (EC 4.2.1.11) - common
           ice plant>gb:MCU09194_1685850 Mesembryanthemum
           crystallinum 2-phospho-D-glycerate hydrolase, enolase,
           mRNA, complete cds.
          Length = 444

 Score =  191 bits (486), Expect = 1e-47
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +2

Query: 332 LKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           +KARQI DSRG PTVE D++ + G + RA+ PSGAS G+YEA+ELRD  K  Y+G GV +
Sbjct: 7   VKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKD-YMGKGVYK 65

Query: 509 AVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMAACK 670
           AVKN+NE I  AL+G DPT Q+ ID  M+  LD T       K +LGANAILAVS+A CK
Sbjct: 66  AVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCK 125

Query: 671 AGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AGA  K++PLY+HIA+++G  N++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 126 AGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>sp|Q43130|ENO_MESCR Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:S79242_1704568
           Pgh1b=2-phospho-D-glycerate hydrolase [Mesembryanthemum
           crystallinum=common ice plant, mRNA Partial, 1683 nt].
          Length = 444

 Score =  191 bits (486), Expect = 1e-47
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 7/172 (4%)
 Frame = +2

Query: 332 LKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNGVSR 508
           +KARQI DSRG PTVE D++ + G + RA+ PSGAS G+YEA+ELRD  K  Y+G GV +
Sbjct: 7   VKARQIYDSRGNPTVEADIHLDDGTYARAAVPSGASTGVYEALELRDGGKD-YMGKGVYK 65

Query: 509 AVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMAACK 670
           AVKN+NE I  AL+G DPT Q+ ID  M+  LD T       K +LGANAILAVS+A CK
Sbjct: 66  AVKNVNEIIGPALVGKDPTQQTAIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLAVCK 125

Query: 671 AGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AGA  K++PLY+HIA+++G  N++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 126 AGAQVKKIPLYQHIAEIAGNKNMVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:AE017343_1755255 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 444

 Score =  191 bits (484), Expect = 2e-47
 Identities = 105/174 (60%), Positives = 131/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGT-YLG 493
           SV+TK+ ARQI DSRG PTVEVDLYT KG+FRA  PSGAS G +EA+ELR  DKG+ Y+G
Sbjct: 2   SVVTKVHARQIFDSRGNPTVEVDLYTEKGLFRAEVPSGASTGAHEAVELR--DKGSDYMG 59

Query: 494 NGVSRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAAC 667
            GV +AV+N+N+ I+ ALI   +  T Q +ID  +I LD TE KG+LGANAIL VSMA  
Sbjct: 60  KGVLKAVENVNKVIAPALIDSKLPVTSQKEIDDLLIKLDGTENKGKLGANAILGVSMAVS 119

Query: 668 KAGAAEKEVPLYKHIADLSGKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A AA+K VPLY ++A L+G +   +LPVPAF +I+GG HAGN LA QE M+LP
Sbjct: 120 EAAAADKGVPLYGYLAQLAGVSEPYVLPVPAFNVINGGSHAGNALAFQEFMLLP 173



>gb:SSU85830_1398135 Stephanostomum sp. enolase mRNA, partial cds.
          Length = 169

 Score =  191 bits (484), Expect = 2e-47
 Identities = 98/167 (58%), Positives = 127/167 (76%), Gaps = 2/167 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVD+ T KGMFRA+ PSGAS G++EA+ELRD     Y G GV
Sbjct: 3   IQKIHARQIFDSRGNPTVEVDVTTAKGMFRAAVPSGASTGVHEALELRDKVDKDYWGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV+N+N +I+  LI  G+  T Q++ID  M+ +D T+ K +LGANAIL VS+A CKAG
Sbjct: 63  LKAVENVNSQIAPGLIKSGLPVTSQTEIDGFMLKMDGTDNKEKLGANAILGVSLAVCKAG 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AAEK VPLY++IA L+G ++++LPVPAF +I+GG HAGN LA+ E M
Sbjct: 123 AAEKGVPLYRYIASLAGNSDVVLPVPAFNVINGGSHAGNKLAMHEFM 169



>gb:AY522939_1332960 Centruroides sp. SBH266264
           2-phospho-D-glycerate hydrolase mRNA, partial cds.
          Length = 368

 Score =  191 bits (484), Expect = 2e-47
 Identities = 94/150 (62%), Positives = 115/150 (76%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           DL T KG+FRA+ PSGAS G++EA+E+RD DK  Y+G GV  AV N+N  I+ A++G   
Sbjct: 1   DLTTEKGLFRAAVPSGASTGIHEALEMRDGDKSAYMGKGVKNAVNNVNNVIAPAVVGKQF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           DP  Q++ID  MI LD TE K +LGANAIL VS+A CKAGAA K V LYKHIADL+G TN
Sbjct: 61  DPVKQTEIDDFMIALDGTENKSKLGANAILGVSLAVCKAGAAHKGVSLYKHIADLAGNTN 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IVLPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AF152348_1245588 Trypanosoma brucei brucei enolase gene,
           complete cds.
          Length = 429

 Score =  191 bits (484), Expect = 2e-47
 Identities = 97/168 (57%), Positives = 120/168 (71%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+  R++LDSRG PTVEV++ T +G+FR++ PSGAS G+YEA ELRD DK  Y+G G 
Sbjct: 3   IQKVHGREVLDSRGNPTVEVEVTTERGVFRSAVPSGASTGVYEACELRDGDKKRYVGKGC 62

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
            +AVKN+NE I  ALIG D   Q ++D  M+ LD T  KG+LGANAIL  SMA  KA AA
Sbjct: 63  LQAVKNVNEVIGPALIGRDELKQEELDTLMLRLDGTPNKGKLGANAILGCSMAISKAAAA 122

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            K VPLY+++A L+G   L LPVP F +I+GGKHAGN L  QE MI P
Sbjct: 123 AKGVPLYRYLASLAGTKELRLPVPCFNVINGGKHAGNALPFQEFMIAP 170



>gb:AF115858_2474783 Trachemys scripta alpha enolase mRNA, partial
           cds.
          Length = 373

 Score =  190 bits (483), Expect = 2e-47
 Identities = 94/153 (61%), Positives = 122/153 (79%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           VEVDLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GVS+AV ++N+ I+ ALI 
Sbjct: 1   VEVDLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFLGKGVSKAVGHVNKTIAPALIS 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  KNINVVEQEKIDKLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 NPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 153



>gb:AF115855_2474780 Caiman crocodilus alpha enolase mRNA, partial
           cds.
          Length = 373

 Score =  190 bits (483), Expect = 2e-47
 Identities = 93/153 (60%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = +2

Query: 374 VEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG 553
           V VDLYTNKG+FRA+ PSGAS G+YEA+ELRD DK  ++G GVS+AV ++N+ I+ ALI 
Sbjct: 1   VXVDLYTNKGLFRAAVPSGASTGIYEALELRDNDKSRFMGKGVSKAVAHVNKTIAPALIS 60

Query: 554 MDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSG 727
            +  +  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G
Sbjct: 61  KNINVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAG 120

Query: 728 KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 NPEVILPVPAFNVINGGSHAGNKLAMQEFMILP 153



>gb:AY307448_1597835 Brassica rapa enolase mRNA, complete cds.
          Length = 444

 Score =  190 bits (482), Expect = 3e-47
 Identities = 104/177 (58%), Positives = 129/177 (72%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITAVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  A IG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNSIIGPASIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGSHAGNKLAMQEFMILP 177



>gb:HSU85826_1386472 Haematolechus sp. enolase mRNA, partial cds.
          Length = 168

 Score =  190 bits (482), Expect = 3e-47
 Identities = 98/167 (58%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVD++T+KG FRA+ PSGAS G++EA+ELRD  K TY+G  V
Sbjct: 3   IKKIHARQIFDSRGNPTVEVDVFTDKGTFRAAVPSGASTGVHEALELRDGGK-TYMGKAV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +A+ N+N+KI+  LI   +  T Q+ ID  MI LD T+ K  LGANAIL VS+A CKAG
Sbjct: 62  LKAISNVNDKIAPELIKANIPVTDQTAIDNFMIKLDGTKNKATLGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AAEK VPLY++IA L+G  +++LPVP+F +I+GG HAGN LA+ E M
Sbjct: 122 AAEKGVPLYRYIASLAGNNDVILPVPSFNVINGGSHAGNKLAMHEFM 168



>gb:AF424654_1798989 Phytophthora infestans clone MY-07-F-01 enolase
           mRNA, complete cds.
          Length = 454

 Score =  189 bits (481), Expect = 4e-47
 Identities = 102/174 (58%), Positives = 128/174 (73%), Gaps = 6/174 (3%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  +KARQI DSRG PTVEVDL T  G +RA+ PSGAS G +EA+E+RD  K  Y+G GV
Sbjct: 4   IVSIKARQIFDSRGNPTVEVDLVTELGEYRAAVPSGASTGEFEALEMRDGGKD-YMGKGV 62

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMAA 664
             AVKN+NE I+ ALIG D T Q++ID+ M++ LD T+      K +LGANAIL VS+A 
Sbjct: 63  LNAVKNVNEIIAPALIGKDVTKQAEIDRFMVEKLDGTQNEWGWYKKKLGANAILGVSLAL 122

Query: 665 CKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           C+AGAA K+ PL++HIADL+G     LPVP+F +I+GG HAGN LA+QE MILP
Sbjct: 123 CRAGAAAKKQPLWQHIADLAGNPTPCLPVPSFNIINGGSHAGNKLAMQEFMILP 176



>gb:AY092986_1574940 Arabidopsis thaliana enolase
           (2-phospho-D-glycerate hydroylase) (At2g36530) mRNA,
           complete cds.
          Length = 444

 Score =  189 bits (481), Expect = 4e-47
 Identities = 104/177 (58%), Positives = 129/177 (72%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDIHTSNGIKVTAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGVSKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+ G HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINDGSHAGNKLAMQEFMILP 177



>sp|P42896|ENO_RICCO Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|S39203|S39203 phosphopyruvate
           hydratase (EC 4.2.1.11) - castor
           bean>gb:RCENOLASE_1703349 R.communis mRNA for enolase.
          Length = 445

 Score =  188 bits (478), Expect = 9e-47
 Identities = 104/175 (59%), Positives = 128/175 (73%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  ++ARQI DSRG PTVE D+  + G + RA+ PSGAS G+YEA+ELRD     YLG G
Sbjct: 5   IVSVRARQIFDSRGNPTVEADIKLSDGHLARAAVPSGASTGIYEALELRDGGSD-YLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVSMA 661
           VS+AV+N+N  I  ALIG DPT Q+ +D  M+ +LD T       K +LGANAILAVS+A
Sbjct: 64  VSKAVENVNSIIGPALIGKDPTEQTALDNFMVQELDGTVNEWGWCKQKLGANAILAVSLA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K +PLYKHIA+L+G  NL+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 LCKAGAHVKGIPLYKHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:AE016959_1021115 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC131375_1741011
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNAb0015J03, complete
           sequence.>gb:AE017061_1750934 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 15 of 77 of the
           complete sequence.
          Length = 428

 Score =  187 bits (476), Expect = 2e-46
 Identities = 105/178 (58%), Positives = 131/178 (73%), Gaps = 8/178 (4%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  +KARQI DSRG PTVEVD+  + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 3   ATIVSVKARQIFDSRGNPTVEVDVCCSDGTFARAAVPSGASTGVYEALELRDGGSD-YLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I+ ALIG DPT Q+++D  M+  LD T+      K +LGANAILAVS
Sbjct: 62  KGVSKAVDNVNSVIAPALIGKDPTSQAELDNFMVQQLDGTKNEWGWCKQKLGANAILAVS 121

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQ-EIMILP 826
           +A CKAGA  K++PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+Q E MILP
Sbjct: 122 LAICKAGAIIKKIPLYQHIANLAGNKQLVLPVPAFNVINGGSHAGNKLAMQAEFMILP 179



>gb:SZU85832_1398320 Stylochus zebra enolase mRNA, partial cds.
          Length = 168

 Score =  187 bits (475), Expect = 2e-46
 Identities = 98/167 (58%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+  RQI DSRG PTVEVD+ T KGMFRA+ PSGAS G++EA+E+RD  K  Y+G GV
Sbjct: 3   IKKIHGRQIFDSRGNPTVEVDITTEKGMFRAAVPSGASTGVHEALEMRDKAK-EYMGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N  I  ALI  G     Q  ID  M++LD TE K +LGANAIL VS+A  KAG
Sbjct: 62  LNAVNNVNNVIGPALIAKGFSVVEQENIDNFMLELDGTENKAKLGANAILGVSLAVLKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AA+K  PLY+HIADL+G   ++LPVPAF +I+GG HAGN LA+ E M
Sbjct: 122 AAQKGTPLYRHIADLAGNNEVILPVPAFNVINGGSHAGNKLAMHEFM 168



>gb:CCU85831_1359529 Cerebratulus cf. lacteus enolase mRNA, partial
           cds.
          Length = 168

 Score =  187 bits (475), Expect = 2e-46
 Identities = 94/167 (56%), Positives = 121/167 (72%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           S ITK+ ARQI DSRG PTVEV++ T +G FRA+ PSGAS G+YEA+ELRD DK  + G 
Sbjct: 2   STITKVHARQIYDSRGNPTVEVEVTTGQGTFRAAVPSGASTGIYEALELRDKDKAVHHGK 61

Query: 497 GVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           GV+ AV N+   +  A+ GM    Q+ +D+ M+ LD ++ K + GANAIL VS+A CKAG
Sbjct: 62  GVNTAVANVINSLGPAVKGMVVKEQTAVDEKMLTLDGSDNKSKFGANAILGVSLAVCKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AA K VPLY+HIADL+    ++LPVPAF +I+GG HAGN LA+ E M
Sbjct: 122 AAAKGVPLYRHIADLAENKKVVLPVPAFNVINGGSHAGNKLAMHEFM 168



>gb:AY522934_1332955 Artemia sp. SBH266677 2-phospho-D-glycerate
           hydrolase mRNA, partial cds.
          Length = 368

 Score =  187 bits (475), Expect = 2e-46
 Identities = 94/150 (62%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GM 556
           DL T +G+FRA+ PSGAS G+YEA+ELRD  K  Y G GV +A++N+NE I+ ALI  G+
Sbjct: 1   DLVTEQGLFRAAVPSGASTGIYEALELRDGVKAEYHGKGVFKAIRNVNEIIAPALIAKGL 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           D T Q QIDQ M+DLD T  K +LGANAIL VS+AACKAGA +K VPLY+HIADL+G   
Sbjct: 61  DVTQQEQIDQFMLDLDGTPNKEKLGANAILGVSLAACKAGAKQKGVPLYRHIADLAGTPE 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LP PAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IILPTPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AF353515_1264906 Eimeria tenella enolase mRNA, complete cds.
          Length = 445

 Score =  187 bits (475), Expect = 2e-46
 Identities = 98/176 (55%), Positives = 131/176 (74%), Gaps = 8/176 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I ++KAR+ILDSRG PTVEVDL T +G FRA+ PSGAS G+YEA+ELRD DK  Y G GV
Sbjct: 4   IVEVKAREILDSRGNPTVEVDLKTEQGCFRAAVPSGASTGIYEALELRDGDKTRYNGKGV 63

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTE-----KKGELGANAILAVSMAA 664
            +AV+N+N+ ++ AL+G D   Q+ +D+ M+ +LD ++      K  LGANAILAVSMA 
Sbjct: 64  LKAVENVNKVLAPALVGKDCREQAALDRLMVEELDGSKNEWGWSKSVLGANAILAVSMAL 123

Query: 665 CKAGAAEKEVPLYKHIADLSG--KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           C+AGAA K +PLYK++A L+G      +LPVP F +++GGKHAGN+LA+QE M+ P
Sbjct: 124 CRAGAAAKGIPLYKYVAQLAGHEAPEFVLPVPCFNVLNGGKHAGNSLAMQEFMVAP 179



>gb:AF258670_1256778 Tomocerus sp. 'Tom' enolase mRNA, partial cds.
          Length = 383

 Score =  187 bits (475), Expect = 2e-46
 Identities = 94/150 (62%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           DL T+KG+FRA+ PSGAS G+YEA+ELRD DK  Y G GV++AV NIN+ I+ AL+G  +
Sbjct: 1   DLTTDKGLFRAAVPSGASTGIYEALELRDNDKANYHGKGVTKAVDNINKIITPALLGQNL 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           D T Q  ID  M+ LD TE K +LGANAIL VSMA C+AGAAEK +PLYK+IA+L+G  N
Sbjct: 61  DVTKQKDIDDFMLKLDGTENKDKLGANAILGVSMAVCRAGAAEKGIPLYKYIAELAGNPN 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MI P
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMIFP 150



>gb:AY307449_1597836 Brassica napus enolase mRNA, complete cds.
          Length = 444

 Score =  187 bits (474), Expect = 3e-46
 Identities = 103/177 (58%), Positives = 128/177 (72%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLG 493
           + IT +KARQI DSRG PTVEVD++T+ G+   A+ PSGAS G+YEA+ LRD     YLG
Sbjct: 2   ATITVVKARQIFDSRGNPTVEVDVHTSSGVKVTAAVPSGASTGIYEALGLRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVS 655
            G S+AV N+N  I  ALIG DPT Q+ ID  M+ +LD T+      K +LGANAILAVS
Sbjct: 61  KGASKAVGNVNNIIGPALIGKDPTQQTAIDNFMVHELDGTQNEWGWCKQKLGANAILAVS 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA    +PLYKHIA+L+G   ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 LAVCKAGAVVSGIPLYKHIANLAGNPKIVLPVPAFNVINGGLHAGNKLAMQEFMILP 177



>gb:AY496909_1609129 Glycine max enolase mRNA, complete cds.
          Length = 444

 Score =  186 bits (473), Expect = 4e-46
 Identities = 103/177 (58%), Positives = 126/177 (71%), Gaps = 7/177 (3%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  + ARQI DSRG PTVEVDL  + G F RA+ PSGAS G+YEA+ELRD     YLG
Sbjct: 2   ATIVSINARQIFDSRGNPTVEVDLTCSDGTFARAAVPSGASTGIYEALELRDGGSD-YLG 60

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVS 655
            GVS+AV N+N  I  ALIG DPT Q+ ID  M+  LD T       K +LGANAILAV 
Sbjct: 61  KGVSKAVDNVNTVIGPALIGKDPTEQTAIDNLMVQQLDGTVNEWGWCKQKLGANAILAVF 120

Query: 656 MAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A CKAGA+  ++PLYKHIA+++G   L+LPVPAF +I+GG HAGN LA+QE M+LP
Sbjct: 121 LAVCKAGASVLKIPLYKHIANIAGNKKLVLPVPAFNVINGGSHAGNKLAMQEFMVLP 177



>gb:AY522932_1332953 Phormictopus sp. SBH266263
           2-phospho-D-glycerate hydrolase mRNA, partial cds.
          Length = 368

 Score =  186 bits (471), Expect = 6e-46
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GM 556
           D+ T KG+FRA+ PSGAS G+YEA+ELRD DK +Y G  V +A+ N+N +I+ ALI   +
Sbjct: 1   DVTTEKGLFRAAVPSGASTGIYEALELRDGDKSSYHGKSVRKAIDNVNTQIAPALIQKNI 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
            PT Q+QID+ MI LD TE K + GANAIL VS+A CKAGAA K VPLYKHIA+L+G  +
Sbjct: 61  SPTEQTQIDEMMIALDGTENKSKFGANAILGVSLAVCKAGAAHKGVPLYKHIAELAGNKD 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AF123457_1242904 Toxoplasma gondii enolase (ENO2) mRNA, complete
           cds.>gb:AY155668_1304766 Toxoplasma gondii strain PLK
           enolase 2 (ENO2) and enolase 1 (ENO1) genes, complete
           cds.
          Length = 444

 Score =  186 bits (471), Expect = 6e-46
 Identities = 101/176 (57%), Positives = 129/176 (73%), Gaps = 8/176 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQILDSRG PTVEVDL T+ G FRA+ PSGAS G+YEA+ELRD D+  ++G GV
Sbjct: 4   IKDITARQILDSRGNPTVEVDLLTDGGCFRAAVPSGASTGIYEALELRDKDQTKFMGKGV 63

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMI-DLDKTEK-----KGELGANAILAVSMAA 664
            +AV+NI++ I  ALIG DP  Q  ID+ M+ +LD T+      K +LGANAILAVSMA 
Sbjct: 64  MKAVENIHKIIKPALIGKDPCDQKGIDKLMVEELDGTKNEWGWCKSKLGANAILAVSMAC 123

Query: 665 CKAGAAEKEVPLYKHIADLSGK--TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           C+AGAA K +PLYK+IA L+G     +++PVP F +I+GG HAGN +A+QE MI P
Sbjct: 124 CRAGAAAKGMPLYKYIATLAGNPTDKMVMPVPFFNVINGGSHAGNKVAMQEFMIAP 179



>gb:AP003526_1830451 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0548D03.>gb:AP004234_1839094 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0001H02.
          Length = 446

 Score =  185 bits (470), Expect = 8e-46
 Identities = 104/175 (59%), Positives = 124/175 (70%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +KARQI DSRG PTVEVD+  + G F R + PSGAS G+YEA+ELRD     YLG G
Sbjct: 5   IQSVKARQIFDSRGNPTVEVDVGLSDGSFARGAVPSGASTGIYEALELRDGGSD-YLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMA 661
           V +AV N+N  I  ALIG DPT Q  ID  M+  LD T       K +LGANAILAVS+A
Sbjct: 64  VLKAVSNVNTIIGPALIGKDPTEQVDIDNFMVQQLDGTSNNWGWCKQKLGANAILAVSLA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K++PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>pir|I50026|I50026 phosphopyruvate hydratase (EC 4.2.1.11) alpha -
           American alligator (fragment)
          Length = 395

 Score =  185 bits (470), Expect = 8e-46
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDP 562
           DLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GVS+AV ++N+ I+ ALI  + 
Sbjct: 1   DLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVAHVNKTIAPALISKNI 60

Query: 563 TL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           ++  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G   
Sbjct: 61  SVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPE 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>sp|P42897|ENO_ALLMI Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase)
           (Fragment).>gb:ALLALENOLA_2504997 Alligator
           mississippiensis alpha-enolase mRNA, partial cds.
          Length = 395

 Score =  185 bits (470), Expect = 8e-46
 Identities = 90/150 (60%), Positives = 120/150 (80%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDP 562
           DLYT+KG+FRA+ PSGAS G+YEA+ELRD DK  ++G GVS+AV ++N+ I+ ALI  + 
Sbjct: 1   DLYTSKGLFRAAVPSGASTGIYEALELRDNDKTRFMGKGVSKAVAHVNKTIAPALISKNI 60

Query: 563 TL--QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           ++  Q +ID+ M+++D +E K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G   
Sbjct: 61  SVVEQEKIDRLMLEMDGSENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPE 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>sp|P26301|ENO1_MAIZE Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 1) (2-phospho- D-glycerate hydro-lyase
           1).>pir|S16257|S16257 phosphopyruvate hydratase (EC
           4.2.1.11) - maize>gb:ZMENOLA_1731837 Maize mRNA for
           enolase (2-phospho-D-glycerate hydrolase).
          Length = 446

 Score =  185 bits (470), Expect = 8e-46
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           IT +KARQI DSRG PTVEVD+  + G + R + PSGAS G+YEA+ELRD     YLG G
Sbjct: 5   ITWVKARQIFDSRGNPTVEVDVGLSDGSYARGAVPSGASTGIYEALELRDGGSD-YLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMA 661
           V +AV N+N  I  A++G DPT Q +ID  M+  LD T       K +LGANAILAVS+A
Sbjct: 64  VLKAVSNVNNIIGPAIVGKDPTEQVEIDNFMVQQLDGTSNEWGWCKQKLGANAILAVSLA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K++PLY+HIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 VCKAGAMVKKIPLYQHIANLAGNKTLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:LMFP1408_1388739 Leishmania major Friedlin chromosome 14 PAC
           P1408.
          Length = 429

 Score =  185 bits (469), Expect = 1e-45
 Identities = 93/168 (55%), Positives = 124/168 (73%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR++LDSRG PTVEV+L T  G+FR++ PSGAS G++EA ELRD DK  Y G G 
Sbjct: 3   IRKVYAREVLDSRGNPTVEVELMTEAGVFRSAVPSGASTGVHEACELRDGDKARYCGAGC 62

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
           ++AVKN+NE ++ AL+G + + Q+ +D+ M +LD T+ K +LGANAIL  SMA  KA AA
Sbjct: 63  TQAVKNVNEILAPALVGKEESDQAGLDKMMCELDGTKNKSKLGANAILGCSMAISKAAAA 122

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +  VPLY++IA L+G  ++ LPVP F +I+GGKHAGN L  QE MI P
Sbjct: 123 KAGVPLYRYIASLAGTKDIRLPVPCFNVINGGKHAGNILPFQEFMIAP 170



>sp|P42894|ENO_NEOFR Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:NFENOL_1690897 N.frontalis enolase
           gene.
          Length = 436

 Score =  184 bits (468), Expect = 1e-45
 Identities = 94/171 (54%), Positives = 128/171 (74%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ ARQI DSRG PTVEV++ T+KG+FRA+ PSGAS G++EA+ELRD  K  Y+G GV
Sbjct: 3   ITKVHARQIFDSRGNPTVEVEVTTDKGLFRAAVPSGASTGVHEALELRDGIKADYVGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV+N+N+ I+ AL+   +D   Q  +D  ++ LD T  K +LGANAIL VS+A  +AG
Sbjct: 63  LKAVENVNKTIAPALVAANLDVKNQKAVDDFLLKLDGTPNKSKLGANAILGVSLAVARAG 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K VPLY+H+ +L+G K   +LPVP+  +++GG HAGN LA+QE MILP
Sbjct: 123 AADKGVPLYQHLGELAGNKGPWILPVPSMNVLNGGSHAGNKLAMQEFMILP 173



>gb:AY005162_2507834 Salmo trutta alpha-2 enolase-1 mRNA, partial
           cds.
          Length = 363

 Score =  184 bits (466), Expect = 2e-45
 Identities = 91/147 (61%), Positives = 113/147 (76%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV RAVK+INE ++ AL   +  + 
Sbjct: 1   TKKGLFRAAVPSGASTGIYEALELRDNDKTRYLGKGVKRAVKHINEFLAPALCNQNVNVL 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q ++D+ M+D+D TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G  N +L
Sbjct: 61  EQEKVDKLMLDMDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPNXIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           P PAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PCPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:EGR272111_1676456 Euglena gracilis mRNA for enolase (eno02
           gene).
          Length = 431

 Score =  184 bits (466), Expect = 2e-45
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 1/170 (0%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGN 496
           VI  +KARQILDSRG PTVEVD+  + G+  R + PSGAS G YEA+ELRD DK  YLG 
Sbjct: 3   VIKTVKARQILDSRGNPTVEVDVILDNGLLGRGAVPSGASTGEYEAVELRDGDKAVYLGK 62

Query: 497 GVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           GV ++V+ +N  ++  L+G+DPT Q +ID  M +LD T  KG++GAN IL VSMA C+A 
Sbjct: 63  GVLKSVEAVNTIVAPKLVGLDPTEQLKIDNLMRELDGTPNKGKIGANGILGVSMAVCRAA 122

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K VPLY+HI DL G     +PVP   +I+GGKHA N +  QE M++P
Sbjct: 123 ALVKGVPLYRHIGDLHGNKTFQMPVPMCNIINGGKHADNKIDFQEFMVMP 172



>gb:AE017330_444845 Listeria monocytogenes str. 4b F2365, section 9
           of 10 of the complete genome.>gb:AE017262_1077201
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 430

 Score =  184 bits (466), Expect = 2e-45
 Identities = 95/171 (55%), Positives = 128/171 (74%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S+IT++ AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG
Sbjct: 2   SIITEVYAREVLDSRGNPTVEVEVYTEAGAFGRALVPSGASTGEYEAVELRDGDKARYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+N+N+ I++ +IG D T Q  ID+AMI+LD T  KG+LGANAIL VS+AA +A
Sbjct: 62  KGVLKAVENVNDIIADKIIGFDVTDQIGIDKAMIELDGTPNKGKLGANAILGVSLAAARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E  V LY+++  ++GK   +LPVP   +++GG+HA NN+ VQE M++P
Sbjct: 122 AADELGVHLYEYLGGVNGK---VLPVPMMNILNGGEHADNNVDVQEFMVMP 169



>sp|Q928I3|ENO_LISMO Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|AG1381|AG1381 enolase homolog eno
           [imported] - Listeria monocytogenes  (strain
           EGD-e)>pir|AH1750|AH1750 enolase homolog eno [imported]
           - Listeria innocua (strain Clip11262)>gb:AL591983_536946
           Listeria monocytogenes strain EGD, complete genome
           segment 11/12.>gb:AL596172_539890 Listeria innocua
           Clip11262 complete genome, segment 10/12.
          Length = 430

 Score =  184 bits (466), Expect = 2e-45
 Identities = 95/171 (55%), Positives = 128/171 (74%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S+IT++ AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG
Sbjct: 2   SIITEVYAREVLDSRGNPTVEVEVYTEAGAFGRALVPSGASTGEYEAVELRDGDKARYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+N+N+ I++ +IG D T Q  ID+AMI+LD T  KG+LGANAIL VS+AA +A
Sbjct: 62  KGVLKAVENVNDIIADKIIGFDVTDQIGIDKAMIELDGTPNKGKLGANAILGVSLAAARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E  V LY+++  ++GK   +LPVP   +++GG+HA NN+ VQE M++P
Sbjct: 122 AADELGVHLYEYLGGVNGK---VLPVPMMNILNGGEHADNNVDVQEFMVMP 169



>sp|Q9LEJ0|ENO1_HEVBR Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 1) (2-phospho- D-glycerate hydro-lyase 1)
           (Allergen Hev b 9).>gb:HBR132580_1681586 Hevea
           brasiliensis mRNA for enolase, isoform 1.
          Length = 445

 Score =  183 bits (465), Expect = 3e-45
 Identities = 103/175 (58%), Positives = 126/175 (72%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  ++ARQI DSRG PTVE D+  + G + RA+ PSGAS G+YEA+ELRD     YLG G
Sbjct: 5   IVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPSGASTGIYEALELRDGGSD-YLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMA 661
           VS+AV+N+N  I  AL+G DPT Q  ID  M+  LD T       K +LGANAILAVS+A
Sbjct: 64  VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K +PLY+HIA+L+G  NL+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 VCKAGAHVKGIPLYEHIANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:CR382139_1672627 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 439

 Score =  183 bits (464), Expect = 4e-45
 Identities = 96/172 (55%), Positives = 124/172 (72%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           +TKL AR + DSRG PTVEVDL T+KG+FR+  PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   VTKLFARYVYDSRGNPTVEVDLTTDKGLFRSIVPSGASTGIHEALELRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+NE I+ A +   +D T QS +D  +  LD T  K +LGANAIL VS+A  KA 
Sbjct: 63  TKAVANVNELIAPAFVKANLDVTNQSAVDDFLNKLDGTPNKSKLGANAILGVSLATAKAA 122

Query: 677 AAEKEVPLYKHIADLSG--KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+H+AD+SG  +   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKNVPLYQHLADISGSKQDKFVLPVPFQNVLNGGSHAGGALAFQEFMIVP 174



>gb:AY522931_1332952 Diplopoda sp. SBH266145 2-phospho-D-glycerate
           hydrolase mRNA, partial cds.
          Length = 368

 Score =  183 bits (464), Expect = 4e-45
 Identities = 91/150 (60%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GM 556
           DL T+KG+FRA+ PSGAS G+YEA+ELRD DKG+Y G  V +AV N+N+ I  AL+    
Sbjct: 1   DLVTDKGLFRAAVPSGASTGIYEALELRDNDKGSYHGKSVLKAVSNVNDTIVPALLPKNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           + T Q +ID  M+ LD T+ KG+LGANAIL VS+A CKAGAAEK +P YK+IA+L+G  N
Sbjct: 61  NITNQKEIDDFMLALDGTDNKGKLGANAILGVSLAVCKAGAAEKGIPXYKYIAELAGNDN 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AF051910_1236724 Toxoplasma gondii enolase mRNA, complete
           cds.>gb:AY155668_1304767 Toxoplasma gondii strain PLK
           enolase 2 (ENO2) and enolase 1 (ENO1) genes, complete
           cds.
          Length = 444

 Score =  183 bits (464), Expect = 4e-45
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 8/177 (4%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           VI  + AR+ILDSRG PT+EVD+ T  G+FRA+ PSGAS G+YEA+ELRD D   YLG G
Sbjct: 3   VIKDIVAREILDSRGNPTIEVDVSTEGGVFRAAVPSGASTGIYEALELRDKDPKRYLGKG 62

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTE-----KKGELGANAILAVSMA 661
           V  AV+ + ++I  AL+G DP  Q  ID  M++ LD T+      K +LGANAIL VS+A
Sbjct: 63  VLNAVEIVRQEIKPALLGKDPCDQKGIDMLMVEQLDGTKNEWGYSKSKLGANAILGVSIA 122

Query: 662 ACKAGAAEKEVPLYKHIADLSGKT--NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            C+AGAA K +PLYK+IA L+GKT   +++PVP F +I+GG+HAGN LA+QE +I P
Sbjct: 123 CCRAGAASKGLPLYKYIATLAGKTIDKMVMPVPFFNVINGGEHAGNGLALQEFLIAP 179



>gb:AY005158_2507830 Neoceratodus forsteri beta enolase-1 mRNA,
           partial cds.
          Length = 363

 Score =  182 bits (463), Expect = 5e-45
 Identities = 92/147 (62%), Positives = 114/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV++AV +IN+ I  AL+    ++ 
Sbjct: 1   TAKGLFRAAVPSGASTGIYEALELRDGDKSRYLGKGVTKAVNHINQTIVPALLEKKLSVV 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID  M+ LD TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G T+L+L
Sbjct: 61  DQEKIDTLMLQLDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNTDLIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:AY522938_1332959 Ostracoda sp. SBH266127 2-phospho-D-glycerate
           hydrolase mRNA, partial cds.
          Length = 368

 Score =  182 bits (463), Expect = 5e-45
 Identities = 90/150 (60%), Positives = 118/150 (78%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           DL T KG+FRA+ PSGAS G+YEA+E+RD  K  + G GV+ A+KN+NE I+ ALIG  +
Sbjct: 1   DLVTEKGLFRAAVPSGASTGIYEALEMRDNVKADHHGKGVNNAIKNVNEIIAPALIGKNL 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           DPT Q+ ID+ M++LD TE K +LGANAIL VS+AACKAGA  K +PLY++IA+L+G  +
Sbjct: 61  DPTDQAGIDKFMLELDGTENKSKLGANAILGVSLAACKAGAVHKGLPLYRYIAELAGNND 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LP PAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IILPCPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AY522933_1332954 Limulus polyphemus 2-phospho-D-glycerate
           hydrolase mRNA, partial cds.
          Length = 368

 Score =  182 bits (463), Expect = 5e-45
 Identities = 91/150 (60%), Positives = 115/150 (76%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           DL T+KGMFRA+ PSGAS G+YEA+ELRD DK  Y G  V +AV N+N  I+ AL+    
Sbjct: 1   DLTTDKGMFRAAVPSGASTGIYEALELRDGDKTKYHGKSVGKAVDNVNSIIAPALLAKNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           + T Q +ID+ M+ LD TE K +LGAN+IL VS+A CKAGAA+K VPLY+HIADL+G  +
Sbjct: 61  EATQQGEIDEFMLSLDGTENKAKLGANSILGVSLAVCKAGAAQKSVPLYRHIADLAGYGD 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>sp|Q9LEI9|ENO2_HEVBR Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 2) (2-phospho- D-glycerate hydro-lyase 2)
           (Allergen Hev b 9).>gb:HBR132581_1681587 Hevea
           brasiliensis mRNA for enolase, isoform 2.
          Length = 445

 Score =  182 bits (463), Expect = 5e-45
 Identities = 102/175 (58%), Positives = 125/175 (71%), Gaps = 7/175 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  ++ARQI DSRG PTVE D+  + G + RA+ P GAS G+YEA+ELRD     YLG G
Sbjct: 5   IVSVRARQIFDSRGNPTVEADVKLSDGYLARAAVPRGASTGIYEALELRDGGSD-YLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMID-LDKTEK-----KGELGANAILAVSMA 661
           VS+AV+N+N  I  AL+G DPT Q  ID  M+  LD T       K +LGANAILAVS+A
Sbjct: 64  VSKAVENVNIIIGPALVGKDPTDQVGIDNFMVQQLDGTVNEWGWCKQKLGANAILAVSLA 123

Query: 662 ACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            CKAGA  K +PLYKH+A+L+G  NL+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 124 VCKAGAHVKGIPLYKHVANLAGNKNLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:AY615333_1618127 Heterocapsa triquetra enolase 2 mRNA, partial
           cds.
          Length = 430

 Score =  182 bits (462), Expect = 7e-45
 Identities = 97/171 (56%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLGN 496
           +I  L AR+ILDSRG PTVEVDL T  G+  RA+ PSGAS G++EA ELRD DKG YLG 
Sbjct: 1   MIKSLFAREILDSRGNPTVEVDLVTESGISVRAAVPSGASTGIHEACELRDGDKGRYLGK 60

Query: 497 GVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           GV +AV+ +N  ++ AL G D + Q  +D  M +LD T  KG+LGANAIL VS+AA KA 
Sbjct: 61  GVKKAVEAVNTVLASALKGADVSEQKALDAKMCELDGTPNKGKLGANAILGVSLAAAKAA 120

Query: 677 AAEKEVPLYKHIADLSGKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A  K VPLYKH  DL+G    ++LPVP F +++GG HAGN LA QE  I+P
Sbjct: 121 AEAKGVPLYKHFGDLAGNPGPVVLPVPCFNVVNGGSHAGNKLAFQEYFIIP 171



>gb:AY005154_2507826 Latimeria chalumnae alpha enolase-1 mRNA,
           partial cds.
          Length = 363

 Score =  181 bits (460), Expect = 1e-44
 Identities = 89/147 (60%), Positives = 114/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG+FRA+ PSGAS G+YEA+ELRDADK  +LG GVSRAVK +NE +  AL   +  + 
Sbjct: 1   TKKGLFRAAVPSGASTGIYEALELRDADKTRFLGKGVSRAVKYVNEFLGPALCNQNVNVV 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID+ ++++D T  K + GANAIL VS+A CKAGAAEK+VPLY+HIADL+G   ++L
Sbjct: 61  EQEKIDKLLLEMDGTANKSKFGANAILGVSLAVCKAGAAEKDVPLYRHIADLAGNPEVIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:AF480465_1275304 Clonorchis sinensis enolase mRNA, complete cds.
          Length = 437

 Score =  181 bits (460), Expect = 1e-44
 Identities = 99/171 (57%), Positives = 126/171 (73%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+  RQILDSRG PTVEVDL T KG+FRA+ PSGAS G++EA E+RD+    Y G GV
Sbjct: 3   ILKITGRQILDSRGYPTVEVDLVTRKGLFRAAVPSGASTGIHEANEMRDSGP-EYHGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMI-DLDKTEKKGELGANAILAVSMAACKA 673
            +AV N+N+ I+ ALI   +  T Q  ID+ M+ +LD T+ K  LGANAILAVS+A  KA
Sbjct: 62  MKAVNNVNKIIAPALIKKNLCVTEQHAIDEFMVTELDGTKNKTHLGANAILAVSLAVLKA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           GAAEK +P+Y+ +A+L+G   + LPVPAF +++GGKHAGN LA QE MILP
Sbjct: 122 GAAEKNLPVYRWVANLAGNEKVTLPVPAFNVLNGGKHAGNRLAFQEFMILP 172



>sp|Q43321|ENO_ALNGL Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AGPGH1_1811039 A.glutinosa mRNA for
           enolase.
          Length = 440

 Score =  181 bits (460), Expect = 1e-44
 Identities = 103/176 (58%), Positives = 126/176 (71%), Gaps = 8/176 (4%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           IT +KARQI DSRG PTVE ++ T  G+  RA+ PSGAS G+YEA+ELRD     YLG G
Sbjct: 4   ITHIKARQIFDSRGNPTVEAEVTTANGVVSRAAVPSGASTGVYEALELRDGGSD-YLGKG 62

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMI--DLDKTEK-----KGELGANAILAVSM 658
           V +AV N+N+ I  ALIG D T Q+ ID   +   LD T       K +LGANAILAVS+
Sbjct: 63  VLKAVDNVNKIIGPALIGKDATEQTAIDIDFMFQQLDGTVNEWGWCKQKLGANAILAVSL 122

Query: 659 AACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A CKAGA+ K++PLYKHIA+L+G   L+LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 123 AVCKAGASVKKIPLYKHIANLAGNPKLVLPVPAFNVINGGSHAGNKLAMQEFMILP 178



>gb:AF348937_1790165 Scenedesmus rubescens enolase (eno) gene,
           partial cds.
          Length = 140

 Score =  181 bits (459), Expect = 1e-44
 Identities = 89/138 (64%), Positives = 111/138 (80%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTLQ 571
           T KG FRA+ PSGAS G++EA+ELRD DK  ++G GV++AV N+N  I+ AL+G DPT Q
Sbjct: 3   TYKGTFRAAVPSGASTGIHEAVELRDGDKSQWMGKGVAKAVGNVNNDIAPALLGKDPTQQ 62

Query: 572 SQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLLPV 751
            +ID AMI LD TE KG+LGANAILAVSMA  KAGAAEK VPLYK+IA L+G + L+LPV
Sbjct: 63  KEIDDAMIALDGTENKGKLGANAILAVSMAVAKAGAAEKGVPLYKYIAQLAGNSKLVLPV 122

Query: 752 PAFTLISGGKHAGNNLAV 805
           P+F +I+GG+HAGN LA+
Sbjct: 123 PSFNVINGGEHAGNGLAM 140



>gb:AY430422_1605985 Prymnesium parvum enolase gene, partial cds.
          Length = 437

 Score =  181 bits (459), Expect = 1e-44
 Identities = 96/164 (58%), Positives = 119/164 (72%), Gaps = 9/164 (5%)
 Frame = +2

Query: 362 GIPTVEVDLYTNKGM-FRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKIS 538
           G PTVEVDL T KG  +RA+ PSGAS G+YEA+E+RD DK  Y+G GVS+AV N+N  I 
Sbjct: 2   GNPTVEVDLITAKGQTYRAAVPSGASTGIYEALEMRDGDKSMYMGKGVSKAVHNVNTIIG 61

Query: 539 EALIGMDPTLQSQIDQAMI-DLDKTE-----KKGELGANAILAVSMAACKAGAAEKEVPL 700
            AL+GMDP  Q +ID  M+  LD ++      K +LGANAIL VSMA CKAGAA K +PL
Sbjct: 62  PALVGMDPVQQKEIDDKMVKTLDGSKNDWGWSKSKLGANAILGVSMAVCKAGAASKGIPL 121

Query: 701 YKHIADLSGK--TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           YKHIA+L+G     + +PVP+F +I+GG HAGN LA+QE MILP
Sbjct: 122 YKHIAELAGNPTDKMYMPVPSFNVINGGSHAGNKLAMQEFMILP 165



>sp|Q870B9|ENO_RHORB Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase)
           (Allergen Rho m 1).>gb:AF382946_1793878 Rhodotorula
           mucilaginosa enolase mRNA, complete cds.
          Length = 439

 Score =  181 bits (459), Expect = 1e-44
 Identities = 95/172 (55%), Positives = 127/172 (73%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ +R + DSRG PTVEV+L T KG FR+  PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   ISKIHSRYVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N+ I+ ALI   +D   Q++ID+ ++ LD T  K +LGANAIL VS+AA KAG
Sbjct: 63  LKAVANVNDTIAPALIEANIDVADQAKIDEFLLKLDGTPNKAKLGANAILGVSLAAAKAG 122

Query: 677 AAEKEVPLYKHIADLS--GKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K+VPLYKHIAD+S   +   +LPVP   +++GG HAG +LA QE MI+P
Sbjct: 123 AAQKDVPLYKHIADISKAKEGKFVLPVPFQNVLNGGSHAGGDLAFQEFMIVP 174



>gb:AY430424_1605987 Heterocapsa triquetra enolase gene, partial
           cds.
          Length = 434

 Score =  181 bits (458), Expect = 2e-44
 Identities = 95/168 (56%), Positives = 119/168 (70%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ ARQ+ DSRG PTVEV+L T KG+FR+  PSGAS G  EA ELRD  K  + G GV
Sbjct: 3   ISKIHARQVFDSRGNPTVEVELTTEKGVFRSIVPSGASTGENEACELRDGGK-EFHGKGV 61

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
             AV+N+   I+ ALIG D   Q  ID+ M++LD TE K +LGANAIL VSMA C+AGAA
Sbjct: 62  RDAVENVKTIIAPALIGKDVCDQEGIDKIMLELDGTENKSKLGANAILGVSMAVCRAGAA 121

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            K VPLY+HI  L+G   +++PVP F +I+GG HAGN LA QE  ++P
Sbjct: 122 AKGVPLYQHINSLAGSPKMVMPVPCFNVINGGVHAGNYLAFQEFFLIP 169



>sp|Q8ENP5|ENO_OCEIH Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:BA000028_696821 Oceanobacillus
           iheyensis HTE831 DNA, complete genome.
          Length = 429

 Score =  181 bits (458), Expect = 2e-44
 Identities = 94/169 (55%), Positives = 120/169 (71%), Gaps = 1/169 (0%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           IT + AR++LDSRG PT+EV+++T  G F  A  PSGAS G YEA+ELRD DK  YLG G
Sbjct: 4   ITDVYAREVLDSRGNPTIEVEIFTESGAFGSAIVPSGASTGEYEAVELRDGDKDRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V +AV+N+N+ I+  LIG+D T Q+ ID  MIDLD TE KG+LGANAIL VSMAA  A A
Sbjct: 64  VQKAVENVNDLIAPELIGIDVTRQNIIDALMIDLDGTENKGKLGANAILGVSMAAAHAAA 123

Query: 680 AEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              EVPLY ++   + KT   LP P   +++GG+HA NN+ +QE MI+P
Sbjct: 124 NYLEVPLYNYLGGFNAKT---LPTPMMNILNGGEHADNNVDIQEFMIMP 169



>gb:AY005157_2507829 Lepidosiren paradoxa beta enolase-1 mRNA,
           partial cds.
          Length = 363

 Score =  180 bits (457), Expect = 3e-44
 Identities = 91/147 (61%), Positives = 113/147 (76%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--MDPT 565
           T+KG+FRA+ PSGAS G+YEA+ELRD DK  YLG GV++AV +IN+ I+  L+   +   
Sbjct: 1   TDKGLFRAAVPSGASTGIYEALELRDGDKSRYLGKGVTQAVDHINKTIAPELLKHKLSVV 60

Query: 566 LQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID+ MI LD TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G   L+L
Sbjct: 61  EQEKIDKVMIQLDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNAALVL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:CR382121_1654663 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.>gb:AJ586240_1811757 Kluyveromyces lactis eno
           gene for enolase, sub-strain 2359/152.
          Length = 437

 Score =  180 bits (457), Expect = 3e-44
 Identities = 97/172 (56%), Positives = 123/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR + DSRG PTVEV+L T KG FR+  PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   ISKVYARSVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVHEALELRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N  I+ AL+   +D T Q Q+D  ++ LD T  K +LGANAIL VS+AA KAG
Sbjct: 63  LTAVSNVNNIIAPALVKANVDVTNQQQVDDLLLSLDGTANKSKLGANAILGVSLAASKAG 122

Query: 677 AAEKEVPLYKHIADLSG-KTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA K VPLY+H+ADL+G KT   +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAAKNVPLYQHLADLAGAKTQPFVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>gb:AF258665_1256773 Limulus polyphemus isolate Lpo23_344 enolase
           mRNA, partial cds.
          Length = 321

 Score =  180 bits (457), Expect = 3e-44
 Identities = 91/150 (60%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GM 556
           DL T+KGMFRA+ PSGAS G+YEA+ELRD DK  Y G  V +AV N+N  I+ AL     
Sbjct: 1   DLTTDKGMFRAAVPSGASTGIYEALELRDGDKTKYHGKSVGKAVDNVNSIIAPALWPKNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           + T Q +ID+ M+ LD TE K +LGAN+IL VS+A CKAGAA+K VPLY+HIADL+G  +
Sbjct: 61  EATQQGEIDEFMLSLDGTENKAKLGANSILGVSLAVCKAGAAQKXVPLYRHIADLAGYGD 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:BACTPIPMEN_746590 Bacillus subtilis phosphoglycerate kinase
           (pgk) gene, partial cds, triose phosphate isomerase
           (tpi), phosphoglycerate mutase (pgm) and enolase (eno)
           genes, complete cds.
          Length = 430

 Score =  180 bits (457), Expect = 3e-44
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 1/169 (0%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG G
Sbjct: 4   IVDVYAREVLDSRGNPTVEVEVYTETGAFGRALVPSGASTGQYEAVELRDGDKDRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V  AV N+NE I+  L+G D T Q+ IDQ +I+LD TE KG+LGANAIL VSMA  +A A
Sbjct: 64  VLTAVNNVNEIIAPELLGFDVTEQNAIDQLLIELDGTENKGKLGANAILGVSMACARAAA 123

Query: 680 AEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++PLY+++   + KT   LPVP   +++GG+HA NN+ +QE MI+P
Sbjct: 124 DFLQIPLYQYLGGFNSKT---LPVPMMNIVNGGEHADNNVDIQEFMIMP 169



>sp|Q8PT81|ENO_METMA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AE013533_293166 Methanosarcina mazei
           strain Goe1, section 315 of 379 of the complete
           genome.>gb:AE008384_967275 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 428

 Score =  180 bits (457), Expect = 3e-44
 Identities = 95/168 (56%), Positives = 115/168 (68%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PTVEVD++T KG  RAS PSGAS G  EA+ELRDAD   Y G GV
Sbjct: 15  IQKIHAREILDSRGNPTVEVDVFTPKGFGRASVPSGASTGTNEALELRDADPNRYGGKGV 74

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
             AVKN+N  I + L+G+D   Q +ID+ MI+LD+TE K  LGANAIL VSMA  KA A 
Sbjct: 75  LTAVKNVNTIIQKELLGLDVRNQREIDELMIELDETENKSNLGANAILGVSMAVAKAAAD 134

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              +PLY++     G     LPVP   +++GGKHAGN LA+QE MI P
Sbjct: 135 SLNIPLYRY---FGGSNAFTLPVPTMNVLNGGKHAGNELAIQEFMIQP 179



>sp|Q8KG25|ENO2_CHLTE Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 2) (2-phospho- D-glycerate hydro-lyase
           2).>gb:AE012794_285635 Chlorobium tepidum TLS section 15
           of 194 of the complete genome.>gb:AE006470_932803
           Chlorobium tepidum TLS complete genome.
          Length = 437

 Score =  180 bits (457), Expect = 3e-44
 Identities = 92/170 (54%), Positives = 121/170 (71%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           SVIT++ ARQI+DSRG PTVEVD++T     RA+ PSGAS G++EA+ELRD DK  +LG 
Sbjct: 2   SVITRIHARQIMDSRGNPTVEVDVHTESSFGRAAVPSGASTGVHEAVELRDKDKSVFLGK 61

Query: 497 GVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           GV +AV+N+N  I++AL+GMD T Q  ID  +I+LD T  K +LGANAIL VS+A  KAG
Sbjct: 62  GVLKAVENVNTLINDALLGMDVTEQEAIDAKLIELDGTPNKSKLGANAILGVSLACAKAG 121

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A    +PLY++I   + KT   LPVP   +++GG HA N +  QE MI+P
Sbjct: 122 AEYSALPLYRYIGGTTAKT---LPVPMMNVLNGGAHADNTVDFQEFMIMP 168



>gb:DCU85837_1376805 Dugesia cf. dorotocephala enolase mRNA, partial
           cds.
          Length = 161

 Score =  180 bits (456), Expect = 3e-44
 Identities = 95/159 (59%), Positives = 120/159 (75%), Gaps = 3/159 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           IT++ ARQI DSRG PTVEVDL T KG+FRA+ PSGAS G++EA+ELRD DK  Y G GV
Sbjct: 3   ITRIFARQIFDSRGNPTVEVDLTTAKGLFRAAVPSGASTGVHEALELRDNDKHNYHGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMI-DLDKTEKKGELGANAILAVSMAACKA 673
            +AV+N+N+ I+  LI  G+  T Q++ID  MI +LD T  K +LGANAIL VS+A  KA
Sbjct: 63  LKAVENVNKIIAPKLIEKGLHVTHQAEIDNFMIKELDGTPNKAKLGANAILGVSLAVAKA 122

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAG 790
           GAAEK +PLY+H  DL+G   ++LPVPAF +I+GG HAG
Sbjct: 123 GAAEKGIPLYRHFCDLAGHKEVILPVPAFNVINGGSHAG 161



>gb:AP006840_567438 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 430

 Score =  180 bits (456), Expect = 3e-44
 Identities = 93/171 (54%), Positives = 121/171 (70%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           + I  + AR++LDSRG PTVEV++    G   RA  PSGAS G +EA+ELRD DK  YLG
Sbjct: 2   TTIVNVHAREVLDSRGNPTVEVEVILASGTTGRAIVPSGASTGQFEAVELRDGDKQRYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV  AV+N+NE I+EA++GMD T Q ++DQAM+ LD T  K +LGANAIL VS+A  +A
Sbjct: 62  KGVLTAVRNVNEVIAEAVVGMDATEQVEVDQAMLALDGTPNKSKLGANAILGVSLATARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            AAE  +PLY+H+  L+ +T   LPVP   +I+GGKHA NN+ +QE MI P
Sbjct: 122 AAAELGIPLYRHVGGLTART---LPVPMMNIINGGKHADNNVDMQEFMIFP 169



>gb:AY005152_2507824 Amia calva alpha enolase-1 mRNA, partial cds.
          Length = 363

 Score =  179 bits (455), Expect = 4e-44
 Identities = 89/147 (60%), Positives = 114/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG+FRA+ PSGAS G+YEA+ELRD DK  Y+G GV +AV++IN+ I+ AL+  + ++ 
Sbjct: 1   TKKGLFRAAVPSGASTGIYEALELRDKDKTRYMGKGVLKAVEHINKTIAPALVSQNVSVI 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID+ MI +D TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G    +L
Sbjct: 61  EQEKIDKLMIAMDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNPEXIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>sp|P37869|ENO_BACSU Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|B69620|B69620 phosphopyruvate
           hydratase (EC 4.2.1.11) [validated] - Bacillus
           subtilis>gb:BSUB0018_755355 Bacillus subtilis complete
           genome (section 18 of 21): from 3414339 to
           3609030.>gb:CQ796253_1453208 Sequence 29 from Patent
           WO2004027092.
          Length = 430

 Score =  179 bits (455), Expect = 4e-44
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 1/169 (0%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG G
Sbjct: 4   IVDVYAREVLDSRGNPTVEVEVYTETGAFGRALVPSGASTGEYEAVELRDGDKDRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V  AV N+NE I+  L+G D T Q+ IDQ +I+LD TE KG+LGANAIL VSMA  +A A
Sbjct: 64  VLTAVNNVNEIIAPELLGFDVTEQNAIDQLLIELDGTENKGKLGANAILGVSMACARAAA 123

Query: 680 AEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++PLY+++   + KT   LPVP   +++GG+HA NN+ +QE MI+P
Sbjct: 124 DFLQIPLYQYLGGFNSKT---LPVPMMNIVNGGEHADNNVDIQEFMIMP 169



>gb:ECU85825_1384245 Echinostoma caproni enolase mRNA, partial cds.
          Length = 170

 Score =  179 bits (454), Expect = 6e-44
 Identities = 93/167 (55%), Positives = 122/167 (73%), Gaps = 2/167 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I  + ARQI DSRG PTVEVD+ T KG+FRA+ PSGAS G++EA+ELRD   G Y+G GV
Sbjct: 5   IKSIHARQIFDSRGNPTVEVDVTTAKGLFRAAVPSGASTGVHEALELRDGPPG-YMGKGV 63

Query: 503 SRAVKNINEKISEAL--IGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N +I++     G+  T Q+ ID  M+ LD T  K +LGANAIL VS+A CKAG
Sbjct: 64  LKAVSNVNNQIAQVFWKCGIPVTDQAGIDNFMLQLDGTPNKEKLGANAILGVSLAVCKAG 123

Query: 677 AAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIM 817
           AAEK +PLYK+IA L+G  ++++ VP+F +I+GG HAGN LA+ E M
Sbjct: 124 AAEKGLPLYKYIASLAGNNDVVIAVPSFNVINGGSHAGNKLAMHEFM 170



>gb:AY430416_1605979 Apodachlya brachynema enolase 2 gene, partial
           cds.
          Length = 388

 Score =  179 bits (453), Expect = 7e-44
 Identities = 92/155 (59%), Positives = 109/155 (70%)
 Frame = +2

Query: 362 GIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISE 541
           G PTVEVDL T  G+FRAS PSGAS G++EA+ELRD     +LG GV +AV N+N+ I  
Sbjct: 2   GNPTVEVDLITQDGLFRASVPSGASTGIHEAVELRDGGS-RFLGKGVLKAVNNVNDIIGP 60

Query: 542 ALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADL 721
            L GMDP  Q  ID  MI LD T+ KG LGANAIL VS+A  KAGA  K VPL++H AD+
Sbjct: 61  KLEGMDPRKQKDIDHLMIQLDGTDNKGRLGANAILGVSLAVAKAGAKSKGVPLFQHFADM 120

Query: 722 SGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
                L+LPVPAF +I+GG HAGN LA QE MI+P
Sbjct: 121 IKNDKLILPVPAFNVINGGSHAGNKLAFQEFMIMP 155



>gb:AY522930_1332951 Lithobius sp. SBH266126 2-phospho-D-glycerate
           hydrolase mRNA, partial cds.
          Length = 368

 Score =  179 bits (453), Expect = 7e-44
 Identities = 88/150 (58%), Positives = 115/150 (76%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           D+ T KG++RA+ PSGAS G+YEA+ELRD DK  + G GV++AV ++N+ I+ A+I    
Sbjct: 1   DVETEKGLYRAAVPSGASTGIYEALELRDGDKSIHHGKGVTKAVGHVNDSIAPAIIAKNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           D T Q +ID+ M+ LD TE K + GANAIL VS+A CKAGAA K VPLYK+IA+L+G  N
Sbjct: 61  DVTSQKEIDEFMLALDGTENKSKFGANAILGVSLAVCKAGAAHKGVPLYKYIAELAGNDN 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IVLPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:CR543861_103920 Acinetobacter sp. ADP1 complete genome.
          Length = 431

 Score =  179 bits (453), Expect = 7e-44
 Identities = 94/171 (54%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  ++AR+ILDSRG PT+E D+    G+  RA APSGAS G  EA+ELRD DK  YLG
Sbjct: 4   SQIVDIRAREILDSRGNPTIEADVILASGVVGRACAPSGASTGSREALELRDGDKARYLG 63

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV  AV N+N  I +AL+G     Q  ID  MI+LD TE K +LGANA LAVS+AA +A
Sbjct: 64  KGVKTAVNNVNTIIRDALVGKSVFEQKDIDNTMIELDGTENKEKLGANATLAVSLAAARA 123

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A EK++PL+++IADL G+T L +PVP   +I+GG HA NN+ +QE MI P
Sbjct: 124 AADEKKIPLFQYIADLRGQTILTMPVPMMNIINGGSHADNNVDIQEFMIEP 174



>gb:AE017333_449444 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859233 Bacillus licheniformis ATCC
           14580, complete genome.>gb:CQ796327_1453245 Sequence 103
           from Patent WO2004027092.
          Length = 430

 Score =  178 bits (452), Expect = 1e-43
 Identities = 93/169 (55%), Positives = 119/169 (70%), Gaps = 1/169 (0%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG G
Sbjct: 4   IVDVYAREVLDSRGNPTVEVEVYTESGAFGRALVPSGASTGEYEAVELRDGDKDRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V  AV N+NE I+  LIG D T Q  ID+ +I+LD TE KG+LGANAIL VSMA  +A A
Sbjct: 64  VLTAVNNVNEIIAPELIGFDVTEQVSIDKLLIELDGTENKGKLGANAILGVSMAVARAAA 123

Query: 680 AEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              ++PLY+++   + KT   LPVP   +++GG+HA NN+ +QE MI+P
Sbjct: 124 DFLQIPLYQYLGGFNSKT---LPVPMMNIVNGGEHADNNVDIQEFMIMP 169



>gb:AE017202_404085 Lactobacillus johnsonii NCC 533, section 3 of 7
           of the complete genome.>gb:AE017198_1122572
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 432

 Score =  178 bits (452), Expect = 1e-43
 Identities = 95/171 (55%), Positives = 123/171 (71%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           SVIT + AR++LDSRG PTVE ++YT  G F RA  PSGAS G +EA+ELRD DK  +LG
Sbjct: 2   SVITDIHAREVLDSRGNPTVEAEVYTELGGFGRAIVPSGASTGEHEAVELRDGDKSRFLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV  AV+N+N +I++A+IG+D T Q  IDQ MIDLD T  KG LGANA+LAVS+A+ +A
Sbjct: 62  QGVLTAVENVNGEIAKAVIGLDVTDQRLIDQTMIDLDGTPNKGRLGANAMLAVSLASARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E  +PLY++   L G    +LP P   +I+GGKHA NN+ +QE MI+P
Sbjct: 122 AADELGLPLYEY---LGGPNAHVLPTPMMNVINGGKHADNNVDIQEFMIMP 169



>gb:AY430423_1605986 Thraustotheca clavata enolase gene, partial
           cds.
          Length = 388

 Score =  178 bits (451), Expect = 1e-43
 Identities = 95/155 (61%), Positives = 109/155 (70%)
 Frame = +2

Query: 362 GIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISE 541
           G PTVEVDL T  G+FRAS PSGAS G++EA ELRD  K  YLG GV++AV N+   I  
Sbjct: 2   GNPTVEVDLTTEHGLFRASVPSGASTGIHEACELRDGGK-RYLGKGVTQAVNNVKNIIGP 60

Query: 542 ALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADL 721
            + GMDPT Q  ID  M +LD TE KG LGANAIL VS+A  KAGA  K VPL++H ADL
Sbjct: 61  KIEGMDPTQQKDIDFLMRELDGTENKGNLGANAILGVSLAVAKAGARSKGVPLFQHFADL 120

Query: 722 SGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
                L+LPVPAF +I+GG HAGN LA QE MILP
Sbjct: 121 IKNDKLVLPVPAFNVINGGSHAGNALAFQEFMILP 155



>sp|Q8TQ79|ENO_METAC Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AE010840_267016 Methanosarcina
           acetivorans str. C2A, section 185 of 534 of the complete
           genome.>gb:AE010299_907575 Methanosarcina acetivorans
           str. C2A, complete genome.
          Length = 429

 Score =  178 bits (451), Expect = 1e-43
 Identities = 93/168 (55%), Positives = 115/168 (68%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ AR+ILDSRG PT+EVD++T KG  RAS PSGAS G  EA+ELRDAD   Y G GV
Sbjct: 16  IQKIHAREILDSRGNPTIEVDVFTPKGFGRASVPSGASTGTNEALELRDADPNRYGGKGV 75

Query: 503 SRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAA 682
             AVKN+N  I + L+G+D   Q +ID+ MI+LD+TE K  LGAN+IL VSMA  KA A 
Sbjct: 76  LTAVKNVNTIIQKELLGLDVRNQREIDELMIELDETENKSNLGANSILGVSMAVAKAAAD 135

Query: 683 EKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
              +PLY++     G     LPVP   +++GGKHAGN LA+QE MI P
Sbjct: 136 SLNMPLYRY---FGGSNAFTLPVPTMNVLNGGKHAGNELAIQEFMIQP 180



>sp|Q9K596|ENO_ENTFA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:EFA401152_135141 Enterococcus faecalis
           eno gene for enolase.>gb:AE016953_365968 Enterococcus
           faecalis V583, section 7 of 11 of the complete
           genome.>gb:AE016830_992456 Enterococcus faecalis V583,
           complete genome.
          Length = 432

 Score =  177 bits (450), Expect = 2e-43
 Identities = 94/171 (54%), Positives = 118/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S+IT + AR++LDSRG PT+EV++YT  G F R   PSGAS G YEA+ELRD DK  YLG
Sbjct: 2   SIITDIYAREVLDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV++AV N+N  I+EA+IG D   Q  ID+AMIDLD T  KG+LGANAIL VS+A  +A
Sbjct: 62  KGVTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIDLDGTPNKGKLGANAILGVSIAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A   EVPLY +   L G    +LP P   +I+GG HA N++  QE MI+P
Sbjct: 122 AADYLEVPLYHY---LGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMP 169



>gb:AE016818_1748439 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 437

 Score =  177 bits (449), Expect = 2e-43
 Identities = 93/172 (54%), Positives = 122/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR + DSRG PTVEV++ T  G FR+  PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   ISKVYARSVYDSRGNPTVEVEVTTENGTFRSIVPSGASTGVHEALELRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+N+ I+ AL+   +D   Q  +D  M+ LD T  K +LGANAIL VSMA  KA 
Sbjct: 63  TKAVSNVNDIIAPALLSANVDVKDQKAVDALMLTLDGTPNKSKLGANAILGVSMAVAKAA 122

Query: 677 AAEKEVPLYKHIADLSGK--TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK+VPLY+H+ADL+G   T  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAEKKVPLYQHLADLAGSSTTPFVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>sp|Q88MF9|ENO_PSEPK Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AE016780_331047 Pseudomonas putida
           KT2440 section 7 of 21 of the complete
           genome.>gb:AE015451_946124 Pseudomonas putida KT2440
           complete genome.
          Length = 429

 Score =  177 bits (449), Expect = 2e-43
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +K R++LDSRG PTVE D+  + G+   A APSGAS G  EA+ELRD DK  YLG G
Sbjct: 4   IVDIKGREVLDSRGNPTVEADVLLDNGIIGSACAPSGASTGSREALELRDGDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V +AV NIN  I + L+G DP+ Q  +D+AMI+LD TE K +LGANAILAVS+AA KA A
Sbjct: 64  VLKAVANINGPIRDLLLGKDPSDQKALDRAMIELDGTENKAKLGANAILAVSLAAAKAAA 123

Query: 680 AEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            ++++PLY HIA+L+G      +PVP   +I+GG+HA NN+ +QE M+ P
Sbjct: 124 QDQDLPLYAHIANLNGTPGQYSMPVPMMNIINGGEHADNNVDIQEFMVQP 173



>gb:AY005153_2507825 Amia calva beta enolase-1 mRNA, partial cds.
          Length = 363

 Score =  177 bits (448), Expect = 3e-43
 Identities = 90/147 (61%), Positives = 110/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +AV +IN+ I   L+    ++ 
Sbjct: 1   TAKGRFRAAVPSGASTGIYEALELRDGDKSRYLGKGVQKAVDHINKDIVPKLLEKKLSVV 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID  M++LD TE K + GANAIL VS+A CKAGAAEK VPLY+HIADL+G   L+L
Sbjct: 61  EQEKIDNFMLELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPLYRHIADLAGNAELIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:CR380955_1651623 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 437

 Score =  177 bits (448), Expect = 3e-43
 Identities = 93/172 (54%), Positives = 123/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  +LG GV
Sbjct: 3   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGIHEALEMRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+ A +   +D   Q  +D  ++ LD T  K +LGANAIL VSMAA +A 
Sbjct: 63  ENAVKNVNDVIAPAFVKANVDIKDQKAVDDLLLSLDGTANKSKLGANAILGVSMAAARAA 122

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+H+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAEKNVPLYQHLADLSDSKTSPFVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>gb:AY005160_2507832 Chiloscyllium punctatum beta enolase-1 mRNA,
           partial cds.
          Length = 363

 Score =  176 bits (447), Expect = 4e-43
 Identities = 90/147 (61%), Positives = 110/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG FRA+ PSGAS G+YEA+ELRD DK  YLG GV +AV+NIN+ I  ALI     + 
Sbjct: 1   TAKGHFRAAVPSGASTGIYEALELRDGDKSRYLGKGVLKAVENINKHIGPALIEKKVNVL 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID+ M+ LD T+ K + GANAIL VS+A CKAGA EK VPLY+HIADL+G  + +L
Sbjct: 61  EQEKIDELMLHLDGTDNKSKFGANAILGVSLAVCKAGAKEKGVPLYRHIADLAGNKDXVL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:HUMENOGA_2030892 Human gamma enolase mRNA, 3' end.
          Length = 408

 Score =  176 bits (447), Expect = 4e-43
 Identities = 87/144 (60%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = +2

Query: 401 GMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMDPTLQS 574
           G+FRA+ PSGAS G+YEA+ELRD DK  YLG GV +AV +IN  I+ ALI  G+    Q 
Sbjct: 3   GLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSGLSVVEQE 62

Query: 575 QIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLLPVP 754
           ++D  M++LD TE K + GANAIL VS+A CKAGAAE+ +PLY+HIA L+G ++L+LPVP
Sbjct: 63  KLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERNLPLYRHIAQLAGNSDLILPVP 122

Query: 755 AFTLISGGKHAGNNLAVQEIMILP 826
           AF +I+GG HAGN LA+QE MILP
Sbjct: 123 AFNVINGGSHAGNKLAMQEFMILP 146



>gb:AY005159_2507831 Chiloscyllium punctatum alpha enolase-1 mRNA,
           partial cds.
          Length = 363

 Score =  176 bits (446), Expect = 5e-43
 Identities = 89/147 (60%), Positives = 110/147 (74%), Gaps = 2/147 (1%)
 Frame = +2

Query: 392 TNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDPTL- 568
           T KG+FRA+ PSGAS G+YEA+ELRD DK  +LG GVSRAVK IN+ +  AL      + 
Sbjct: 1   TGKGLFRAAVPSGASTGIYEALELRDGDKTRFLGKGVSRAVKYINQFLGPALCSQHVNVI 60

Query: 569 -QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLL 745
            Q +ID+ M+ +D TE K + GANAIL VS+A CKAGAAEK VPLY+HI+ L+G T  +L
Sbjct: 61  EQEKIDKLMLAMDGTENKSKYGANAILGVSLAVCKAGAAEKGVPLYRHISHLAGNTQXIL 120

Query: 746 PVPAFTLISGGKHAGNNLAVQEIMILP 826
           PVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 PVPAFNVINGGSHAGNKLAMQEFMILP 147



>gb:AY314788_1598395 Tuber borchii enolase (eno-1) gene, promoter
           region and complete cds.
          Length = 440

 Score =  176 bits (446), Expect = 5e-43
 Identities = 99/173 (57%), Positives = 122/173 (70%), Gaps = 4/173 (2%)
 Frame = +2

Query: 320 VITKLKARQILDSRGIPTVEVDLYT-NKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           +ITK+ AR + DSRG PTVEVDL T + G+ RA  PSGAS G +EAIELRD DK  + G 
Sbjct: 1   MITKIHARSVYDSRGNPTVEVDLTTTDTGLHRAIVPSGASTGQHEAIELRDKDKTKWAGK 60

Query: 497 GVSRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACK 670
           GV +AV+N+N  I+ ALI    D   Q+ ID+ +IDLD T  K +LGANAIL VS+A  K
Sbjct: 61  GVLKAVENVNTIIAPALIKEKFDVKDQATIDKFLIDLDGTPNKAKLGANAILGVSLAVAK 120

Query: 671 AGAAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AGAA K+VPLY H+ADL+G K   +LPVP   +I+GG HAG  LA QE MI+P
Sbjct: 121 AGAAAKKVPLYAHVADLAGTKKPFVLPVPFMNVINGGSHAGGRLAFQEFMIVP 173



>sp|Q886M3|ENO1_PSESM Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 1) (2-phospho- D-glycerate hydro-lyase
           1).>gb:AE016861_350986 Pseudomonas syringae pv. tomato
           str. DC3000 section 6 of 21 of the complete
           genome.>gb:AE016853_1036161 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 428

 Score =  176 bits (446), Expect = 5e-43
 Identities = 92/170 (54%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +K R++LDSRG PTVE D+  + G+   A APSGAS G  EA+ELRD DK  Y+G G
Sbjct: 4   IVDIKGREVLDSRGNPTVEADVLLDNGIIGSACAPSGASTGSREALELRDGDKSRYMGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V +AV NIN  I + L+G DP  Q  +D AMI LD TE K  LGANAILAVS+AA KA A
Sbjct: 64  VLKAVANINGPIRDLLLGKDPVDQKALDHAMIALDATENKASLGANAILAVSLAAAKAAA 123

Query: 680 AEKEVPLYKHIADLSGKTNLL-LPVPAFTLISGGKHAGNNLAVQEIMILP 826
            ++++PLY HIA+L+G   +  +PVP   +I+GG+HA NN+ +QE MI P
Sbjct: 124 QDQDLPLYAHIANLNGTPGVYSMPVPMMNIINGGEHADNNIDIQEFMIQP 173



>gb:YSCENOA_1728862 S.cerevisiae enolase gene (clone peno46) and
           flanks.
          Length = 437

 Score =  176 bits (445), Expect = 6e-43
 Identities = 93/172 (54%), Positives = 123/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  ++G GV
Sbjct: 3   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDGDKSKWMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+ A +   +D   Q  +D  +I LD T  K +LGANAIL VS+AA +A 
Sbjct: 63  LHAVKNVNDVIAPAFVKANIDVKDQKAVDDFLISLDGTANKSKLGANAILGVSLAASRAA 122

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLYKH+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAEKNVPLYKHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>gb:AF258671_1256779 Speleonectes tulumensis isolate Stu23_241
           enolase mRNA, partial cds.
          Length = 219

 Score =  176 bits (445), Expect = 6e-43
 Identities = 88/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGM-- 556
           DL T+KG+FRA+ PSGAS G+YEA+ELRD  KG Y G GV +A+ ++N  I+  L+    
Sbjct: 1   DLVTDKGLFRAAVPSGASTGIYEALELRDNIKGDYHGKGVGKAIGHVNTDIAPKLLAQNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           +PT Q QID+ M+  D T+ K + GANAIL VS+A CKAGAA K VPLY+HIADL+G  +
Sbjct: 61  EPTQQVQIDEFMLKEDGTDNKSKFGANAILGVSLAVCKAGAAAKGVPLYRHIADLAGVGD 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 VILPVPAFNVINGGSHAGNKLAMQEFMILP 150



>pir|S64586|NOBY phosphopyruvate hydratase (EC 4.2.1.11) 1
           [validated] - yeast (Saccharomyces
           cerevisiae)>gb:SCCHRVII_1707033 S.cerevisiae genomic
           sequence from chromosome VII.>gb:SCYGR254W_1712500
           S.cerevisiae chromosome VII reading frame ORF YGR254w.
          Length = 437

 Score =  176 bits (445), Expect = 6e-43
 Identities = 93/172 (54%), Positives = 123/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  ++G GV
Sbjct: 3   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDGDKSKWMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+ A +   +D   Q  +D  +I LD T  K +LGANAIL VS+AA +A 
Sbjct: 63  LHAVKNVNDVIAPAFVKANIDVKDQKAVDDFLISLDGTANKSKLGANAILGVSLAASRAA 122

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLYKH+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAEKNVPLYKHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>sp|P00924|ENO1_YEAST Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 436

 Score =  176 bits (445), Expect = 6e-43
 Identities = 93/172 (54%), Positives = 123/172 (71%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  ++G GV
Sbjct: 2   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDGDKSKWMGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I+ A +   +D   Q  +D  +I LD T  K +LGANAIL VS+AA +A 
Sbjct: 62  LHAVKNVNDVIAPAFVKANIDVKDQKAVDDFLISLDGTANKSKLGANAILGVSLAASRAA 121

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLYKH+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 122 AAEKNVPLYKHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAP 173



>gb:CR380952_1650578 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 438

 Score =  175 bits (444), Expect = 8e-43
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           +TK+ AR + DSRG PTVEV++YT  GMFRA  PSGAS G +EA+ELRD DK  + G GV
Sbjct: 3   VTKVHARTVYDSRGNPTVEVEVYTKDGMFRAIVPSGASTGSHEALELRDGDKSKWEGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+N+ I   LI   +D   Q  ID+ MI LD T+ K +LGANAIL VS+A  +AG
Sbjct: 63  TKAVSNVNDIIGPKLIESKLDVKDQKAIDEFMIKLDGTKNKSKLGANAILGVSLAVARAG 122

Query: 677 AAEKEVPLYKHIADLSG--KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA K VPLY+HIA+L+   K   ++P P F +++GG HAG NLA+QE +I P
Sbjct: 123 AAAKGVPLYQHIAELADMKKEPYVIPCPFFNVLNGGVHAGGNLALQEFLIAP 174



>gb:CR378673_96372 Photobacterium profundum SS9; segment 11/12.
          Length = 433

 Score =  175 bits (444), Expect = 8e-43
 Identities = 93/172 (54%), Positives = 122/172 (70%), Gaps = 2/172 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I K+  R+I+DSRG PTVE +++   G    A+APSGAS G  EA+ELRD DK  +LG
Sbjct: 2   SKIVKVLGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +A++ +N  I+EAL+G D T Q+ IDQ MIDLD TE K + GANAILAVS+A  KA
Sbjct: 62  KGVLKALEAVNGPIAEALLGKDATDQAAIDQVMIDLDGTENKSKFGANAILAVSLANAKA 121

Query: 674 GAAEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           GAA K +PLY+HIA+L+G      +P+P   +I+GG+HA NN+ +QE MI P
Sbjct: 122 GAAAKGMPLYEHIAELNGTAGQFSMPLPMMNIINGGEHADNNVDIQEFMIQP 173



>gb:AY499570_1609606 Cryphonectria parasitica enolase (Eno1) gene,
           complete cds.
          Length = 438

 Score =  175 bits (443), Expect = 1e-42
 Identities = 94/171 (54%), Positives = 119/171 (69%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR + DSRG PTVEVDL T  G+ RA  PSGAS G +EA ELRD DK  +LG GV
Sbjct: 3   ISKIHARYVYDSRGNPTVEVDLVTETGLHRAIVPSGASTGQHEACELRDGDKSKWLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV+N+N  +   LI  G+D   Q+ +D+ +I LD T  K +LGANAIL VS+A  KAG
Sbjct: 63  LKAVENVNTVLGPELIKAGLDVKDQTAVDEFLIKLDGTANKTKLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY H++DL+G K   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKGVPLYAHVSDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173



>sp|Q9HXZ5|ENO_PSEAE Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|H83191|H83191 enolase PA3635
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004783_57871 Pseudomonas aeruginosa PAO1,
           section 344 of 529 of the complete
           genome.>gb:AE004091_971971 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 429

 Score =  175 bits (443), Expect = 1e-42
 Identities = 94/170 (55%), Positives = 116/170 (68%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +K R++LDSRG PTVE D+  + G+   A APSGAS G  EA+ELRD DK  YLG G
Sbjct: 4   IVDIKGREVLDSRGNPTVEADVILDNGIVGSACAPSGASTGSREALELRDGDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V +AV NIN  I + L+G D   Q  +D AMI+LD TE K +LGANAILAVS+AA KA A
Sbjct: 64  VLKAVANINGPIRDLLLGKDAADQKALDHAMIELDGTENKAKLGANAILAVSLAAAKAAA 123

Query: 680 AEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
             K VPLY HIADL+G      +PVP   +I+GG+HA NN+ +QE M+ P
Sbjct: 124 QAKGVPLYAHIADLNGTPGQYSMPVPMMNIINGGEHADNNVDIQEFMVQP 173



>gb:AY522937_1332958 Nereis macrydi 2-phospho-D-glycerate hydrolase
           mRNA, partial cds.
          Length = 368

 Score =  174 bits (442), Expect = 1e-42
 Identities = 87/150 (58%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDP 562
           DL T++G+FRA+ PSGAS G+YEA+ELRD     + G GV +AV+N+N  I+ AL+G   
Sbjct: 1   DLKTDRGLFRAAVPSGASHGIYEALELRDKVASEFHGKGVKKAVENVNMVIAPALVGKSV 60

Query: 563 TLQSQI--DQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
            + +Q+  D+ M+ LD TE K +LGANAIL VS+A CKAGAA+K VPLY+HIADL+G   
Sbjct: 61  NMANQVAVDKIMLXLDGTENKAKLGANAILGVSLAVCKAGAAQKGVPLYRHIADLAGNXX 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            +LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 XVLPVPAFNVINGGSHAGNKLAMQEFMILP 150



>sp|P40370|EN11_SCHPO Enolase 1-1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 1-1) (2- phospho-D-glycerate hydro-lyase
           1-1).>pir|T39737|T39737 enolase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC1815_1719342 S.pombe
           chromosome II cosmid c1815.>gb:YSPPHHY_1731169
           Schizosaccharomyces pombe phosphopyruvate hydratase
           mRNA, complete cds.
          Length = 439

 Score =  174 bits (442), Expect = 1e-42
 Identities = 94/171 (54%), Positives = 124/171 (72%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I K+ ARQI DSRG PTVEVDL T  G+ RA  PSGAS G++EA+E+RD DK  + G GV
Sbjct: 3   IQKVFARQIYDSRGNPTVEVDLTTETGIHRAIVPSGASTGIWEALEMRDGDKTKWGGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV N+N  I+ A++   +D T Q   D+ ++ LD TE K +LGANAIL VSMA C+AG
Sbjct: 63  LKAVGNVNNIIAPAVVKANLDVTDQKAADEFLLKLDGTENKSKLGANAILGVSMAICRAG 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA+K++PL+K+IA+  G K   +LPVP+F +++GG HAG +LA QE MILP
Sbjct: 123 AAQKKLPLWKYIAENFGTKGPYVLPVPSFNVLNGGSHAGGDLAFQEFMILP 173



>sp|Q8EBR0|ENO_SHEON Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 431

 Score =  174 bits (441), Expect = 2e-42
 Identities = 93/170 (54%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLGNG 499
           I  +  R+I+DSRG PTVE +++   G    A+APSGAS G  EA+ELRD DK  YLG G
Sbjct: 4   IINVIGREIMDSRGNPTVEAEVHLEGGFIGMAAAPSGASTGSREALELRDGDKSRYLGKG 63

Query: 500 VSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGA 679
           V  AV N+N  I  ALIG D T Q+++DQ MIDLD TE K +LGANAILAVS+AA KA A
Sbjct: 64  VLTAVANVNGPIRTALIGKDATAQAELDQIMIDLDGTENKDKLGANAILAVSLAAAKAAA 123

Query: 680 AEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A K +PLY HIA+L+G      +PVP   +++GG+HA NN+ +QE M+ P
Sbjct: 124 AFKGMPLYAHIAELNGTPGQYAMPVPMMNILNGGEHADNNVDIQEFMVQP 173



>gb:AY522935_1332956 Daphnia magna 2-phospho-D-glycerate hydrolase
           mRNA, partial cds.
          Length = 368

 Score =  174 bits (440), Expect = 2e-42
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GM 556
           DL T KG+FRA+ PSGAS G++EA+ELRD  K  Y G GV +AV NIN+ I+ AL+    
Sbjct: 1   DLTTEKGLFRAAVPSGASTGIHEALELRDEIKTEYHGKGVKKAVSNINDSIAPALLKESF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
             T Q  ID  MI LD TE K + GANAIL VS+A CKAGAA+K VPLY+HIADL+G   
Sbjct: 61  QVTEQEAIDNFMIKLDGTENKSKFGANAILGVSLAVCKAGAAQKGVPLYRHIADLAGTPE 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LP PAF +I+GG HAGN LA+QE MI P
Sbjct: 121 IILPTPAFNVINGGSHAGNKLAMQEFMIFP 150



>gb:AF375335_1266656 Araucarius minor isolate Cou02 enolase (Eno1ni)
           gene, partial cds.
          Length = 238

 Score =  174 bits (440), Expect = 2e-42
 Identities = 88/149 (59%), Positives = 110/149 (73%), Gaps = 2/149 (1%)
 Frame = +2

Query: 386 LYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMD 559
           L T+ G+FRA+ PSGAS G++EA+ELRD     Y+G GVS+AV+N+N  I   L+    D
Sbjct: 1   LITDLGLFRAAVPSGASTGVHEALELRDEVPDQYMGKGVSKAVENVNVSIGPELVKQDFD 60

Query: 560 PTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNL 739
            T Q +ID  MI LD TE K + GANAIL VS+A CKAGAA++ VPLY+HIADL+G  NL
Sbjct: 61  VTQQEEIDDFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGVPLYRHIADLAGNKNL 120

Query: 740 LLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +LPVPAF +I+GG HA N LA+QE MILP
Sbjct: 121 ILPVPAFNVINGGSHAANKLAMQEFMILP 149



>gb:AF284645_1783088 Aspergillus fumigatus enolase mRNA, complete
           cds.
          Length = 438

 Score =  173 bits (439), Expect = 3e-42
 Identities = 96/171 (56%), Positives = 118/171 (69%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR + DSRG PTVEVD+ T  G+ RA  PSGAS G +EA ELRD DK  + G GV
Sbjct: 3   ISKIHARSVYDSRGNPTVEVDVATETGLHRAIVPSGASTGQHEAHELRDGDKTQWGGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AVKN+NE I  ALI   +D   QS++D+ +  LD T  K  LGANAIL VS+A  KAG
Sbjct: 63  LKAVKNVNETIGPALIKENIDVKDQSKVDEFLNKLDGTANKSNLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY HI+DL+G K   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKGVPLYAHISDLAGTKKPYVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173



>gb:AF258668_1256776 Polyxenus fasciculatus enolase mRNA, partial
           cds.
          Length = 385

 Score =  173 bits (439), Expect = 3e-42
 Identities = 85/152 (55%), Positives = 113/152 (74%), Gaps = 4/152 (2%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIGMDP 562
           DL T +G+FR + PSGAS G+YEA+ELRD DK  + G GV +A+ N+N+ I+ ALI +  
Sbjct: 1   DLTTERGIFRGAVPSGASTGIYEALELRDNDKSVHHGKGVLKAIANVNDIIAPALIDLGK 60

Query: 563 TL----QSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGK 730
            L    Q  ID  ++DLD TE KG+LGANAIL VS+A CKAGAA + +PLY++IA+L+G 
Sbjct: 61  NLEITDQEGIDMFLLDLDATENKGKLGANAILGVSLAVCKAGAAHRGLPLYRYIAELAGN 120

Query: 731 TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           + ++LP PAF +I+GG HAGN LA+QE MILP
Sbjct: 121 SKIILPTPAFNVINGGSHAGNKLAMQEFMILP 152



>sp|P30575|ENO1_CANAL Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|A40624|A40624 phosphopyruvate
           hydratase (EC 4.2.1.11) - yeast (Candida
           albicans)>gb:YSAENO1A_1728109 Candida albicans enolase
           (ENO1) gene, complete cds.>gb:YSAENOLAS_1728110 Candida
           albicans enolase (ENO1) gene, complete
           cds.>gb:YSAENOLASE_1728111 Candida albicans (clone
           lambda-C1.d) enolase mRNA, complete cds.
          Length = 440

 Score =  173 bits (438), Expect = 4e-42
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 4/174 (2%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGN 496
           S  TK+ AR + DSRG PTVEVD  T+KG+FR+  PSGAS G++EA+ELRD DK  +LG 
Sbjct: 2   SYATKIHARYVYDSRGNPTVEVDFTTDKGLFRSIVPSGASTGVHEALELRDGDKSKWLGK 61

Query: 497 GVSRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACK 670
           GV +AV N+N+ I+ ALI   +D   Q++ID+ ++ LD T  K +LGANAIL VS+AA  
Sbjct: 62  GVLKAVANVNDIIAPALIKAKIDVVDQAKIDEFLLSLDGTPNKSKLGANAILGVSLAAAN 121

Query: 671 AGAAEKEVPLYKHIADLSG--KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A AA + +PLYKHIA++S   K   +LPVP   +++GG HAG  LA QE MI P
Sbjct: 122 AAAAAQGIPLYKHIANISNAKKGKFVLPVPFQNVLNGGSHAGGALAFQEFMIAP 175



>gb:CR382132_1665642 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 438

 Score =  172 bits (437), Expect = 5e-42
 Identities = 93/171 (54%), Positives = 120/171 (70%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           + KL AR + DSRG PTVEVDL T  G+FRA  PSGAS G++EA+ELRD D   + G GV
Sbjct: 3   VEKLHARYVYDSRGNPTVEVDLTTQHGLFRAIVPSGASTGVHEALELRDKDASKWGGKGV 62

Query: 503 SRAVKNINEKISEALIG--MDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV+N+NE I+ A+I   +D   Q+  D+ +++LD TE K +LGANAIL VS+AA +AG
Sbjct: 63  LKAVQNVNEIIAPAVIDAKLDVKDQAAFDKFLLELDGTENKSKLGANAILGVSIAAARAG 122

Query: 677 AAEKEVPLYKHIADL-SGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           A EK VPLY+HIA L S     +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AGEKGVPLYEHIASLASSPQPYVLPVPFLNVLNGGSHAGGRLAIQEFMIAP 173



>gb:AB091508_1525051 Penicillium chrysogenum mRNA for enolase,
           complete cds.
          Length = 438

 Score =  172 bits (437), Expect = 5e-42
 Identities = 93/171 (54%), Positives = 119/171 (69%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ AR + DSRG PTVEVD+ T  G+ RA  PSGAS G++E +ELRD DK  + G GV
Sbjct: 3   ISKIHARSVYDSRGNPTVEVDVVTETGLHRAIVPSGASTGLHEVVELRDGDKTKWGGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AVKN+N+ I  ALI   +D   Q+++D+ +  LD T  KG+LGANAIL VS+A  KA 
Sbjct: 63  LNAVKNVNDVIGPALIKENIDVKDQAKVDEFLNKLDGTPNKGKLGANAILGVSLAVAKAA 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY HI+DL+G K   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKGVPLYAHISDLAGTKKPFVLPVPFQNVLNGGSHAGGRLAFQEFMIVP 173



>gb:CP000020_872251 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 432

 Score =  172 bits (437), Expect = 5e-42
 Identities = 91/172 (52%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I K+  R+I+DSRG PTVE +++   G    A+APSGAS G  EA+ELRD DK  +LG
Sbjct: 2   SKIVKVLGREIIDSRGNPTVEAEVHLESGFVGMAAAPSGASTGSREALELRDGDKARFLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV  +N  I+EAL+G D   Q++IDQ MIDLD T+ K   GANAILAVS+A  KA
Sbjct: 62  KGVLKAVAAVNGPIAEALVGKDAKNQAEIDQIMIDLDGTDNKANFGANAILAVSLANAKA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLL-LPVPAFTLISGGKHAGNNLAVQEIMILP 826
            AA K +PLY HIA+L+G   +  +P+P   +I+GG+HA NN+ +QE MI P
Sbjct: 122 AAAAKSMPLYAHIAELNGTPGVFSMPLPMMNIINGGEHADNNVDIQEFMIQP 173



>gb:AE004969_60374 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 428

 Score =  172 bits (437), Expect = 5e-42
 Identities = 93/171 (54%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR+ILDSRG PTVE D+    G M RA+ PSGAS G  EA+ELRD DK  Y G
Sbjct: 2   SAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+++N +I++ALIG+D   QS IDQ MI+LD TE KG LGANA LAVSMA  +A
Sbjct: 62  KGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A +  +PLY++   L G   + LPVP   +I+GG+HA N+L +QE MI+P
Sbjct: 122 AAEDSGLPLYRY---LGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMP 169



>pir|A01148|NOBY2 phosphopyruvate hydratase (EC 4.2.1.11) 2 - yeast 
           (Saccharomyces cerevisiae)>gb:YSCENOB_1728863 Yeast (S.
           cerevisiae) enolase gene (clone peno8) and
           flanks.>gb:YSCH9986_1729264 Saccharomyces cerevisiae
           chromosome VIII cosmid 9986.
          Length = 437

 Score =  172 bits (437), Expect = 5e-42
 Identities = 91/172 (52%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  ++G GV
Sbjct: 3   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDEDKSKWMGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N  I+ A +   +D   Q  +D  ++ LD T  K +LGANAIL VSMAA +A 
Sbjct: 63  MNAVNNVNNVIAAAFVKANLDVKDQKAVDDFLLSLDGTANKSKLGANAILGVSMAAARAA 122

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+H+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 123 AAEKNVPLYQHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAP 174



>sp|Q9JZ53|ENO_NEIMB Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|D81100|D81100 enolase NMB1285
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002477_46706 Neisseria meningitidis
           serogroup B strain MC58 section 119 of 206 of the
           complete genome.>gb:AE002098_896819 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 428

 Score =  172 bits (437), Expect = 5e-42
 Identities = 93/171 (54%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR+ILDSRG PTVE D+    G M RA+ PSGAS G  EA+ELRD DK  Y G
Sbjct: 2   SAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+++N +I++ALIG+D   QS IDQ MI+LD TE KG LGANA LAVSMA  +A
Sbjct: 62  KGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A +  +PLY++   L G   + LPVP   +I+GG+HA N+L +QE MI+P
Sbjct: 122 AAEDSGLPLYRY---LGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMP 169



>sp|Q9JU46|ENO_NEIMA Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>pir|A81841|A81841 phosphopyruvate
           hydratase (EC 4.2.1.11) NMA1495 [imported] - Neisseria
           meningitidis (strain Z2491 serogroup
           A)>gb:NMA5Z2491_154384 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 5/7.
          Length = 428

 Score =  172 bits (437), Expect = 5e-42
 Identities = 93/171 (54%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR+ILDSRG PTVE D+    G M RA+ PSGAS G  EA+ELRD DK  Y G
Sbjct: 2   SAIVDIFAREILDSRGNPTVECDVLLESGVMGRAAVPSGASTGQKEALELRDGDKSRYSG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+++N +I++ALIG+D   QS IDQ MI+LD TE KG LGANA LAVSMA  +A
Sbjct: 62  KGVLKAVEHVNNQIAQALIGIDANEQSYIDQIMIELDGTENKGNLGANATLAVSMAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A +  +PLY++   L G   + LPVP   +I+GG+HA N+L +QE MI+P
Sbjct: 122 AAEDSGLPLYRY---LGGAGPMSLPVPMMNVINGGEHANNSLNIQEFMIMP 169



>sp|P00925|ENO2_YEAST Enolase 2 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase).
          Length = 436

 Score =  172 bits (437), Expect = 5e-42
 Identities = 91/172 (52%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ++K+ AR + DSRG PTVEV+L T KG+FR+  PSGAS G++EA+E+RD DK  ++G GV
Sbjct: 2   VSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGVHEALEMRDEDKSKWMGKGV 61

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
             AV N+N  I+ A +   +D   Q  +D  ++ LD T  K +LGANAIL VSMAA +A 
Sbjct: 62  MNAVNNVNNVIAAAFVKANLDVKDQKAVDDFLLSLDGTANKSKLGANAILGVSMAAARAA 121

Query: 677 AAEKEVPLYKHIADLS-GKTN-LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY+H+ADLS  KT+  +LPVP   +++GG HAG  LA+QE MI P
Sbjct: 122 AAEKNVPLYQHLADLSKSKTSPYVLPVPFLNVLNGGSHAGGALALQEFMIAP 173



>gb:CR382136_1668681 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 439

 Score =  172 bits (436), Expect = 7e-42
 Identities = 92/172 (53%), Positives = 120/172 (69%), Gaps = 4/172 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ +R + DSRG PTVEVD+ T  G+FRA  PSGAS G+ EA+ELRD DK  + G GV
Sbjct: 3   ISKVHSRYVYDSRGNPTVEVDVTTENGLFRAIVPSGASTGINEAMELRDGDKSKWQGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+N+ I+  LI  G+D   Q +ID  ++ LD T  K  LGANAIL VS+A  KAG
Sbjct: 63  TKAVDNVNKTIAPHLIKSGLDEKNQEEIDSFLLKLDGTPNKRSLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADL--SGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AA K+VPLY+HIAD+  S +   +LPVP   +++GG HAG +LA QE MI P
Sbjct: 123 AAAKQVPLYRHIADISKSKQDKYVLPVPFQNVLNGGSHAGGSLAFQEFMIAP 174



>gb:CHU82438_1647470 Cladosporium herbarum enolase gene, complete
           cds.
          Length = 440

 Score =  172 bits (436), Expect = 7e-42
 Identities = 93/171 (54%), Positives = 117/171 (68%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ +R + DSRG PTVEVD+ T  G+ RA  PSGAS G +EA ELRD DK  + G GV
Sbjct: 3   ISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWAGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+NE I+ ALI   +D   Q+ +D  +  LD T  K ++GANAIL VSMA  KA 
Sbjct: 63  TKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAKAA 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY HI+DLSG K   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173



>gb:BA000043_739631 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 430

 Score =  172 bits (436), Expect = 7e-42
 Identities = 90/171 (52%), Positives = 120/171 (70%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G YEA+ELRD DK  YLG
Sbjct: 2   SAIIDVYAREVLDSRGNPTVEVEVYTEDGGFGRALVPSGASTGEYEAVELRDGDKNRYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV+N+NE I+  +IG++   Q  ID+ +I+LD TE K +LGANAIL VS+A  +A
Sbjct: 62  KGVLKAVENVNEIIAPEIIGLEVADQVAIDRKLIELDGTENKSKLGANAILGVSLAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E  +PLY+++   + KT   LPVP   +++GG HA NN+ +QE MI+P
Sbjct: 122 AADELGLPLYQYLGGFNAKT---LPVPMMNILNGGAHADNNVDIQEFMIMP 169



>sp|Q8Y0B5|ENO_RALSO Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AL646062_546057 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 6/19.
          Length = 427

 Score =  172 bits (436), Expect = 7e-42
 Identities = 90/171 (52%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKG-MFRASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  +  R++LDSRG PTVE D+    G M RA+ PSGAS G  EAIELRD DKG YLG
Sbjct: 2   SAIVDIIGREVLDSRGNPTVECDVLLESGVMGRAAVPSGASTGSREAIELRDGDKGRYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV +AV++IN +ISEA++G+D + Q+ +D+ +IDLD TE KG LGANA LAVSMA  KA
Sbjct: 62  KGVLKAVEHINTEISEAIMGLDASEQAFLDRTLIDLDGTENKGRLGANATLAVSMAVAKA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E  +PLY++     G   + +PVP   +++GG HA N+L +QE M++P
Sbjct: 122 AAEEAGLPLYRY---FGGSGAMQMPVPMMNIVNGGAHANNSLDIQEFMVMP 169



>sp|P42040|ENO_CLAHE Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate hydro-lyase)
           (Allergen Cla h 6) (Cla h VI).
          Length = 440

 Score =  172 bits (436), Expect = 7e-42
 Identities = 93/171 (54%), Positives = 117/171 (68%), Gaps = 3/171 (1%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           I+K+ +R + DSRG PTVEVD+ T  G+ RA  PSGAS G +EA ELRD DK  + G GV
Sbjct: 3   ISKIHSRYVYDSRGNPTVEVDIVTETGLHRAIVPSGASTGSHEACELRDGDKSKWAGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
           ++AV N+NE I+ ALI   +D   Q+ +D  +  LD T  K ++GANAIL VSMA  KA 
Sbjct: 63  TKAVANVNEIIAPALIKENLDVKDQAAVDAFLNKLDGTTNKTKIGANAILGVSMAVAKAA 122

Query: 677 AAEKEVPLYKHIADLSG-KTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           AAEK VPLY HI+DLSG K   +LPVP   +++GG HAG  LA QE MI+P
Sbjct: 123 AAEKRVPLYAHISDLSGTKKPFVLPVPFMNVVNGGSHAGGRLAFQEFMIVP 173



>sp|Q05524|ENOL_HUMAN Alpha enolase, lung specific (EC 4.2.1.11)
           (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase)
           (NNE) (Phosphopyruvate hydratase)
           (HLE1).>pir|I37360|I37360 phosphopyruvate hydratase (EC
           4.2.1.11), lung - human>gb:HSENOL_2012999 H.sapiens mRNA
           for enolase.
          Length = 458

 Score =  172 bits (436), Expect = 7e-42
 Identities = 103/180 (57%), Positives = 131/180 (72%), Gaps = 10/180 (5%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF--RASAPSGASLGMYEAI-ELRDADKGTY 487
           S++  + AR I +SRG PTVEVDLYTNKG    RA+ PSGAS G+YEA+ ELRD DK  Y
Sbjct: 2   SILKIIHARDIFESRGNPTVEVDLYTNKGGLFGRAAVPSGASTGIYEALLELRDNDKTRY 61

Query: 488 LGN-GVSRAVKNI-NEKISEALIGMDPTL--QSQIDQAMIDLDKTEKKGELGANAILAVS 655
           +G  GVS+AV++I N+ I+ ALI  +  +  Q +ID  M+D+D +E K + GANAIL VS
Sbjct: 62  MGGKGVSKAVEHIINKTIAPALISKNVNVVEQDKIDNLMLDMDGSENKSKFGANAILGVS 121

Query: 656 MAACK-AGA-AEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +A C  AGA AEK VPLY+HIADL+G    ++LPVPAF +I+GG HAGN LA+QE MI P
Sbjct: 122 LAVCSNAGATAEKGVPLYRHIADLAGNNPEVILPVPAFNVINGGSHAGNKLAMQEFMIPP 181



>gb:AF375333_1266654 Coleobothrus germeauxi enolase (Eno1ni) gene,
           partial cds.
          Length = 223

 Score =  172 bits (435), Expect = 9e-42
 Identities = 86/149 (57%), Positives = 109/149 (73%), Gaps = 2/149 (1%)
 Frame = +2

Query: 386 LYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMD 559
           L T  G+F A+ PSGAS G++EA+ELRD     Y+G GVS+AV N+N  I   L+    D
Sbjct: 1   LITELGLFTAAVPSGASTGVHEALELRDDIADQYMGKGVSKAVDNVNNSIGPELVKQDFD 60

Query: 560 PTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNL 739
            T Q +ID+ MI LD TE K + GANAIL VS+A CKAGAA++ +PLY+HIADL+G  N+
Sbjct: 61  VTQQEEIDEFMIKLDGTENKSKFGANAILGVSLAVCKAGAAKRGLPLYRHIADLAGNKNI 120

Query: 740 LLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           +LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 ILPVPAFNVINGGSHAGNKLAMQEFMILP 149



>gb:AF025805_1234142 Drosophila pseudoobscura enolase (Eno) mRNA,
           partial cds.
          Length = 413

 Score =  172 bits (435), Expect = 9e-42
 Identities = 86/152 (56%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query: 377 EVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI-- 550
           EVDL T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V +AV ++N+ +   +I  
Sbjct: 1   EVDLTTENGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKAVAHVNDTLGPEVIKA 60

Query: 551 GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGK 730
            +D   Q+ +D  MI LD TE K + GANAIL +S+A  KAGAA+K VPLYKHIADL+G 
Sbjct: 61  NLDVVDQAAVDNFMIKLDGTENKSKFGANAILGISLAVAKAGAAKKNVPLYKHIADLAGN 120

Query: 731 TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
             ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 KEIILPVPAFNVINGGSHAGNKLAMQEFMILP 152



>gb:ECENO_125496 E.coli eno gene.
          Length = 437

 Score =  172 bits (435), Expect = 9e-42
 Identities = 93/172 (54%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I K+  R+I+DSRG PTVE +++   G    A+APSGAS G  EA+ELRD DK  +LG
Sbjct: 2   SKIVKIIGREIIDSRGNPTVEAEVHLEGGFVGMAAAPSGASTGSREALELRDGDKSRFLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV++AV  +N  I++ALIG D   Q+ ID+ MIDLD TEKK + GANAILAVS+A  KA
Sbjct: 62  KGVTKAVAAVNGPIAQALIGKDAKDQAGIDKIMIDLDGTEKKSKFGANAILAVSLANAKA 121

Query: 674 GAAEKEVPLYKHIADLSGKT-NLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            AA K +PLY+HIA+L+G      +PVP   +I+GG+HA NN+ +QE MI P
Sbjct: 122 AAAAKGMPLYEHIAELNGTPGKYSMPVPMMNIINGGEHADNNVDIQEFMIQP 173



>sp|Q88YH3|ENOA_LACPL Enolase 1 (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase 1) (2-phospho- D-glycerate hydro-lyase
           1).>gb:LPL567908_141861 Lactobacillus plantarum cggR
           gene, gap gene, pgk gene, tpi gene and eno
           genes.>gb:AL935254_550726 Lactobacillus plantarum strain
           WCFS1 complete genome; segment 3/11.
          Length = 442

 Score =  172 bits (435), Expect = 9e-42
 Identities = 91/171 (53%), Positives = 119/171 (69%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S+IT + AR++LDSRG PTVEV+LYT  G F R   PSGAS G +EA+ELRD DK  ++G
Sbjct: 2   SIITDIYAREVLDSRGNPTVEVELYTESGAFGRGIVPSGASTGEHEAVELRDGDKSRFMG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV++AV N+N+ I++ ++G D T Q  IDQAMI LD T  K +LGANAIL VS+AA +A
Sbjct: 62  KGVTKAVDNVNKLIAKEIVGYDVTDQRAIDQAMIKLDGTPNKAKLGANAILGVSIAAARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A E E+PLY +   L G    +LP P   +I+GG HA N++  QE MI+P
Sbjct: 122 AADELEMPLYNY---LGGFNAHVLPTPMMNVINGGAHANNDVDFQEFMIMP 169



>gb:AF375290_1266624 Xylosandrus sp. SCY05 enolase (Eno2i) gene,
           partial cds.
          Length = 224

 Score =  171 bits (434), Expect = 1e-41
 Identities = 86/142 (60%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +2

Query: 407 FRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMDPTLQSQI 580
           FRA+ PSGA+ G+YEA+ELRD DK  Y G  V +A+ NIN+ I+  LI  G++ T Q++I
Sbjct: 1   FRAAVPSGATTGIYEALELRDNDKSAYHGKSVQKAIDNINKIIAPDLIKTGLEVTQQTEI 60

Query: 581 DQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLLPVPAF 760
            + MI LD TE K +LGANAIL VS+A  KAGAA+K +PLYKH+ADL+G TN++LPVPAF
Sbjct: 61  XEFMIKLDGTENKEKLGANAILGVSLAVAKAGAAKKGIPLYKHLADLAGNTNIILPVPAF 120

Query: 761 TLISGGKHAGNNLAVQEIMILP 826
            +I+GG HAGN LA+QE MILP
Sbjct: 121 NVINGGSHAGNKLAMQEFMILP 142



>gb:AF258669_1256777 Scolopendra polymorpha enolase mRNA, partial
           cds.
          Length = 384

 Score =  171 bits (434), Expect = 1e-41
 Identities = 89/150 (59%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = +2

Query: 383 DLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALIG--M 556
           DL T KG+FRA+ PSGAS G++EA+ELRD DK  + G GV +AV +IN +I+ ALI    
Sbjct: 1   DLVTEKGLFRAAVPSGASTGVHEALELRDDDKKVHHGKGVLKAVCHINNEIAPALIAKNF 60

Query: 557 DPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTN 736
           D T Q +ID  MI  D TE K   GANAIL VS+A CKAGAA K +PLYK+IA+L+G   
Sbjct: 61  DITNQKEIDDYMICCDGTENKSNFGANAILGVSLAVCKAGAAHKGIPLYKYIAELAGNEK 120

Query: 737 LLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
           ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 IVLPVPAFNVINGGSHAGNKLAMQEFMILP 150



>gb:AF025806_1234143 Drosophila subobscura enolase (Eno) mRNA,
           partial cds.
          Length = 413

 Score =  171 bits (434), Expect = 1e-41
 Identities = 86/152 (56%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query: 377 EVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI-- 550
           EVDL T  G+FRA+ PSGAS G++EA+ELRD DK  Y G  V +AV ++N+ +   +I  
Sbjct: 1   EVDLTTEHGLFRAAVPSGASTGVHEALELRDNDKANYHGKSVLKAVAHVNDTLGPEVIKA 60

Query: 551 GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGK 730
            +D   Q+ +D  MI LD TE K + GANAIL +S+A  KAGAA+K VPLYKHIADL+G 
Sbjct: 61  NLDVVDQAAVDNFMIKLDGTENKSKFGANAILGISLAVAKAGAAKKNVPLYKHIADLAGN 120

Query: 731 TNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
             ++LPVPAF +I+GG HAGN LA+QE MILP
Sbjct: 121 KEIILPVPAFNVINGGSHAGNKLAMQEFMILP 152



>gb:CP000001_855415 Bacillus cereus ZK, complete genome.
          Length = 431

 Score =  171 bits (434), Expect = 1e-41
 Identities = 92/171 (53%), Positives = 115/171 (67%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G +EA+ELRD DK  YLG
Sbjct: 2   STIIDVYAREVLDSRGNPTVEVEVYTESGAFGRAIVPSGASTGEHEAVELRDGDKSRYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV  AV N+NE I+  ++G D T Q+ ID+AMI+LD T  KG+LGANAIL VSMA   A
Sbjct: 62  KGVMNAVNNVNEAIAPEIVGFDVTDQAGIDRAMIELDGTPNKGKLGANAILGVSMAVAHA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A    +PLY+++   + K    LP P   +I+GG HA NN+  QE MILP
Sbjct: 122 AADFVGLPLYRYLGGFNAKQ---LPTPMMNIINGGSHADNNVDFQEFMILP 169



>gb:AE017040_385266 Bacillus anthracis str. Ames section 17 of 18 of
           the complete genome.>gb:AE017225_410351 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_455113 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_466099 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1014971 Bacillus anthracis str. Ames
           complete genome.
          Length = 431

 Score =  171 bits (434), Expect = 1e-41
 Identities = 92/171 (53%), Positives = 115/171 (67%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S I  + AR++LDSRG PTVEV++YT  G F RA  PSGAS G +EA+ELRD DK  YLG
Sbjct: 2   STIIDVYAREVLDSRGNPTVEVEVYTESGAFGRAIVPSGASTGEHEAVELRDGDKSRYLG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV  AV N+NE I+  ++G D T Q+ ID+AMI+LD T  KG+LGANAIL VSMA   A
Sbjct: 62  KGVMNAVNNVNEAIAPEIVGFDVTDQAGIDRAMIELDGTPNKGKLGANAILGVSMAVAHA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A    +PLY+++   + K    LP P   +I+GG HA NN+  QE MILP
Sbjct: 122 AADFVGLPLYRYLGGFNAKQ---LPTPMMNIINGGSHADNNVDFQEFMILP 169



>sp|Q8GR70|ENO_ENTHR Enolase (EC 4.2.1.11) (2-phosphoglycerate
           dehydratase) (2-phospho-D- glycerate
           hydro-lyase).>gb:AB091345_12218 Enterococcus hirae eno
           gene for enolase, complete cds.
          Length = 432

 Score =  171 bits (434), Expect = 1e-41
 Identities = 93/171 (54%), Positives = 116/171 (67%), Gaps = 1/171 (0%)
 Frame = +2

Query: 317 SVITKLKARQILDSRGIPTVEVDLYTNKGMF-RASAPSGASLGMYEAIELRDADKGTYLG 493
           S+IT + AR+ILDSRG PT+EV++YT  G F R   PSGAS G YEA+ELRD DK  Y G
Sbjct: 2   SIITDVYAREILDSRGNPTIEVEVYTESGAFGRGMVPSGASTGEYEAVELRDGDKARYGG 61

Query: 494 NGVSRAVKNINEKISEALIGMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKA 673
            GV++AV N+N  I+EA+IG D   Q  ID+AMI LD T  KG+LGANAIL VS+A  +A
Sbjct: 62  KGVTKAVDNVNNIIAEAIIGYDVRDQMAIDKAMIALDGTPNKGKLGANAILGVSIAVARA 121

Query: 674 GAAEKEVPLYKHIADLSGKTNLLLPVPAFTLISGGKHAGNNLAVQEIMILP 826
            A   EVPLY +   L G    +LP P   +I+GG HA N++  QE MI+P
Sbjct: 122 AADYLEVPLYHY---LGGFNTKVLPTPMMNIINGGSHADNSIDFQEFMIMP 169



>gb:CET21B10_1367893 Caenorhabditis elegans cosmid T21B10, complete
           sequence.
          Length = 337

 Score =  171 bits (433), Expect = 2e-41
 Identities = 93/158 (58%), Positives = 114/158 (72%), Gaps = 4/158 (2%)
 Frame = +2

Query: 323 ITKLKARQILDSRGIPTVEVDLYTNKGMFRASAPSGASLGMYEAIELRDADKGTYLGNGV 502
           ITK+ ARQI DSRG PTVEVDL+T KG+FRA+ PSGAS G++EA+ELRD DK  +LG GV
Sbjct: 3   ITKIHARQIYDSRGNPTVEVDLFTEKGVFRAAVPSGASTGVHEALELRDGDKAVHLGKGV 62

Query: 503 SRAVKNINEKISEALI--GMDPTLQSQIDQAMIDLDKTEKKGELGANAILAVSMAACKAG 676
            +AV NINEKI+ ALI  G D T Q  ID  M+ LD +E KG LGANAIL VS+A  KAG
Sbjct: 63  LKAVSNINEKIAPALIAKGFDVTAQKDIDDFMMALDGSENKGNLGANAILGVSLAVAKAG 122

Query: 677 AAEKEVPLYKHIADL--SGKTNLLLPVPAFTLISGGKH 784
           A  K +PLYK+IA+L  +GK ++ + V A      GK+
Sbjct: 123 AVHKGLPLYKYIAELAGTGKISIGMDVAASEFFKDGKY 160



>gb:AF375283_1266617 Coccotrypes dactyliperda enolase (Eno2i) gene,
           partial cds.
          Length = 269

 Score =  171 bits (433), Expect = 2e-41
 Identities = 84/144 (58%), Positives = 109/144 (75%), Gaps = 2/144 (1%)
 Frame = +2

Query: 401 GMFRASAPSGASLGMYEAIELRDADKGTYLGNGVSRAVKNINEKISEALI--GMDPTLQS 574
           G+FRA+ PSGAS G+YEA+ELRD DK  Y G  V +A+ NIN+ ++  LI  G++ T  +
Sbjct: 3   GLFRAAVPSGASTGIYEALELRDNDKSRYHGKSVQKAIDNINKIVAPELIKTGLEVTQPT 62

Query: 575 QIDQAMIDLDKTEKKGELGANAILAVSMAACKAGAAEKEVPLYKHIADLSGKTNLLLPVP 754
           +ID+ MI LD  E K + GANAIL VS+A  KAGAA+K +PLYKH+ADL+G  N++LPVP
Sbjct: 63  EIDEFMIKLDGAENKSKFGANAILGVSLAVAKAGAAKKGIPLYKHLADLAGNANIILPVP 122

Query: 755 AFTLISGGKHAGNNLAVQEIMILP 826
           AF +I+GG HAGN LA+QE MILP
Sbjct: 123 AFNVINGGSHAGNKLAMQEFMILP 146


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 867,921,281
Number of Sequences: 1806583
Number of extensions: 18256686
Number of successful extensions: 55480
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 52508
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54482
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 54315948166
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)