BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig2142
         (750 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003628_1831709 Oryza sativa (japonica cultivar-group) genom...    53   7e-06   
gb:BX842630_1643952 Neurospora crassa DNA linkage group I BAC co...    37   0.29    
gb:CR382130_1662563 Yarrowia lipolytica chromosome D of strain C...    34   2.5     
gb:AB009050_1510627 Arabidopsis thaliana genomic DNA, chromosome...    34   3.3     
gb:U41016_1403672 Caenorhabditis elegans cosmid R11G1, complete ...    34   3.3     
pir|T16721|T16721 hypothetical protein R11G1.5 - Caenorhabditis ...    34   3.3     Caenorhabditis elegans [roundworm]
gb:BC077350_2560063 Xenopus laevis MGC81192 protein, mRNA (cDNA ...    33   5.6     
gb:AE012944_287401 Chlorobium tepidum TLS section 165 of 194 of ...    33   7.3     
gb:AY051783_1290377 Drosophila melanogaster LD30441 full length ...    32   9.5     
gb:AE014297_1141158 Drosophila melanogaster chromosome 3R, compl...    32   9.5     
gb:AE014297_1137895 Drosophila melanogaster chromosome 3R, compl...    32   9.5     
gb:AE017266_421841 Bacillus cereus ATCC 10987, section 3 of 18 o...    32   9.5     
sp|P39768|OPA_DROME|OPA_DROME Pair-rule protein odd-paired.>pir|A49839|A49...    32   9.5     Drosophila melanogaster


>gb:AP003628_1831709 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0473H04.
          Length = 436

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 41/119 (34%), Positives = 57/119 (47%), Gaps = 5/119 (4%)
 Frame = +1

Query: 343 AGHGRGVPLPISVPSPSQQRMSLQQPQHKFFVAGEESSDSQTKAXXXXXXXXXXXXXXXG 522
           AG GRG P P+   +P Q       P   F     E+S S+                  G
Sbjct: 95  AGRGRGSPPPLGEVAPKQP-----VPAKLFDAPAAEASSSEPPPPPPPRTLPSA-----G 144

Query: 523 AGRGKPTVTPPVSEKPKEENRHLRAR-KTPQAESSKLPS----PRLSREEAVKKAVGIL 684
           AGRG P +  P  E P+EENR +R R +  +A S+  P+    P+LS E+AVK+A+ +L
Sbjct: 145 AGRGVPRMQQPPVEMPQEENRFIRRREEKKKAASAARPAPSGQPKLSPEDAVKRAMELL 203



>gb:BX842630_1643952 Neurospora crassa DNA linkage group I BAC
           contig B13D15.
          Length = 472

 Score = 37.4 bits (85), Expect = 0.29
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = +2

Query: 332 PPPPLATAEVFPYQFLFHHHPNSGCHCNSRNISSSWQEKSLRIPKP 469
           PPPP       PY  L HHHPN+    NS N+ S+    +   PKP
Sbjct: 77  PPPPPPPPPPPPYHLLDHHHPNT-IEANSVNVHSANNVPNTTTPKP 121



>gb:CR382130_1662563 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1061

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = +1

Query: 529  RGKPTVTPPVSEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAVG 678
            R KP  +PPV   PK +   LR+     A + +LP P LS+   +   +G
Sbjct: 992  RRKPIGSPPVKPMPKPKPSSLRSASAVSATAPQLPIPELSQTSLLDMPIG 1041



>gb:AB009050_1510627 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDF20.
          Length = 759

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 19/71 (26%), Positives = 27/71 (38%)
 Frame = +1

Query: 436 VAGEESSDSQTKAXXXXXXXXXXXXXXXGAGRGKPTVTPPVSEKPKEENRHLRARKTPQA 615
           V  EE S+ +TK                G  R K T  P  S  PK+  +   A K  ++
Sbjct: 555 VESEEESEEETKKKKRGSRTSSDKKESAGKSRSKKTAVPTKSSPPKKATQKRSAGKRKKS 614

Query: 616 ESSKLPSPRLS 648
           +     SP+ S
Sbjct: 615 DDDSDTSPKAS 625



>gb:U41016_1403672 Caenorhabditis elegans cosmid R11G1, complete
            sequence.
          Length = 1656

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 27/107 (25%), Positives = 42/107 (39%)
 Frame = +1

Query: 355  RGVPLPISVPSPSQQRMSLQQPQHKFFVAGEESSDSQTKAXXXXXXXXXXXXXXXGAGRG 534
            RG+ LP+S  +P      L++     F   E S DS+ K                     
Sbjct: 1184 RGIELPLSPKTPIPIATELEKAASANFATAETSEDSEVK--------------------- 1222

Query: 535  KPTVTPPVSEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAV 675
                 P   +KP  E+R   A+ +  ++ SK+PS   SR  + KK +
Sbjct: 1223 --PYQPQTPKKP--ESRKSSAKSSASSKRSKIPSTSQSRVGSAKKQI 1265



>pir|T16721|T16721 hypothetical protein R11G1.5 - Caenorhabditis
           elegans
          Length = 435

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 27/107 (25%), Positives = 42/107 (39%)
 Frame = +1

Query: 355 RGVPLPISVPSPSQQRMSLQQPQHKFFVAGEESSDSQTKAXXXXXXXXXXXXXXXGAGRG 534
           RG+ LP+S  +P      L++     F   E S DS+ K                     
Sbjct: 56  RGIELPLSPKTPIPIATELEKAASANFATAETSEDSEVK--------------------- 94

Query: 535 KPTVTPPVSEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAV 675
                P   +KP  E+R   A+ +  ++ SK+PS   SR  + KK +
Sbjct: 95  --PYQPQTPKKP--ESRKSSAKSSASSKRSKIPSTSQSRVGSAKKQI 137



>gb:BC077350_2560063 Xenopus laevis MGC81192 protein, mRNA (cDNA
           clone MGC:81192 IMAGE:6318409), complete cds.
          Length = 1270

 Score = 33.1 bits (74), Expect = 5.6
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +1

Query: 532 GKPTVTPPVSEKPKEENRHLRARKTPQAESSKLPSPR 642
           G P+ TPP S++P E   H   R TPQ  ++  P+PR
Sbjct: 538 GNPSQTPP-SQRPPEIQEHKPLRTTPQNRAAFRPTPR 573



>gb:AE012944_287401 Chlorobium tepidum TLS section 165 of 194 of the
           complete genome.>gb:AE006470_934569 Chlorobium tepidum
           TLS complete genome.
          Length = 680

 Score = 32.7 bits (73), Expect = 7.3
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = +1

Query: 520 GAGRGKPTVTPPVSEKPKEENRHLRARKTP 609
           G+G GK +  PP +E P+EE    + RK+P
Sbjct: 328 GSGGGKKSSRPPANESPREERSTAKERKSP 357



>gb:AY051783_1290377 Drosophila melanogaster LD30441 full length
           cDNA.
          Length = 609

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 14/52 (26%), Positives = 22/52 (42%)
 Frame = -3

Query: 355 GRGQRGWRQKHYPPQTDLXXXXXXXXXXRFHGHAQFHSVAVGQQLTYHPSHH 200
           G GQ  +   H+  Q  +           ++ H  F + AV   + +HPSHH
Sbjct: 127 GFGQHPFHSHHHHHQMRMGMADAYAAGHPYNHHGNFPTAAVHHPVVHHPSHH 178



>gb:AE014297_1141158 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003747_1223151 Drosophila melanogaster
            chromosome 3R, section 85 of 118 of the complete
            sequence.>gb:AY061461_1293264 Drosophila melanogaster
            LD41803 full length cDNA.
          Length = 1430

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 23/103 (22%), Positives = 45/103 (43%), Gaps = 2/103 (1%)
 Frame = +1

Query: 385  SPSQQRMSLQQP--QHKFFVAGEESSDSQTKAXXXXXXXXXXXXXXXGAGRGKPTVTPPV 558
            SP Q++ ++++   Q K     +  + ++ KA               G  + +P     V
Sbjct: 998  SPKQKKTTIEETSAQKKVKAKAKVETKTEAKAIPTKRKAEVVEKITNGQKKTQPLTNGIV 1057

Query: 559  SEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAVGILS 687
             EKPK+  +     KTP A+++K  +P+ +  E   +  G+ S
Sbjct: 1058 KEKPKQNGKLFFEDKTP-AKNAKSETPKSNGAEGKSRLPGVSS 1099



>gb:AE014297_1137895 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003604_1217509 Drosophila melanogaster
           chromosome 3R, section 4 of 118 of the complete
           sequence.
          Length = 609

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 14/52 (26%), Positives = 22/52 (42%)
 Frame = -3

Query: 355 GRGQRGWRQKHYPPQTDLXXXXXXXXXXRFHGHAQFHSVAVGQQLTYHPSHH 200
           G GQ  +   H+  Q  +           ++ H  F + AV   + +HPSHH
Sbjct: 127 GFGQHPFHSHHHHHQMRMGMADAYAAGHPYNHHGNFPTAAVHHPVVHHPSHH 178



>gb:AE017266_421841 Bacillus cereus ATCC 10987, section 3 of 18 of the
            complete genome.>gb:AE017194_1060260 Bacillus cereus ATCC
            10987, complete genome.
          Length = 1088

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +1

Query: 541  TVTPPVSEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAV 675
            T  P V EKPKEE       + P+ E+SK       +EE  K AV
Sbjct: 952  TSKPVVEEKPKEETTKPAVEEKPKEETSKPVVEEKPKEETTKPAV 996



 Score = 32.3 bits (72), Expect = 9.5
 Identities = 18/45 (40%), Positives = 22/45 (48%)
 Frame = +1

Query: 541  TVTPPVSEKPKEENRHLRARKTPQAESSKLPSPRLSREEAVKKAV 675
            T  P V EKPKEE       + P+ E+SK       +EE  K AV
Sbjct: 926  TTKPVVEEKPKEETTKPVVEEKPKEETSKPVVEEKPKEETTKPAV 970



>sp|P39768|OPA_DROME Pair-rule protein odd-paired.>pir|A49839|A49839
           odd-paired - fruit fly (Drosophila
           melanogaster)>gb:DMU04435_1380337 Drosophila
           melanogaster GLI-Kr zinc finger pair-rule protein mRNA,
           complete cds.>gb:S78339_1396936 opa=odd-paired
           [Drosophila, embryo, mRNA, 2959 nt].
          Length = 609

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 14/52 (26%), Positives = 22/52 (42%)
 Frame = -3

Query: 355 GRGQRGWRQKHYPPQTDLXXXXXXXXXXRFHGHAQFHSVAVGQQLTYHPSHH 200
           G GQ  +   H+  Q  +           ++ H  F + AV   + +HPSHH
Sbjct: 127 GFGQHPFHSHHHHHQMRMGMADAYAAGHPYNHHGNFPTAAVHHPVVHHPSHH 178


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.314    0.129    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 754,806,770
Number of Sequences: 1806583
Number of extensions: 14686951
Number of successful extensions: 39258
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 37275
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39172
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46505143296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)